4H2YC

Crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
77
structure length
77
Chain Sequence
HMNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Amino acid--[acyl-carrier-protein] ligase 1
publication title Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 21
structure length 77
sequence length 77
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4h2yC00
2FQ2A 4IZ6A 4NEOA 2FADA 2LIUA 5HV8A 2K2QA 2L0QA 4BPGA 5KP8B 2LIWA 2MY5A 2KGCA 2KG6A 5KP7B 2KGAA 2MVVA 2EHTA 2JU2A 4R0MA 1ACPA 2CQ8A 2MD9A 5HVCA 2N6ZA 2N6YA 3EJDA 2MVUA 3LMOA 2KG8A 2KORA 1HY8A 2EHSA 2X2BA 2M5RA 1L0HA 2XZ0D 2FVEA 2K0YA 2KOPA 2K0XA 2JGPA 2CG5B 2KOOA 2KOSA 2ROQA 2GDXA 4PWVB 3GZMA 2JQ4A 2FVAA 2KR5A 3NY7B 4BPHA 5KP6B 4H2YC 1NQ4A 4CA3A 2K93A 5CZDB 2KOQA 2N98A 2L22A 2VSQA 3EJBA 2KG9A 2QNWA 2AFDA 4DG9A 2JU1A 2PNGA 4H2XC 1F80D 1HQBA 2N5HA 1OR5A 2K94A 4H2WC 2LKIA 1T8KA 2K92A 2LMLA 3CE7A 2CGQA 2FACA 2LL8A 2FQ1A 2LOLA 4HKGA 3RG2A 3EJEA 2GDWA 2XZ1C 2FVFA 2L9FA 2N5IA 2KWLA 1X3OA 2MF4A 2CNRA 2FQ0A 2N50A 1AF8A 2LPKA 2L4BA 1L0IA 5EJDA 4BPFA 2FHSC 2MR7A 2MR8A 2LTEA 1KLPA 2KGEA 4PXHB 2FAEA 1VKUA 2KW2A 2AF8A 1DNYA 2AFEA 1DV5A 3GZLA 2GDYA 4MRTC 2KGDA 2DNWA 2AVAA
chains in the Genus database with same CATH superfamily
2JO0A 5EW5E 5HGLA 1YJ9P 5F2KA 1M1KQ 4GR6A 2K2QA 2L0QA 5KP8B 3MGEA 3WBHA 2MY5A 2KGCA 2VLOA 2EHTA 3GJNA 5HVCA 3CCEP 1S72P 2KORA 1L0HA 7CEIA 3HYBA 4U0CA 2M8PA 2KOPA 4XRQA 1M90Q 2GDXA 1YI2P 2FVAA 3NY7B 4BPHA 3CC7P 3CPWO 1NQ4A 5CZDB 2KOQA 2PEIA 2N98A 2JU1A 2PNGA 4H2XC 2GZEA 1GPJA 2OTJP 3CMEP 2K94A 4UHPB 1VQMP 3P05A 4H2WC 2LKIA 3CXCO 2Z46A 3CE7A 2LL8A 3RG2A 2XZ1C 5JPAA 1GXGA 5BS1A 1UJZA 2LF4A 2EFJA 2CNRA 1ZNVA 3G28A 2EG5A 1VQKP 1VQNP 3H4EA 3HZQA 1L0IA 4XFXA 2MR8A 2JBGA 4PH0A 4PXHB 1VKUA 1M6EX 4U0FA 2AF8A 1DNYA 1KC8Q 4WYMA 1IUQA 1KD1Q 4GR2A 4IZ6A 4NEOA 5BS2A 4BPGA 1VQLP 2LIWA 1AUMA 4PH1A 2KG6A 1A43A 1YITP 3G21A 2QEXP 3G0VA 2JU2A 2PENA 1NJIQ 1ACPA 2JYGA 1VQOP 2VLQA 2N6YA 3G26A 1RO2A 3B5IA 2EHSA 1AYIA 2X2BA 5HGMA 1VQ5P 2FVEA 4COCA 5HGNA 3CCMP 5F2OA 2JYLA 2Z45A 2CG5B 2KOOA 2KOSA 3LRYA 3GZMA 1A8OA 2JQ4A 4PWVB 2ONTA 3DTJA 2VSQA 2K5XA 2KG9A 3G29A 2E1MA 4COPA 1Q82Q 2BHVA 1T8KA 2K92A 1EIAA 2CGQA 1M6NA 3DS3A 3CC4P 4U0BA 2L6EA 2PEKA 4HKGA 3EJEA 2XT1A 2PEOA 2N5IA 2KWLA 1X3OA 3CCJP 1VQPP 2N50A 2EIAA 2MR7A 2XXMA 1QVFO 2KGEA 2JAZA 2Z44A 3U43A 2KW2A 3CMAP 1W2BO 1DV5A 2P9XA 4MRTC 2KGDA 1VHNA 2FQ2A 2PY8A 3GKLC 1KQSO 2PEMA 4XROA 1Q81Q 3VRLC 5F2NA 5DCKA 5KP7B 2KGAA 1CEIA 2WPTA 1Q7YQ 3G1IA 4R0MA 2CQ8A 5HGOA 3EJDA 3CCUP 2MVUA 3LMOA 2KG8A 2PEQA 3G1GA 1VQ6P 1VQ7P 2K0YA 1GXHA 3B4QA 4QKOA 2JGPA 3CCVP 2M8LA 4H2YC 3G71P 4CA3A 2L22A 3EJBA 1VQ8P 1JJ2O 2QNWA 1F80D 1HQBA 2N5HA 2CWOA 1OR5A 2K0DX 3Q20A 2LMLA 2GZFA 2FQ1A 1EMVA 2DGYA 1VQ9P 2GDWA 2BUOA 2VLNA 2L9FA 2GZGA 2MF4A 3NTEA 1QRJA 1AF8A 1K73Q 2KODA 2GZIA 3CCSP 1E0HA 1KLPA 2GZJA 1E6JP 2FAEA 4XFYA 3I55P 2JB0A 2VLPA 2ERHA 3GZLA 2DNWA 2PEJA 2AVAA 4M0IA 1FR2A 2FADA 3DS0A 2LIUA 5HV8A 4F37A 3DS2A 4U0EA 2M8NA 2MVVA 3CCQP 1BAJA 1YIJP 3DPHA 2MD9A 2N6ZA 3G6EP 2XV6A 3CC2P 1K30A 3DS1A 3I56P 1HY8A 2GYKA 3H47A 2M5RA 2XZ0D 4U0DA 3CCRP 3OW2O 2K0XA 3G4SP 3CD6P 2ROQA 2KR5A 2OTLP 5KP6B 1VQ4P 2K93A 1YJNP 4QNBA 1M74A 2QA4P 2AFDA 4DG9A 4U0AA 5I4TG 1MZ8A 1RNIA 1QVGO 1IMQA 2FACA 4XFZA 2LOLA 1IMPA 2FVFA 1Q86Q 1UNKA 1N8RQ 4IPYA 1K9MQ 3DS4A 1EOQA 2FQ0A 1K8AQ 1RO0A 1BXIA 2NO8A 3E2DA 3RG6C 2LPKA 4BPFA 2L4BA 5EJDA 2FHSC 3CCLP 2LTEA 1ZMBA 1YJWP 3DS5A 2AFEA 2OARA 1Z6MA 3H0DA 2GDYA 1YHQP 1D1DA 3M1MA
chains in the Genus database with same CATH topology
2FQ2A 4IZ6A 4NEOA 2FADA 2LIUA 5HV8A 2K2QA 2L0QA 4BPGA 5KP8B 2LIWA 2MY5A 2KGCA 2KG6A 5KP7B 2KGAA 2MVVA 2EHTA 2JU2A 4R0MA 1ACPA 2CQ8A 2MD9A 5HVCA 2N6ZA 2N6YA 3EJDA 2MVUA 3LMOA 2KG8A 2KORA 1HY8A 2EHSA 2X2BA 2M5RA 1L0HA 2XZ0D 2FVEA 2K0YA 2KOPA 2K0XA 2JGPA 2CG5B 2KOOA 2KOSA 2ROQA 2GDXA 4PWVB 3GZMA 2JQ4A 2FVAA 2KR5A 3NY7B 4BPHA 5KP6B 4H2YC 1NQ4A 4CA3A 2K93A 5CZDB 2KOQA 2N98A 2L22A 2VSQA 3EJBA 2KG9A 2QNWA 2AFDA 4DG9A 2JU1A 2PNGA 4H2XC 1F80D 1HQBA 2N5HA 1OR5A 2K94A 4H2WC 2LKIA 1T8KA 2K92A 2LMLA 3CE7A 2CGQA 2FACA 2LL8A 2FQ1A 2LOLA 4HKGA 3RG2A 3EJEA 2GDWA 2XZ1C 2FVFA 2L9FA 2N5IA 2KWLA 1X3OA 2MF4A 2CNRA 2FQ0A 2N50A 1AF8A 2LPKA 2L4BA 1L0IA 5EJDA 4BPFA 2FHSC 2MR7A 2MR8A 2LTEA 1KLPA 2KGEA 4PXHB 2FAEA 1VKUA 2KW2A 2AF8A 1DNYA 2AFEA 1DV5A 3GZLA 2GDYA 4MRTC 2KGDA 2DNWA 2AVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ2 A;  4IZ6 A;  4NEO A;  2FAD A;  2LIU A;  5HV8 A;  2K2Q A;  2L0Q A;  4BPG A;  5KP8 B;  2LIW A;  2MY5 A;  2KGC A;  2KG6 A;  5KP7 B;  2KGA A;  2MVV A;  2EHT A;  2JU2 A;  4R0M A;  1ACP A;  2CQ8 A;  2MD9 A;  5HVC A;  2N6Z A;  2N6Y A;  3EJD A;  2MVU A;  3LMO A;  2KG8 A;  2KOR A;  1HY8 A;  2EHS A;  2X2B A;  2M5R A;  1L0H A;  2XZ0 D;  2FVE A;  2K0Y A;  2KOP A;  2K0X A;  2JGP A;  2CG5 B;  2KOO A;  2KOS A;  2ROQ A;  2GDX A;  4PWV B;  3GZM A;  2JQ4 A;  2FVA A;  2KR5 A;  3NY7 B;  4BPH A;  5KP6 B;  4H2Y C;  1NQ4 A;  4CA3 A;  2K93 A;  5CZD B;  2KOQ A;  2N98 A;  2L22 A;  2VSQ A;  3EJB A;  2KG9 A;  2QNW A;  2AFD A;  4DG9 A;  2JU1 A;  2PNG A;  4H2X C;  1F80 D;  1HQB A;  2N5H A;  1OR5 A;  2K94 A;  4H2W C;  2LKI A;  1T8K A;  2K92 A;  2LML A;  3CE7 A;  2CGQ A;  2FAC A;  2LL8 A;  2FQ1 A;  2LOL A;  4HKG A;  3RG2 A;  3EJE A;  2GDW A;  2XZ1 C;  2FVF A;  2L9F A;  2N5I A;  2KWL A;  1X3O A;  2MF4 A;  2CNR A;  2FQ0 A;  2N50 A;  1AF8 A;  2LPK A;  2L4B A;  1L0I A;  5EJD A;  4BPF A;  2FHS C;  2MR7 A;  2MR8 A;  2LTE A;  1KLP A;  2KGE A;  4PXH B;  2FAE A;  1VKU A;  2KW2 A;  2AF8 A;  1DNY A;  2AFE A;  1DV5 A;  3GZL A;  2GDY A;  4MRT C;  2KGD A;  2DNW A;  2AVA A; 
#chains in the Genus database with same CATH topology
 2JO0 A;  5EW5 E;  5HGL A;  1YJ9 P;  5F2K A;  1M1K Q;  4GR6 A;  2K2Q A;  2L0Q A;  5KP8 B;  3MGE A;  3WBH A;  2MY5 A;  2KGC A;  2VLO A;  2EHT A;  3GJN A;  5HVC A;  3CCE P;  1S72 P;  2KOR A;  1L0H A;  7CEI A;  3HYB A;  4U0C A;  2M8P A;  2KOP A;  4XRQ A;  1M90 Q;  2GDX A;  1YI2 P;  2FVA A;  3NY7 B;  4BPH A;  3CC7 P;  3CPW O;  1NQ4 A;  5CZD B;  2KOQ A;  2PEI A;  2N98 A;  2JU1 A;  2PNG A;  4H2X C;  2GZE A;  1GPJ A;  2OTJ P;  3CME P;  2K94 A;  4UHP B;  1VQM P;  3P05 A;  4H2W C;  2LKI A;  3CXC O;  2Z46 A;  3CE7 A;  2LL8 A;  3RG2 A;  2XZ1 C;  5JPA A;  1GXG A;  5BS1 A;  1UJZ A;  2LF4 A;  2EFJ A;  2CNR A;  1ZNV A;  3G28 A;  2EG5 A;  1VQK P;  1VQN P;  3H4E A;  3HZQ A;  1L0I A;  4XFX A;  2MR8 A;  2JBG A;  4PH0 A;  4PXH B;  1VKU A;  1M6E X;  4U0F A;  2AF8 A;  1DNY A;  1KC8 Q;  4WYM A;  1IUQ A;  1KD1 Q;  4GR2 A;  4IZ6 A;  4NEO A;  5BS2 A;  4BPG A;  1VQL P;  2LIW A;  1AUM A;  4PH1 A;  2KG6 A;  1A43 A;  1YIT P;  3G21 A;  2QEX P;  3G0V A;  2JU2 A;  2PEN A;  1NJI Q;  1ACP A;  2JYG A;  1VQO P;  2VLQ A;  2N6Y A;  3G26 A;  1RO2 A;  3B5I A;  2EHS A;  1AYI A;  2X2B A;  5HGM A;  1VQ5 P;  2FVE A;  4COC A;  5HGN A;  3CCM P;  5F2O A;  2JYL A;  2Z45 A;  2CG5 B;  2KOO A;  2KOS A;  3LRY A;  3GZM A;  1A8O A;  2JQ4 A;  4PWV B;  2ONT A;  3DTJ A;  2VSQ A;  2K5X A;  2KG9 A;  3G29 A;  2E1M A;  4COP A;  1Q82 Q;  2BHV A;  1T8K A;  2K92 A;  1EIA A;  2CGQ A;  1M6N A;  3DS3 A;  3CC4 P;  4U0B A;  2L6E A;  2PEK A;  4HKG A;  3EJE A;  2XT1 A;  2PEO A;  2N5I A;  2KWL A;  1X3O A;  3CCJ P;  1VQP P;  2N50 A;  2EIA A;  2MR7 A;  2XXM A;  1QVF O;  2KGE A;  2JAZ A;  2Z44 A;  3U43 A;  2KW2 A;  3CMA P;  1W2B O;  1DV5 A;  2P9X A;  4MRT C;  2KGD A;  1VHN A;  2FQ2 A;  2PY8 A;  3GKL C;  1KQS O;  2PEM A;  4XRO A;  1Q81 Q;  3VRL C;  5F2N A;  5DCK A;  5KP7 B;  2KGA A;  1CEI A;  2WPT A;  1Q7Y Q;  3G1I A;  4R0M A;  2CQ8 A;  5HGO A;  3EJD A;  3CCU P;  2MVU A;  3LMO A;  2KG8 A;  2PEQ A;  3G1G A;  1VQ6 P;  1VQ7 P;  2K0Y A;  1GXH A;  3B4Q A;  4QKO A;  2JGP A;  3CCV P;  2M8L A;  4H2Y C;  3G71 P;  4CA3 A;  2L22 A;  3EJB A;  1VQ8 P;  1JJ2 O;  2QNW A;  1F80 D;  1HQB A;  2N5H A;  2CWO A;  1OR5 A;  2K0D X;  3Q20 A;  2LML A;  2GZF A;  2FQ1 A;  1EMV A;  2DGY A;  1VQ9 P;  2GDW A;  2BUO A;  2VLN A;  2L9F A;  2GZG A;  2MF4 A;  3NTE A;  1QRJ A;  1AF8 A;  1K73 Q;  2KOD A;  2GZI A;  3CCS P;  1E0H A;  1KLP A;  2GZJ A;  1E6J P;  2FAE A;  4XFY A;  3I55 P;  2JB0 A;  2VLP A;  2ERH A;  3GZL A;  2DNW A;  2PEJ A;  2AVA A;  4M0I A;  1FR2 A;  2FAD A;  3DS0 A;  2LIU A;  5HV8 A;  4F37 A;  3DS2 A;  4U0E A;  2M8N A;  2MVV A;  3CCQ P;  1BAJ A;  1YIJ P;  3DPH A;  2MD9 A;  2N6Z A;  3G6E P;  2XV6 A;  3CC2 P;  1K30 A;  3DS1 A;  3I56 P;  1HY8 A;  2GYK A;  3H47 A;  2M5R A;  2XZ0 D;  4U0D A;  3CCR P;  3OW2 O;  2K0X A;  3G4S P;  3CD6 P;  2ROQ A;  2KR5 A;  2OTL P;  5KP6 B;  1VQ4 P;  2K93 A;  1YJN P;  4QNB A;  1M74 A;  2QA4 P;  2AFD A;  4DG9 A;  4U0A A;  5I4T G;  1MZ8 A;  1RNI A;  1QVG O;  1IMQ A;  2FAC A;  4XFZ A;  2LOL A;  1IMP A;  2FVF A;  1Q86 Q;  1UNK A;  1N8R Q;  4IPY A;  1K9M Q;  3DS4 A;  1EOQ A;  2FQ0 A;  1K8A Q;  1RO0 A;  1BXI A;  2NO8 A;  3E2D A;  3RG6 C;  2LPK A;  4BPF A;  2L4B A;  5EJD A;  2FHS C;  3CCL P;  2LTE A;  1ZMB A;  1YJW P;  3DS5 A;  2AFE A;  2OAR A;  1Z6M A;  3H0D A;  2GDY A;  1YHQ P;  1D1D A;  3M1M A; 
#chains in the Genus database with same CATH homology
 2FQ2 A;  4IZ6 A;  4NEO A;  2FAD A;  2LIU A;  5HV8 A;  2K2Q A;  2L0Q A;  4BPG A;  5KP8 B;  2LIW A;  2MY5 A;  2KGC A;  2KG6 A;  5KP7 B;  2KGA A;  2MVV A;  2EHT A;  2JU2 A;  4R0M A;  1ACP A;  2CQ8 A;  2MD9 A;  5HVC A;  2N6Z A;  2N6Y A;  3EJD A;  2MVU A;  3LMO A;  2KG8 A;  2KOR A;  1HY8 A;  2EHS A;  2X2B A;  2M5R A;  1L0H A;  2XZ0 D;  2FVE A;  2K0Y A;  2KOP A;  2K0X A;  2JGP A;  2CG5 B;  2KOO A;  2KOS A;  2ROQ A;  2GDX A;  4PWV B;  3GZM A;  2JQ4 A;  2FVA A;  2KR5 A;  3NY7 B;  4BPH A;  5KP6 B;  4H2Y C;  1NQ4 A;  4CA3 A;  2K93 A;  5CZD B;  2KOQ A;  2N98 A;  2L22 A;  2VSQ A;  3EJB A;  2KG9 A;  2QNW A;  2AFD A;  4DG9 A;  2JU1 A;  2PNG A;  4H2X C;  1F80 D;  1HQB A;  2N5H A;  1OR5 A;  2K94 A;  4H2W C;  2LKI A;  1T8K A;  2K92 A;  2LML A;  3CE7 A;  2CGQ A;  2FAC A;  2LL8 A;  2FQ1 A;  2LOL A;  4HKG A;  3RG2 A;  3EJE A;  2GDW A;  2XZ1 C;  2FVF A;  2L9F A;  2N5I A;  2KWL A;  1X3O A;  2MF4 A;  2CNR A;  2FQ0 A;  2N50 A;  1AF8 A;  2LPK A;  2L4B A;  1L0I A;  5EJD A;  4BPF A;  2FHS C;  2MR7 A;  2MR8 A;  2LTE A;  1KLP A;  2KGE A;  4PXH B;  2FAE A;  1VKU A;  2KW2 A;  2AF8 A;  1DNY A;  2AFE A;  1DV5 A;  3GZL A;  2GDY A;  4MRT C;  2KGD A;  2DNW A;  2AVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...