2CNRA

Structural studies on the interaction of scfas acp with acps
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords ACYL CARRIER PROTEIN
publication title Structure and Malonyl Coa-Acp Transacylase Binding of Streptomyces Coelicolor Fatty Acid Synthase Acyl Carrier Protein.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cnrA00
2CGQA 2KOOA 2EHTA 2DNWA 4PWVB 2AFDA 2X2BA 4PXHB 3RG2A 2N5HA 2QNWA 2K93A 1L0HA 2KOPA 2VSQA 1ACPA 2M5RA 2LTEA 1KLPA 2AVAA 4BPFA 1AF8A 2MF4A 2LIWA 2MY5A 2FHSC 2K0XA 5KP6B 3NY7B 2XZ0D 2CQ8A 2L22A 4H2YC 2MR8A 2LOLA 3EJDA 2N6ZA 2LMLA 2KWLA 2MR7A 2FQ1A 4H2XC 2CG5B 5HV8A 5KP8B 4H2WC 2KGCA 2K2QA 2CNRA 3CE7A 2FAEA 5KP7B 1F80D 2L9FA 5HVCA 2FVFA 2JU2A 2KOQA 2AFEA 2K94A 2GDXA 2KGDA 2FADA 4BPGA 4DG9A 3EJEA 1HQBA 2MD9A 2JU1A 2AF8A 2KOSA 2LKIA 5EJDA 2LL8A 1L0IA 2L0QA 2LIUA 2PNGA 2JGPA 2FACA 2L4BA 2GDYA 2XZ1C 2EHSA 2JQ4A 2KG6A 2N98A 3EJBA 4BPHA 2KGEA 1DV5A 4CA3A 4NEOA 4IZ6A 2ROQA 2KORA 2K0YA 1T8KA 5CZDB 1X3OA 1DNYA 2FQ0A 2MVUA 2KGAA 1HY8A 1VKUA 2N5IA 2GDWA 2KG9A 2N6YA 2FVAA 2FQ2A 3GZMA 2N50A 2MVVA 4MRTC 4R0MA 3LMOA 2KR5A 2KW2A 1NQ4A 1OR5A 2FVEA 2K92A 2KG8A 2LPKA 3GZLA 4HKGA
chains in the Genus database with same CATH superfamily
5F2NA 2EHTA 2Z46A 3CMEP 2OTLP 2X2BA 1K9MQ 1M90Q 2K93A 3CCRP 1L0HA 2KOPA 1ACPA 2LTEA 2AVAA 4BPFA 4H2YC 2L22A 3G29A 2NO8A 4U0AA 2LMLA 3G1GA 3I55P 3DTJA 5KP8B 3CCSP 4GR6A 1RNIA 1GPJA 3CE7A 5HVCA 3CCLP 5HGLA 1YITP 2PEMA 2M8LA 3I56P 3WBHA 1M6EX 3G6EP 1HQBA 2AF8A 1GXGA 5EJDA 3G1IA 1YHQP 1VQOP 2PNGA 2PEIA 2EHSA 2GYKA 3EJBA 1M6NA 3GKLC 4CA3A 2VLOA 1K73Q 5CZDB 1VQMP 2MVUA 2KGAA 1VQ6P 2N5IA 1A43A 2N6YA 2FVAA 1VQKP 4U0DA 4MRTC 1VQ4P 2XV6A 3LMOA 2KR5A 1AYIA 4U0BA 4QNBA 3H47A 1YIJP 2KOOA 1Q86Q 2AFDA 2CWOA 3RG2A 1Z6MA 2QNWA 1UNKA 2JB0A 2PY8A 2GZGA 2K5XA 2FHSC 4XROA 2M8NA 2QA4P 2VLNA 1CEIA 3H4EA 3GJNA 1VHNA 4GR2A 2JAZA 2KWLA 3P05A 2Z45A 4M0IA 4WYMA 4H2WC 2KGCA 2EFJA 2GZEA 3CXCO 1KQSO 2PENA 2GZIA 3DS1A 2L9FA 2FVFA 1E6JP 2GDXA 2PEOA 2GZJA 4XFYA 2M8PA 2FADA 3DS0A 3CPWO 2MD9A 3CD6P 1L0IA 2JBGA 5F2OA 4IPYA 2EG5A 1JJ2O 3OW2O 1YJNP 2JGPA 1EMVA 2ERHA 4NEOA 4IZ6A 3Q20A 1AUMA 1DNYA 1KC8Q 3DS4A 3MGEA 1MZ8A 4XRQA 3H0DA 1Q81Q 5HGOA 2FQ2A 4F37A 5EW5E 2XT1A 4R0MA 7CEIA 2KW2A 3DS2A 2LF4A 1W2BO 2BHVA 4PWVB 2Z44A 2N5HA 3CC7P 3G0VA 3G26A 4PH0A 2E1MA 2PEQA 1KLPA 1D1DA 2LIWA 2MY5A 2K0XA 5KP6B 2VLQA 2XZ0D 3G71P 2CQ8A 3EJDA 1VQNP 3RG6C 4H2XC 5HV8A 3CCVP 2K2QA 5KP7B 1F80D 2OTJP 3CCJP 2JYGA 2KOQA 4XFXA 2AFEA 3HZQA 2WPTA 2K94A 1A8OA 3HYBA 4U0EA 1ZMBA 2KGDA 1Q82Q 1EOQA 4BPGA 4DG9A 3EJEA 2JU1A 2EIAA 2KOSA 2LKIA 2LL8A 2L0QA 1UJZA 2L4BA 2XZ1C 4COCA 4QKOA 2KGEA 2K0YA 1T8KA 1RO2A 1X3OA 2FQ0A 5DCKA 3CC4P 1HY8A 3G21A 2BUOA 1QVFO 2GDWA 3B4QA 5I4TG 2PEJA 3B5IA 1GXHA 2MVVA 3CCEP 1IMPA 2OARA 4U0CA 3CCMP 2KG8A 4U0FA 4HKGA 2KODA 3CMAP 2CGQA 1M74A 2P9XA 2DNWA 4PXHB 3VRLC 2K0DX 2VSQA 2M5RA 4PH1A 1S72P 1YJ9P 1AF8A 2MF4A 3G4SP 3NY7B 3U43A 2MR8A 2LOLA 2N6ZA 1VQLP 1BAJA 1K30A 2FQ1A 2MR7A 2QEXP 2CG5B 4UHPB 1VQ5P 4XFZA 2DGYA 1QRJA 2CNRA 1M1KQ 2FAEA 3CCUP 1RO0A 2JU2A 3LRYA 2XXMA 4COPA 3G28A 1NJIQ 3CC2P 2PEKA 1IMQA 1EIAA 1ZNVA 3CCQP 3DPHA 2VLPA 1VQ7P 3NTEA 1YJWP 2GZFA 2ONTA 2LIUA 1KD1Q 5JPAA 2JO0A 2FACA 2GDYA 2JQ4A 1K8AQ 1VQ9P 2KG6A 2N98A 5HGMA 4BPHA 2JYLA 3E2DA 1IUQA 1DV5A 1E0HA 5HGNA 5BS2A 3DS3A 2ROQA 5F2KA 1FR2A 2KORA 1VQ8P 1VKUA 3M1MA 2KG9A 2L6EA 3GZMA 2N50A 5BS1A 1BXIA 1YI2P 1N8RQ 1VQPP 1Q7YQ 3DS5A 1QVGO 1NQ4A 1OR5A 2FVEA 2K92A 2LPKA 3GZLA
chains in the Genus database with same CATH topology
2CGQA 2KOOA 2EHTA 2DNWA 4PWVB 2AFDA 2X2BA 4PXHB 3RG2A 2N5HA 2QNWA 2K93A 1L0HA 2KOPA 2VSQA 1ACPA 2M5RA 2LTEA 1KLPA 2AVAA 4BPFA 1AF8A 2MF4A 2LIWA 2MY5A 2FHSC 2K0XA 5KP6B 3NY7B 2XZ0D 2CQ8A 2L22A 4H2YC 2MR8A 2LOLA 3EJDA 2N6ZA 2LMLA 2KWLA 2MR7A 2FQ1A 4H2XC 2CG5B 5HV8A 5KP8B 4H2WC 2KGCA 2K2QA 2CNRA 3CE7A 2FAEA 5KP7B 1F80D 2L9FA 5HVCA 2FVFA 2JU2A 2KOQA 2AFEA 2K94A 2GDXA 2KGDA 2FADA 4BPGA 4DG9A 3EJEA 1HQBA 2MD9A 2JU1A 2AF8A 2KOSA 2LKIA 5EJDA 2LL8A 1L0IA 2L0QA 2LIUA 2PNGA 2JGPA 2FACA 2L4BA 2GDYA 2XZ1C 2EHSA 2JQ4A 2KG6A 2N98A 3EJBA 4BPHA 2KGEA 1DV5A 4CA3A 4NEOA 4IZ6A 2ROQA 2KORA 2K0YA 1T8KA 5CZDB 1X3OA 1DNYA 2FQ0A 2MVUA 2KGAA 1HY8A 1VKUA 2N5IA 2GDWA 2KG9A 2N6YA 2FVAA 2FQ2A 3GZMA 2N50A 2MVVA 4MRTC 4R0MA 3LMOA 2KR5A 2KW2A 1NQ4A 1OR5A 2FVEA 2K92A 2KG8A 2LPKA 3GZLA 4HKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGQ A;  2KOO A;  2EHT A;  2DNW A;  4PWV B;  2AFD A;  2X2B A;  4PXH B;  3RG2 A;  2N5H A;  2QNW A;  2K93 A;  1L0H A;  2KOP A;  2VSQ A;  1ACP A;  2M5R A;  2LTE A;  1KLP A;  2AVA A;  4BPF A;  1AF8 A;  2MF4 A;  2LIW A;  2MY5 A;  2FHS C;  2K0X A;  5KP6 B;  3NY7 B;  2XZ0 D;  2CQ8 A;  2L22 A;  4H2Y C;  2MR8 A;  2LOL A;  3EJD A;  2N6Z A;  2LML A;  2KWL A;  2MR7 A;  2FQ1 A;  4H2X C;  2CG5 B;  5HV8 A;  5KP8 B;  4H2W C;  2KGC A;  2K2Q A;  2CNR A;  3CE7 A;  2FAE A;  5KP7 B;  1F80 D;  2L9F A;  5HVC A;  2FVF A;  2JU2 A;  2KOQ A;  2AFE A;  2K94 A;  2GDX A;  2KGD A;  2FAD A;  4BPG A;  4DG9 A;  3EJE A;  1HQB A;  2MD9 A;  2JU1 A;  2AF8 A;  2KOS A;  2LKI A;  5EJD A;  2LL8 A;  1L0I A;  2L0Q A;  2LIU A;  2PNG A;  2JGP A;  2FAC A;  2L4B A;  2GDY A;  2XZ1 C;  2EHS A;  2JQ4 A;  2KG6 A;  2N98 A;  3EJB A;  4BPH A;  2KGE A;  1DV5 A;  4CA3 A;  4NEO A;  4IZ6 A;  2ROQ A;  2KOR A;  2K0Y A;  1T8K A;  5CZD B;  1X3O A;  1DNY A;  2FQ0 A;  2MVU A;  2KGA A;  1HY8 A;  1VKU A;  2N5I A;  2GDW A;  2KG9 A;  2N6Y A;  2FVA A;  2FQ2 A;  3GZM A;  2N50 A;  2MVV A;  4MRT C;  4R0M A;  3LMO A;  2KR5 A;  2KW2 A;  1NQ4 A;  1OR5 A;  2FVE A;  2K92 A;  2KG8 A;  2LPK A;  3GZL A;  4HKG A; 
#chains in the Genus database with same CATH topology
 5F2N A;  2EHT A;  2Z46 A;  3CME P;  2OTL P;  2X2B A;  1K9M Q;  1M90 Q;  2K93 A;  3CCR P;  1L0H A;  2KOP A;  1ACP A;  2LTE A;  2AVA A;  4BPF A;  4H2Y C;  2L22 A;  3G29 A;  2NO8 A;  4U0A A;  2LML A;  3G1G A;  3I55 P;  3DTJ A;  5KP8 B;  3CCS P;  4GR6 A;  1RNI A;  1GPJ A;  3CE7 A;  5HVC A;  3CCL P;  5HGL A;  1YIT P;  2PEM A;  2M8L A;  3I56 P;  3WBH A;  1M6E X;  3G6E P;  1HQB A;  2AF8 A;  1GXG A;  5EJD A;  3G1I A;  1YHQ P;  1VQO P;  2PNG A;  2PEI A;  2EHS A;  2GYK A;  3EJB A;  1M6N A;  3GKL C;  4CA3 A;  2VLO A;  1K73 Q;  5CZD B;  1VQM P;  2MVU A;  2KGA A;  1VQ6 P;  2N5I A;  1A43 A;  2N6Y A;  2FVA A;  1VQK P;  4U0D A;  4MRT C;  1VQ4 P;  2XV6 A;  3LMO A;  2KR5 A;  1AYI A;  4U0B A;  4QNB A;  3H47 A;  1YIJ P;  2KOO A;  1Q86 Q;  2AFD A;  2CWO A;  3RG2 A;  1Z6M A;  2QNW A;  1UNK A;  2JB0 A;  2PY8 A;  2GZG A;  2K5X A;  2FHS C;  4XRO A;  2M8N A;  2QA4 P;  2VLN A;  1CEI A;  3H4E A;  3GJN A;  1VHN A;  4GR2 A;  2JAZ A;  2KWL A;  3P05 A;  2Z45 A;  4M0I A;  4WYM A;  4H2W C;  2KGC A;  2EFJ A;  2GZE A;  3CXC O;  1KQS O;  2PEN A;  2GZI A;  3DS1 A;  2L9F A;  2FVF A;  1E6J P;  2GDX A;  2PEO A;  2GZJ A;  4XFY A;  2M8P A;  2FAD A;  3DS0 A;  3CPW O;  2MD9 A;  3CD6 P;  1L0I A;  2JBG A;  5F2O A;  4IPY A;  2EG5 A;  1JJ2 O;  3OW2 O;  1YJN P;  2JGP A;  1EMV A;  2ERH A;  4NEO A;  4IZ6 A;  3Q20 A;  1AUM A;  1DNY A;  1KC8 Q;  3DS4 A;  3MGE A;  1MZ8 A;  4XRQ A;  3H0D A;  1Q81 Q;  5HGO A;  2FQ2 A;  4F37 A;  5EW5 E;  2XT1 A;  4R0M A;  7CEI A;  2KW2 A;  3DS2 A;  2LF4 A;  1W2B O;  2BHV A;  4PWV B;  2Z44 A;  2N5H A;  3CC7 P;  3G0V A;  3G26 A;  4PH0 A;  2E1M A;  2PEQ A;  1KLP A;  1D1D A;  2LIW A;  2MY5 A;  2K0X A;  5KP6 B;  2VLQ A;  2XZ0 D;  3G71 P;  2CQ8 A;  3EJD A;  1VQN P;  3RG6 C;  4H2X C;  5HV8 A;  3CCV P;  2K2Q A;  5KP7 B;  1F80 D;  2OTJ P;  3CCJ P;  2JYG A;  2KOQ A;  4XFX A;  2AFE A;  3HZQ A;  2WPT A;  2K94 A;  1A8O A;  3HYB A;  4U0E A;  1ZMB A;  2KGD A;  1Q82 Q;  1EOQ A;  4BPG A;  4DG9 A;  3EJE A;  2JU1 A;  2EIA A;  2KOS A;  2LKI A;  2LL8 A;  2L0Q A;  1UJZ A;  2L4B A;  2XZ1 C;  4COC A;  4QKO A;  2KGE A;  2K0Y A;  1T8K A;  1RO2 A;  1X3O A;  2FQ0 A;  5DCK A;  3CC4 P;  1HY8 A;  3G21 A;  2BUO A;  1QVF O;  2GDW A;  3B4Q A;  5I4T G;  2PEJ A;  3B5I A;  1GXH A;  2MVV A;  3CCE P;  1IMP A;  2OAR A;  4U0C A;  3CCM P;  2KG8 A;  4U0F A;  4HKG A;  2KOD A;  3CMA P;  2CGQ A;  1M74 A;  2P9X A;  2DNW A;  4PXH B;  3VRL C;  2K0D X;  2VSQ A;  2M5R A;  4PH1 A;  1S72 P;  1YJ9 P;  1AF8 A;  2MF4 A;  3G4S P;  3NY7 B;  3U43 A;  2MR8 A;  2LOL A;  2N6Z A;  1VQL P;  1BAJ A;  1K30 A;  2FQ1 A;  2MR7 A;  2QEX P;  2CG5 B;  4UHP B;  1VQ5 P;  4XFZ A;  2DGY A;  1QRJ A;  2CNR A;  1M1K Q;  2FAE A;  3CCU P;  1RO0 A;  2JU2 A;  3LRY A;  2XXM A;  4COP A;  3G28 A;  1NJI Q;  3CC2 P;  2PEK A;  1IMQ A;  1EIA A;  1ZNV A;  3CCQ P;  3DPH A;  2VLP A;  1VQ7 P;  3NTE A;  1YJW P;  2GZF A;  2ONT A;  2LIU A;  1KD1 Q;  5JPA A;  2JO0 A;  2FAC A;  2GDY A;  2JQ4 A;  1K8A Q;  1VQ9 P;  2KG6 A;  2N98 A;  5HGM A;  4BPH A;  2JYL A;  3E2D A;  1IUQ A;  1DV5 A;  1E0H A;  5HGN A;  5BS2 A;  3DS3 A;  2ROQ A;  5F2K A;  1FR2 A;  2KOR A;  1VQ8 P;  1VKU A;  3M1M A;  2KG9 A;  2L6E A;  3GZM A;  2N50 A;  5BS1 A;  1BXI A;  1YI2 P;  1N8R Q;  1VQP P;  1Q7Y Q;  3DS5 A;  1QVG O;  1NQ4 A;  1OR5 A;  2FVE A;  2K92 A;  2LPK A;  3GZL A; 
#chains in the Genus database with same CATH homology
 2CGQ A;  2KOO A;  2EHT A;  2DNW A;  4PWV B;  2AFD A;  2X2B A;  4PXH B;  3RG2 A;  2N5H A;  2QNW A;  2K93 A;  1L0H A;  2KOP A;  2VSQ A;  1ACP A;  2M5R A;  2LTE A;  1KLP A;  2AVA A;  4BPF A;  1AF8 A;  2MF4 A;  2LIW A;  2MY5 A;  2FHS C;  2K0X A;  5KP6 B;  3NY7 B;  2XZ0 D;  2CQ8 A;  2L22 A;  4H2Y C;  2MR8 A;  2LOL A;  3EJD A;  2N6Z A;  2LML A;  2KWL A;  2MR7 A;  2FQ1 A;  4H2X C;  2CG5 B;  5HV8 A;  5KP8 B;  4H2W C;  2KGC A;  2K2Q A;  2CNR A;  3CE7 A;  2FAE A;  5KP7 B;  1F80 D;  2L9F A;  5HVC A;  2FVF A;  2JU2 A;  2KOQ A;  2AFE A;  2K94 A;  2GDX A;  2KGD A;  2FAD A;  4BPG A;  4DG9 A;  3EJE A;  1HQB A;  2MD9 A;  2JU1 A;  2AF8 A;  2KOS A;  2LKI A;  5EJD A;  2LL8 A;  1L0I A;  2L0Q A;  2LIU A;  2PNG A;  2JGP A;  2FAC A;  2L4B A;  2GDY A;  2XZ1 C;  2EHS A;  2JQ4 A;  2KG6 A;  2N98 A;  3EJB A;  4BPH A;  2KGE A;  1DV5 A;  4CA3 A;  4NEO A;  4IZ6 A;  2ROQ A;  2KOR A;  2K0Y A;  1T8K A;  5CZD B;  1X3O A;  1DNY A;  2FQ0 A;  2MVU A;  2KGA A;  1HY8 A;  1VKU A;  2N5I A;  2GDW A;  2KG9 A;  2N6Y A;  2FVA A;  2FQ2 A;  3GZM A;  2N50 A;  2MVV A;  4MRT C;  4R0M A;  3LMO A;  2KR5 A;  2KW2 A;  1NQ4 A;  1OR5 A;  2FVE A;  2K92 A;  2KG8 A;  2LPK A;  3GZL A;  4HKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...