4H2YC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Ligase
total genus 21
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2yC00
2KWLA 3EJBA 1T8KA 2CNRA 2CG5B 2FHSC 2LIWA 4BPGA 1VKUA 2KGAA 2FQ0A 2FACA 2LIUA 5KP7B 1DNYA 2LOLA 1ACPA 1HY8A 2K92A 2FQ2A 2KG8A 2EHSA 2N5IA 2N6YA 4PXHB 2KOOA 2MVUA 2LMLA 2K94A 2MVVA 2KGCA 2KGEA 2JQ4A 2L0QA 2KORA 2K0XA 3GZMA 2JU2A 4R0MA 2AFDA 2N50A 3LMOA 1KLPA 2FVAA 2MF4A 2FVEA 2FQ1A 2ROQA 5KP8B 2K2QA 1AF8A 2EHTA 2GDYA 2CQ8A 1OR5A 4BPHA 4PWVB 5KP6B 1L0IA 2AVAA 2MD9A 1HQBA 3GZLA 2LL8A 2LPKA 2LTEA 4IZ6A 4CA3A 4H2WC 5EJDA 4H2YC 2K0YA 4DG9A 3EJDA 2DNWA 2AF8A 2KG9A 2MY5A 2GDXA 2GDWA 2MR8A 3CE7A 5CZDB 2L9FA 2N5HA 1L0HA 2XZ0D 5HV8A 2N98A 4HKGA 2FVFA 2KG6A 1DV5A 2KR5A 2FAEA 2JGPA 2JU1A 2N6ZA 3RG2A 1NQ4A 2MR7A 2LKIA 3NY7B 2CGQA 4NEOA 2XZ1C 2X2BA 2KW2A 2KOSA 2L4BA 2KGDA 2L22A 2AFEA 2K93A 2PNGA 5HVCA 4H2XC 1X3OA 4MRTC 1F80D 2VSQA 3EJEA 2M5RA 2QNWA 2FADA 2KOQA 2KOPA 4BPFA
chains in the Genus database with same CATH superfamily
3CCJP 3DS5A 2WPTA 1VKUA 5JPAA 3G26A 2FQ0A 2LIUA 1YJNP 1VQNP 1ACPA 4U0AA 2K92A 2EHSA 2N5IA 1KD1Q 2LMLA 3P05A 2MVVA 4GR6A 5HGMA 2K0XA 1E6JP 1YHQP 2VLQA 3DS3A 1KLPA 5KP8B 3H47A 1VQ5P 1GXGA 3VRLC 1BAJA 2E1MA 5BS1A 2LTEA 4COCA 2PENA 1K9MQ 1K30A 1KC8Q 2GZFA 1VHNA 5DCKA 3GJNA 1RO0A 2P9XA 2MY5A 3G21A 1Q82Q 5HV8A 2ONTA 4F37A 3WBHA 2FAEA 1M1KQ 2PY8A 4U0BA 4NEOA 1IUQA 2M8PA 3GKLC 3CMEP 2K0DX 1Q7YQ 2L22A 2GZGA 2Z45A 2AFEA 1Q86Q 7CEIA 2PNGA 4U0CA 1F80D 2KOPA 2OTLP 2OARA 2DGYA 1T8KA 2K5XA 1D1DA 3MGEA 1QVGO 1YI2P 1VQ6P 2BHVA 2KG8A 2LF4A 1AUMA 4PXHB 2KOOA 3DPHA 3G1IA 2KGCA 4QKOA 2JQ4A 2Z44A 2GZIA 4XFYA 3CCUP 2EFJA 2JU2A 3G71P 1RNIA 1K73Q 2FVEA 2ROQA 2VLNA 1Q81Q 2GDYA 1OR5A 2CQ8A 4BPHA 2VLPA 2GZJA 1VQ7P 1YJWP 3DTJA 2NO8A 3CCEP 3CXCO 1HQBA 1EOQA 1CEIA 2LPKA 4IZ6A 4CA3A 1YIJP 1A43A 4H2YC 3I56P 1UJZA 1VQOP 4PH0A 3DS1A 2KG9A 1W2BO 2GDXA 2GDWA 2MR8A 3CC7P 2L9FA 5I4TG 5EW5E 1L0HA 3CCRP 4HKGA 2FVFA 3H0DA 1DV5A 3RG6C 1A8OA 2N6ZA 2MR7A 2GYKA 4U0FA 1YITP 2XZ1C 2X2BA 2KW2A 2JBGA 2KOSA 2L4BA 3DS2A 1E0HA 4H2XC 3OW2O 1AYIA 4MRTC 2FADA 3CC2P 2KOQA 2EG5A 1M90Q 2KWLA 3EJBA 3CCMP 2CNRA 2FHSC 4BPGA 2KGAA 2FACA 3CMAP 5HGOA 3G0VA 1IMPA 4XRQA 2FQ2A 1S72P 2K94A 3LRYA 2Z46A 2KGEA 2KORA 4COPA 2M8NA 4R0MA 2N50A 2FVAA 2FQ1A 2K2QA 5BS2A 2JYGA 3HYBA 2EHTA 2PEQA 4PWVB 3Q20A 2OTJP 4XROA 3CC4P 3CD6P 3GZLA 3B5IA 1BXIA 4H2WC 5EJDA 1MZ8A 4DG9A 1GXHA 2M8LA 3CCLP 1KQSO 5CZDB 2N5HA 4XFXA 2XZ0D 4GR2A 3E2DA 3H4EA 2KG6A 3B4QA 5F2KA 2KR5A 1NQ4A 2LKIA 3NY7B 2CGQA 3CCSP 2EIAA 2K93A 1M74A 2QEXP 4XFZA 4PH1A 3CCQP 3EJEA 3M1MA 1K8AQ 1VQ8P 1EIAA 1ZMBA 2CG5B 2LIWA 1JJ2O 1VQ4P 4UHPB 3G1GA 2VLOA 4WYMA 1YJ9P 5KP7B 1DNYA 2LOLA 4U0DA 1RO2A 1HY8A 1GPJA 4QNBA 2PEOA 2N6YA 2MVUA 1VQ9P 4U0EA 3G28A 5F2NA 1N8RQ 4IPYA 2QA4P 2L0QA 2PEJA 5HGLA 1UNKA 1EMVA 1ZNVA 2BUOA 1M6NA 3GZMA 3CPWO 1VQLP 2JO0A 2AFDA 3LMOA 2GZEA 2MF4A 5HGNA 3I55P 1AF8A 2JAZA 1QRJA 5KP6B 1L0IA 1Z6MA 2AVAA 3U43A 2MD9A 1NJIQ 2JB0A 2LL8A 2XV6A 2PEIA 3CCVP 2K0YA 2XT1A 3NTEA 1VQMP 3EJDA 2DNWA 3HZQA 2AF8A 3DS4A 3G4SP 3CE7A 2L6EA 1VQKP 2N98A 3G6EP 1FR2A 2XXMA 1VQPP 2JGPA 2JU1A 2ERHA 3RG2A 4M0IA 5F2OA 1QVFO 2PEKA 1M6EX 3G29A 2PEMA 1IMQA 2KGDA 5HVCA 3DS0A 1X3OA 2JYLA 2VSQA 2M5RA 2QNWA 2CWOA 4BPFA 2KODA
chains in the Genus database with same CATH topology
2KWLA 3EJBA 1T8KA 2CNRA 2CG5B 2FHSC 2LIWA 4BPGA 1VKUA 2KGAA 2FQ0A 2FACA 2LIUA 5KP7B 1DNYA 2LOLA 1ACPA 1HY8A 2K92A 2FQ2A 2KG8A 2EHSA 2N5IA 2N6YA 4PXHB 2KOOA 2MVUA 2LMLA 2K94A 2MVVA 2KGCA 2KGEA 2JQ4A 2L0QA 2KORA 2K0XA 3GZMA 2JU2A 4R0MA 2AFDA 2N50A 3LMOA 1KLPA 2FVAA 2MF4A 2FVEA 2FQ1A 2ROQA 5KP8B 2K2QA 1AF8A 2EHTA 2GDYA 2CQ8A 1OR5A 4BPHA 4PWVB 5KP6B 1L0IA 2AVAA 2MD9A 1HQBA 3GZLA 2LL8A 2LPKA 2LTEA 4IZ6A 4CA3A 4H2WC 5EJDA 4H2YC 2K0YA 4DG9A 3EJDA 2DNWA 2AF8A 2KG9A 2MY5A 2GDXA 2GDWA 2MR8A 3CE7A 5CZDB 2L9FA 2N5HA 1L0HA 2XZ0D 5HV8A 2N98A 4HKGA 2FVFA 2KG6A 1DV5A 2KR5A 2FAEA 2JGPA 2JU1A 2N6ZA 3RG2A 1NQ4A 2MR7A 2LKIA 3NY7B 2CGQA 4NEOA 2XZ1C 2X2BA 2KW2A 2KOSA 2L4BA 2KGDA 2L22A 2AFEA 2K93A 2PNGA 5HVCA 4H2XC 1X3OA 4MRTC 1F80D 2VSQA 3EJEA 2M5RA 2QNWA 2FADA 2KOQA 2KOPA 4BPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWL A;  3EJB A;  1T8K A;  2CNR A;  2CG5 B;  2FHS C;  2LIW A;  4BPG A;  1VKU A;  2KGA A;  2FQ0 A;  2FAC A;  2LIU A;  5KP7 B;  1DNY A;  2LOL A;  1ACP A;  1HY8 A;  2K92 A;  2FQ2 A;  2KG8 A;  2EHS A;  2N5I A;  2N6Y A;  4PXH B;  2KOO A;  2MVU A;  2LML A;  2K94 A;  2MVV A;  2KGC A;  2KGE A;  2JQ4 A;  2L0Q A;  2KOR A;  2K0X A;  3GZM A;  2JU2 A;  4R0M A;  2AFD A;  2N50 A;  3LMO A;  1KLP A;  2FVA A;  2MF4 A;  2FVE A;  2FQ1 A;  2ROQ A;  5KP8 B;  2K2Q A;  1AF8 A;  2EHT A;  2GDY A;  2CQ8 A;  1OR5 A;  4BPH A;  4PWV B;  5KP6 B;  1L0I A;  2AVA A;  2MD9 A;  1HQB A;  3GZL A;  2LL8 A;  2LPK A;  2LTE A;  4IZ6 A;  4CA3 A;  4H2W C;  5EJD A;  4H2Y C;  2K0Y A;  4DG9 A;  3EJD A;  2DNW A;  2AF8 A;  2KG9 A;  2MY5 A;  2GDX A;  2GDW A;  2MR8 A;  3CE7 A;  5CZD B;  2L9F A;  2N5H A;  1L0H A;  2XZ0 D;  5HV8 A;  2N98 A;  4HKG A;  2FVF A;  2KG6 A;  1DV5 A;  2KR5 A;  2FAE A;  2JGP A;  2JU1 A;  2N6Z A;  3RG2 A;  1NQ4 A;  2MR7 A;  2LKI A;  3NY7 B;  2CGQ A;  4NEO A;  2XZ1 C;  2X2B A;  2KW2 A;  2KOS A;  2L4B A;  2KGD A;  2L22 A;  2AFE A;  2K93 A;  2PNG A;  5HVC A;  4H2X C;  1X3O A;  4MRT C;  1F80 D;  2VSQ A;  3EJE A;  2M5R A;  2QNW A;  2FAD A;  2KOQ A;  2KOP A;  4BPF A; 
#chains in the Genus database with same CATH topology
 3CCJ P;  3DS5 A;  2WPT A;  1VKU A;  5JPA A;  3G26 A;  2FQ0 A;  2LIU A;  1YJN P;  1VQN P;  1ACP A;  4U0A A;  2K92 A;  2EHS A;  2N5I A;  1KD1 Q;  2LML A;  3P05 A;  2MVV A;  4GR6 A;  5HGM A;  2K0X A;  1E6J P;  1YHQ P;  2VLQ A;  3DS3 A;  1KLP A;  5KP8 B;  3H47 A;  1VQ5 P;  1GXG A;  3VRL C;  1BAJ A;  2E1M A;  5BS1 A;  2LTE A;  4COC A;  2PEN A;  1K9M Q;  1K30 A;  1KC8 Q;  2GZF A;  1VHN A;  5DCK A;  3GJN A;  1RO0 A;  2P9X A;  2MY5 A;  3G21 A;  1Q82 Q;  5HV8 A;  2ONT A;  4F37 A;  3WBH A;  2FAE A;  1M1K Q;  2PY8 A;  4U0B A;  4NEO A;  1IUQ A;  2M8P A;  3GKL C;  3CME P;  2K0D X;  1Q7Y Q;  2L22 A;  2GZG A;  2Z45 A;  2AFE A;  1Q86 Q;  7CEI A;  2PNG A;  4U0C A;  1F80 D;  2KOP A;  2OTL P;  2OAR A;  2DGY A;  1T8K A;  2K5X A;  1D1D A;  3MGE A;  1QVG O;  1YI2 P;  1VQ6 P;  2BHV A;  2KG8 A;  2LF4 A;  1AUM A;  4PXH B;  2KOO A;  3DPH A;  3G1I A;  2KGC A;  4QKO A;  2JQ4 A;  2Z44 A;  2GZI A;  4XFY A;  3CCU P;  2EFJ A;  2JU2 A;  3G71 P;  1RNI A;  1K73 Q;  2FVE A;  2ROQ A;  2VLN A;  1Q81 Q;  2GDY A;  1OR5 A;  2CQ8 A;  4BPH A;  2VLP A;  2GZJ A;  1VQ7 P;  1YJW P;  3DTJ A;  2NO8 A;  3CCE P;  3CXC O;  1HQB A;  1EOQ A;  1CEI A;  2LPK A;  4IZ6 A;  4CA3 A;  1YIJ P;  1A43 A;  4H2Y C;  3I56 P;  1UJZ A;  1VQO P;  4PH0 A;  3DS1 A;  2KG9 A;  1W2B O;  2GDX A;  2GDW A;  2MR8 A;  3CC7 P;  2L9F A;  5I4T G;  5EW5 E;  1L0H A;  3CCR P;  4HKG A;  2FVF A;  3H0D A;  1DV5 A;  3RG6 C;  1A8O A;  2N6Z A;  2MR7 A;  2GYK A;  4U0F A;  1YIT P;  2XZ1 C;  2X2B A;  2KW2 A;  2JBG A;  2KOS A;  2L4B A;  3DS2 A;  1E0H A;  4H2X C;  3OW2 O;  1AYI A;  4MRT C;  2FAD A;  3CC2 P;  2KOQ A;  2EG5 A;  1M90 Q;  2KWL A;  3EJB A;  3CCM P;  2CNR A;  2FHS C;  4BPG A;  2KGA A;  2FAC A;  3CMA P;  5HGO A;  3G0V A;  1IMP A;  4XRQ A;  2FQ2 A;  1S72 P;  2K94 A;  3LRY A;  2Z46 A;  2KGE A;  2KOR A;  4COP A;  2M8N A;  4R0M A;  2N50 A;  2FVA A;  2FQ1 A;  2K2Q A;  5BS2 A;  2JYG A;  3HYB A;  2EHT A;  2PEQ A;  4PWV B;  3Q20 A;  2OTJ P;  4XRO A;  3CC4 P;  3CD6 P;  3GZL A;  3B5I A;  1BXI A;  4H2W C;  5EJD A;  1MZ8 A;  4DG9 A;  1GXH A;  2M8L A;  3CCL P;  1KQS O;  5CZD B;  2N5H A;  4XFX A;  2XZ0 D;  4GR2 A;  3E2D A;  3H4E A;  2KG6 A;  3B4Q A;  5F2K A;  2KR5 A;  1NQ4 A;  2LKI A;  3NY7 B;  2CGQ A;  3CCS P;  2EIA A;  2K93 A;  1M74 A;  2QEX P;  4XFZ A;  4PH1 A;  3CCQ P;  3EJE A;  3M1M A;  1K8A Q;  1VQ8 P;  1EIA A;  1ZMB A;  2CG5 B;  2LIW A;  1JJ2 O;  1VQ4 P;  4UHP B;  3G1G A;  2VLO A;  4WYM A;  1YJ9 P;  5KP7 B;  1DNY A;  2LOL A;  4U0D A;  1RO2 A;  1HY8 A;  1GPJ A;  4QNB A;  2PEO A;  2N6Y A;  2MVU A;  1VQ9 P;  4U0E A;  3G28 A;  5F2N A;  1N8R Q;  4IPY A;  2QA4 P;  2L0Q A;  2PEJ A;  5HGL A;  1UNK A;  1EMV A;  1ZNV A;  2BUO A;  1M6N A;  3GZM A;  3CPW O;  1VQL P;  2JO0 A;  2AFD A;  3LMO A;  2GZE A;  2MF4 A;  5HGN A;  3I55 P;  1AF8 A;  2JAZ A;  1QRJ A;  5KP6 B;  1L0I A;  1Z6M A;  2AVA A;  3U43 A;  2MD9 A;  1NJI Q;  2JB0 A;  2LL8 A;  2XV6 A;  2PEI A;  3CCV P;  2K0Y A;  2XT1 A;  3NTE A;  1VQM P;  3EJD A;  2DNW A;  3HZQ A;  2AF8 A;  3DS4 A;  3G4S P;  3CE7 A;  2L6E A;  1VQK P;  2N98 A;  3G6E P;  1FR2 A;  2XXM A;  1VQP P;  2JGP A;  2JU1 A;  2ERH A;  3RG2 A;  4M0I A;  5F2O A;  1QVF O;  2PEK A;  1M6E X;  3G29 A;  2PEM A;  1IMQ A;  2KGD A;  5HVC A;  3DS0 A;  1X3O A;  2JYL A;  2VSQ A;  2M5R A;  2QNW A;  2CWO A;  4BPF A;  2KOD A; 
#chains in the Genus database with same CATH homology
 2KWL A;  3EJB A;  1T8K A;  2CNR A;  2CG5 B;  2FHS C;  2LIW A;  4BPG A;  1VKU A;  2KGA A;  2FQ0 A;  2FAC A;  2LIU A;  5KP7 B;  1DNY A;  2LOL A;  1ACP A;  1HY8 A;  2K92 A;  2FQ2 A;  2KG8 A;  2EHS A;  2N5I A;  2N6Y A;  4PXH B;  2KOO A;  2MVU A;  2LML A;  2K94 A;  2MVV A;  2KGC A;  2KGE A;  2JQ4 A;  2L0Q A;  2KOR A;  2K0X A;  3GZM A;  2JU2 A;  4R0M A;  2AFD A;  2N50 A;  3LMO A;  1KLP A;  2FVA A;  2MF4 A;  2FVE A;  2FQ1 A;  2ROQ A;  5KP8 B;  2K2Q A;  1AF8 A;  2EHT A;  2GDY A;  2CQ8 A;  1OR5 A;  4BPH A;  4PWV B;  5KP6 B;  1L0I A;  2AVA A;  2MD9 A;  1HQB A;  3GZL A;  2LL8 A;  2LPK A;  2LTE A;  4IZ6 A;  4CA3 A;  4H2W C;  5EJD A;  4H2Y C;  2K0Y A;  4DG9 A;  3EJD A;  2DNW A;  2AF8 A;  2KG9 A;  2MY5 A;  2GDX A;  2GDW A;  2MR8 A;  3CE7 A;  5CZD B;  2L9F A;  2N5H A;  1L0H A;  2XZ0 D;  5HV8 A;  2N98 A;  4HKG A;  2FVF A;  2KG6 A;  1DV5 A;  2KR5 A;  2FAE A;  2JGP A;  2JU1 A;  2N6Z A;  3RG2 A;  1NQ4 A;  2MR7 A;  2LKI A;  3NY7 B;  2CGQ A;  4NEO A;  2XZ1 C;  2X2B A;  2KW2 A;  2KOS A;  2L4B A;  2KGD A;  2L22 A;  2AFE A;  2K93 A;  2PNG A;  5HVC A;  4H2X C;  1X3O A;  4MRT C;  1F80 D;  2VSQ A;  3EJE A;  2M5R A;  2QNW A;  2FAD A;  2KOQ A;  2KOP A;  4BPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...