2CNRA

Structural studies on the interaction of scfas acp with acps
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
82
structure length
82
Chain Sequence
b'MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL CARRIER PROTEIN
publication title Structure and Malonyl Coa-Acp Transacylase Binding of Streptomyces Coelicolor Fatty Acid Synthase Acyl Carrier Protein.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Lipid transport
total genus 28
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cnrA00
2AFEA 2K92A 2L9FA 2MR8A 2LIUA 2FQ2A 3EJBA 2KOPA 2K0XA 2KOOA 5CZDB 2MY5A 2LIWA 4DG9A 4H2WC 3GZLA 2M5RA 3LMOA 2KW2A 2GDWA 2KWLA 2N6YA 2JQ4A 2AFDA 2L4BA 1NQ4A 2KORA 5HVCA 3NY7B 2CGQA 4NEOA 2N98A 1ACPA 3RG2A 2FACA 1L0HA 1HY8A 2PNGA 5HV8A 2FQ1A 2CG5B 2CQ8A 4HKGA 4PXHB 1HQBA 2FAEA 2GDXA 2LMLA 1KLPA 4H2YC 1X3OA 2JU2A 2KGDA 2K0YA 2N5HA 2EHSA 2LTEA 1F80D 1DV5A 2FADA 3GZMA 3CE7A 4BPGA 2CNRA 2KG8A 4H2XC 2K94A 2KG9A 1T8KA 2X2BA 2FVAA 2JGPA 4R0MA 2LKIA 2KG6A 2N5IA 2LPKA 2LOLA 1OR5A 2KR5A 2L22A 2K93A 2KOQA 2AVAA 4BPFA 2N6ZA 1AF8A 2DNWA 2FHSC 2FVEA 2N50A 2KGAA 2MVVA 2FQ0A 1VKUA 1DNYA 2KOSA 2QNWA 3EJEA 5KP6B 2K2QA 2XZ1C 2KGCA 2MD9A 5EJDA 2ROQA 4IZ6A 2JU1A 2FVFA 2MVUA 2VSQA 2MF4A 2MR7A 4MRTC 4BPHA 3EJDA 4CA3A 2AF8A 2EHTA 4PWVB 1L0IA 2GDYA 5KP7B 2L0QA 5KP8B 2KGEA 2XZ0D 2LL8A
chains in the Genus database with same CATH superfamily
4XFXA 1Q86Q 2M8LA 1JJ2O 2LIUA 2FQ2A 3EJBA 2KOOA 2GZGA 2MY5A 5JPAA 3DS0A 4COCA 2ONTA 3CC2P 2E1MA 2M5RA 2KW2A 4UHPB 2GDWA 1MZ8A 4PH1A 2KORA 2CGQA 2VLPA 2BHVA 2M8NA 2PNGA 3MGEA 5HV8A 1Q7YQ 4HKGA 2LF4A 1K30A 1KLPA 1X3OA 2JU2A 2K0YA 2OTJP 1VQLP 1DV5A 1GXGA 2FADA 1M6EX 2M8PA 2CNRA 2KG8A 2KG9A 5BS1A 2PEMA 1T8KA 1ZNVA 2PEKA 2Z46A 2Z44A 3CD6P 2L22A 5HGLA 1A8OA 3H0DA 1IUQA 1YITP 1AF8A 1VQ7P 2DNWA 1BAJA 1IMQA 2N50A 3G1GA 2KGAA 1VKUA 1DNYA 3G71P 2KOSA 2JO0A 3EJEA 1VQ9P 3CMEP 2JAZA 3U43A 2MD9A 4PH0A 3NTEA 3DTJA 3DS3A 4IZ6A 3CMAP 5HGNA 2PY8A 2GZIA 2MR7A 4MRTC 4CA3A 2P9XA 2AF8A 1VQ8P 2LL8A 2K92A 5HGOA 4QNBA 2Z45A 2MR8A 1RO2A 1KD1Q 2GZFA 3GJNA 2K0XA 5CZDB 4DG9A 2GZJA 1YIJP 1M74A 2JBGA 1VQ5P 2KWLA 5BS2A 1KQSO 2JQ4A 4XFZA 1VQPP 1NJIQ 5HVCA 3H4EA 2N98A 2FACA 1VQKP 1HY8A 3CC4P 2CG5B 2CQ8A 3G1IA 1Q82Q 3G6EP 1HQBA 2FAEA 2GDXA 2LMLA 1E6JP 1EIAA 3RG6C 2N5HA 3CCRP 1VQNP 3GZMA 3CE7A 3CXCO 5F2NA 1UJZA 3H47A 3P05A 1K8AQ 3B4QA 4QKOA 7CEIA 2OTLP 2JYLA 3I56P 2KOQA 3OW2O 5DCKA 1D1DA 2JB0A 2FHSC 2FVEA 2FQ0A 4U0BA 2PEQA 1W2BO 3I55P 5KP6B 2K2QA 2XV6A 2PEIA 3DS2A 1K9MQ 2XXMA 3CCVP 1VQ4P 2K0DX 3DS1A 4BPHA 3EJDA 4WYMA 2VLOA 2EHTA 2PEJA 4PWVB 2GDYA 2CWOA 1RO0A 2KGEA 2XZ0D 1Q81Q 2K5XA 1VQOP 3G0VA 4H2WC 1E0HA 1CEIA 3GKLC 5I4TG 3LMOA 5F2OA 1QVFO 1IMPA 2N6YA 1S72P 1VQMP 2KODA 1VHNA 1NQ4A 3NY7B 4NEOA 1YJNP 1ACPA 2GYKA 2WPTA 3B5IA 3Q20A 2QEXP 3G26A 4PXHB 3CCLP 2EG5A 4U0DA 1EOQA 4H2YC 4F37A 2ERHA 2LTEA 3DPHA 2XT1A 2L6EA 2K94A 1M90Q 2X2BA 2FVAA 1AYIA 2JGPA 1M1KQ 2PENA 2LKIA 2OARA 3LRYA 2KG6A 2N5IA 3M1MA 3CCEP 2LOLA 2AVAA 4GR2A 4BPFA 2N6ZA 3G21A 2MVVA 3CCUP 2QNWA 1FR2A 3G28A 1EMVA 2KGCA 2ROQA 2JU1A 3CCSP 2MVUA 2DGYA 4GR6A 4U0FA 2MF4A 1K73Q 3G29A 1L0IA 3HZQA 1RNIA 5KP7B 1QRJA 1YJ9P 2VLQA 2AFEA 2L9FA 3G4SP 3DS5A 1BXIA 3HYBA 2KOPA 3VRLC 4U0CA 3E2DA 2LIWA 1VQ6P 3GZLA 4XROA 2VLNA 4XFYA 2AFDA 2L4BA 2BUOA 1N8RQ 2NO8A 4XRQA 3RG2A 1L0HA 1M6NA 2FQ1A 3DS4A 2EIAA 2KGDA 3CPWO 3CCJP 2EHSA 1F80D 4U0EA 1YHQP 1AUMA 4BPGA 1YJWP 4H2XC 5F2KA 2EFJA 1YI2P 4R0MA 4M0IA 2LPKA 2PEOA 4IPYA 1OR5A 2KR5A 3WBHA 2K93A 2QA4P 1GPJA 1QVGO 5EW5E 2XZ1C 3CCMP 1A43A 1GXHA 5HGMA 5EJDA 1Z6MA 2FVFA 2VSQA 3CC7P 2JYGA 4U0AA 1KC8Q 1UNKA 2GZEA 2L0QA 5KP8B 4COPA 3CCQP 1ZMBA
chains in the Genus database with same CATH topology
2AFEA 2K92A 2L9FA 2MR8A 2LIUA 2FQ2A 3EJBA 2KOPA 2K0XA 2KOOA 5CZDB 2MY5A 2LIWA 4DG9A 4H2WC 3GZLA 2M5RA 3LMOA 2KW2A 2GDWA 2KWLA 2N6YA 2JQ4A 2AFDA 2L4BA 1NQ4A 2KORA 5HVCA 3NY7B 2CGQA 4NEOA 2N98A 1ACPA 3RG2A 2FACA 1L0HA 1HY8A 2PNGA 5HV8A 2FQ1A 2CG5B 2CQ8A 4HKGA 4PXHB 1HQBA 2FAEA 2GDXA 2LMLA 1KLPA 4H2YC 1X3OA 2JU2A 2KGDA 2K0YA 2N5HA 2EHSA 2LTEA 1F80D 1DV5A 2FADA 3GZMA 3CE7A 4BPGA 2CNRA 2KG8A 4H2XC 2K94A 2KG9A 1T8KA 2X2BA 2FVAA 2JGPA 4R0MA 2LKIA 2KG6A 2N5IA 2LPKA 2LOLA 1OR5A 2KR5A 2L22A 2K93A 2KOQA 2AVAA 4BPFA 2N6ZA 1AF8A 2DNWA 2FHSC 2FVEA 2N50A 2KGAA 2MVVA 2FQ0A 1VKUA 1DNYA 2KOSA 2QNWA 3EJEA 5KP6B 2K2QA 2XZ1C 2KGCA 2MD9A 5EJDA 2ROQA 4IZ6A 2JU1A 2FVFA 2MVUA 2VSQA 2MF4A 2MR7A 4MRTC 4BPHA 3EJDA 4CA3A 2AF8A 2EHTA 4PWVB 1L0IA 2GDYA 5KP7B 2L0QA 5KP8B 2KGEA 2XZ0D 2LL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFE A;  2K92 A;  2L9F A;  2MR8 A;  2LIU A;  2FQ2 A;  3EJB A;  2KOP A;  2K0X A;  2KOO A;  5CZD B;  2MY5 A;  2LIW A;  4DG9 A;  4H2W C;  3GZL A;  2M5R A;  3LMO A;  2KW2 A;  2GDW A;  2KWL A;  2N6Y A;  2JQ4 A;  2AFD A;  2L4B A;  1NQ4 A;  2KOR A;  5HVC A;  3NY7 B;  2CGQ A;  4NEO A;  2N98 A;  1ACP A;  3RG2 A;  2FAC A;  1L0H A;  1HY8 A;  2PNG A;  5HV8 A;  2FQ1 A;  2CG5 B;  2CQ8 A;  4HKG A;  4PXH B;  1HQB A;  2FAE A;  2GDX A;  2LML A;  1KLP A;  4H2Y C;  1X3O A;  2JU2 A;  2KGD A;  2K0Y A;  2N5H A;  2EHS A;  2LTE A;  1F80 D;  1DV5 A;  2FAD A;  3GZM A;  3CE7 A;  4BPG A;  2CNR A;  2KG8 A;  4H2X C;  2K94 A;  2KG9 A;  1T8K A;  2X2B A;  2FVA A;  2JGP A;  4R0M A;  2LKI A;  2KG6 A;  2N5I A;  2LPK A;  2LOL A;  1OR5 A;  2KR5 A;  2L22 A;  2K93 A;  2KOQ A;  2AVA A;  4BPF A;  2N6Z A;  1AF8 A;  2DNW A;  2FHS C;  2FVE A;  2N50 A;  2KGA A;  2MVV A;  2FQ0 A;  1VKU A;  1DNY A;  2KOS A;  2QNW A;  3EJE A;  5KP6 B;  2K2Q A;  2XZ1 C;  2KGC A;  2MD9 A;  5EJD A;  2ROQ A;  4IZ6 A;  2JU1 A;  2FVF A;  2MVU A;  2VSQ A;  2MF4 A;  2MR7 A;  4MRT C;  4BPH A;  3EJD A;  4CA3 A;  2AF8 A;  2EHT A;  4PWV B;  1L0I A;  2GDY A;  5KP7 B;  2L0Q A;  5KP8 B;  2KGE A;  2XZ0 D;  2LL8 A; 
#chains in the Genus database with same CATH topology
 4XFX A;  1Q86 Q;  2M8L A;  1JJ2 O;  2LIU A;  2FQ2 A;  3EJB A;  2KOO A;  2GZG A;  2MY5 A;  5JPA A;  3DS0 A;  4COC A;  2ONT A;  3CC2 P;  2E1M A;  2M5R A;  2KW2 A;  4UHP B;  2GDW A;  1MZ8 A;  4PH1 A;  2KOR A;  2CGQ A;  2VLP A;  2BHV A;  2M8N A;  2PNG A;  3MGE A;  5HV8 A;  1Q7Y Q;  4HKG A;  2LF4 A;  1K30 A;  1KLP A;  1X3O A;  2JU2 A;  2K0Y A;  2OTJ P;  1VQL P;  1DV5 A;  1GXG A;  2FAD A;  1M6E X;  2M8P A;  2CNR A;  2KG8 A;  2KG9 A;  5BS1 A;  2PEM A;  1T8K A;  1ZNV A;  2PEK A;  2Z46 A;  2Z44 A;  3CD6 P;  2L22 A;  5HGL A;  1A8O A;  3H0D A;  1IUQ A;  1YIT P;  1AF8 A;  1VQ7 P;  2DNW A;  1BAJ A;  1IMQ A;  2N50 A;  3G1G A;  2KGA A;  1VKU A;  1DNY A;  3G71 P;  2KOS A;  2JO0 A;  3EJE A;  1VQ9 P;  3CME P;  2JAZ A;  3U43 A;  2MD9 A;  4PH0 A;  3NTE A;  3DTJ A;  3DS3 A;  4IZ6 A;  3CMA P;  5HGN A;  2PY8 A;  2GZI A;  2MR7 A;  4MRT C;  4CA3 A;  2P9X A;  2AF8 A;  1VQ8 P;  2LL8 A;  2K92 A;  5HGO A;  4QNB A;  2Z45 A;  2MR8 A;  1RO2 A;  1KD1 Q;  2GZF A;  3GJN A;  2K0X A;  5CZD B;  4DG9 A;  2GZJ A;  1YIJ P;  1M74 A;  2JBG A;  1VQ5 P;  2KWL A;  5BS2 A;  1KQS O;  2JQ4 A;  4XFZ A;  1VQP P;  1NJI Q;  5HVC A;  3H4E A;  2N98 A;  2FAC A;  1VQK P;  1HY8 A;  3CC4 P;  2CG5 B;  2CQ8 A;  3G1I A;  1Q82 Q;  3G6E P;  1HQB A;  2FAE A;  2GDX A;  2LML A;  1E6J P;  1EIA A;  3RG6 C;  2N5H A;  3CCR P;  1VQN P;  3GZM A;  3CE7 A;  3CXC O;  5F2N A;  1UJZ A;  3H47 A;  3P05 A;  1K8A Q;  3B4Q A;  4QKO A;  7CEI A;  2OTL P;  2JYL A;  3I56 P;  2KOQ A;  3OW2 O;  5DCK A;  1D1D A;  2JB0 A;  2FHS C;  2FVE A;  2FQ0 A;  4U0B A;  2PEQ A;  1W2B O;  3I55 P;  5KP6 B;  2K2Q A;  2XV6 A;  2PEI A;  3DS2 A;  1K9M Q;  2XXM A;  3CCV P;  1VQ4 P;  2K0D X;  3DS1 A;  4BPH A;  3EJD A;  4WYM A;  2VLO A;  2EHT A;  2PEJ A;  4PWV B;  2GDY A;  2CWO A;  1RO0 A;  2KGE A;  2XZ0 D;  1Q81 Q;  2K5X A;  1VQO P;  3G0V A;  4H2W C;  1E0H A;  1CEI A;  3GKL C;  5I4T G;  3LMO A;  5F2O A;  1QVF O;  1IMP A;  2N6Y A;  1S72 P;  1VQM P;  2KOD A;  1VHN A;  1NQ4 A;  3NY7 B;  4NEO A;  1YJN P;  1ACP A;  2GYK A;  2WPT A;  3B5I A;  3Q20 A;  2QEX P;  3G26 A;  4PXH B;  3CCL P;  2EG5 A;  4U0D A;  1EOQ A;  4H2Y C;  4F37 A;  2ERH A;  2LTE A;  3DPH A;  2XT1 A;  2L6E A;  2K94 A;  1M90 Q;  2X2B A;  2FVA A;  1AYI A;  2JGP A;  1M1K Q;  2PEN A;  2LKI A;  2OAR A;  3LRY A;  2KG6 A;  2N5I A;  3M1M A;  3CCE P;  2LOL A;  2AVA A;  4GR2 A;  4BPF A;  2N6Z A;  3G21 A;  2MVV A;  3CCU P;  2QNW A;  1FR2 A;  3G28 A;  1EMV A;  2KGC A;  2ROQ A;  2JU1 A;  3CCS P;  2MVU A;  2DGY A;  4GR6 A;  4U0F A;  2MF4 A;  1K73 Q;  3G29 A;  1L0I A;  3HZQ A;  1RNI A;  5KP7 B;  1QRJ A;  1YJ9 P;  2VLQ A;  2AFE A;  2L9F A;  3G4S P;  3DS5 A;  1BXI A;  3HYB A;  2KOP A;  3VRL C;  4U0C A;  3E2D A;  2LIW A;  1VQ6 P;  3GZL A;  4XRO A;  2VLN A;  4XFY A;  2AFD A;  2L4B A;  2BUO A;  1N8R Q;  2NO8 A;  4XRQ A;  3RG2 A;  1L0H A;  1M6N A;  2FQ1 A;  3DS4 A;  2EIA A;  2KGD A;  3CPW O;  3CCJ P;  2EHS A;  1F80 D;  4U0E A;  1YHQ P;  1AUM A;  4BPG A;  1YJW P;  4H2X C;  5F2K A;  2EFJ A;  1YI2 P;  4R0M A;  4M0I A;  2LPK A;  2PEO A;  4IPY A;  1OR5 A;  2KR5 A;  3WBH A;  2K93 A;  2QA4 P;  1GPJ A;  1QVG O;  5EW5 E;  2XZ1 C;  3CCM P;  1A43 A;  1GXH A;  5HGM A;  5EJD A;  1Z6M A;  2FVF A;  2VSQ A;  3CC7 P;  2JYG A;  4U0A A;  1KC8 Q;  1UNK A;  2GZE A;  2L0Q A;  5KP8 B;  4COP A;  3CCQ P;  1ZMB A; 
#chains in the Genus database with same CATH homology
 2AFE A;  2K92 A;  2L9F A;  2MR8 A;  2LIU A;  2FQ2 A;  3EJB A;  2KOP A;  2K0X A;  2KOO A;  5CZD B;  2MY5 A;  2LIW A;  4DG9 A;  4H2W C;  3GZL A;  2M5R A;  3LMO A;  2KW2 A;  2GDW A;  2KWL A;  2N6Y A;  2JQ4 A;  2AFD A;  2L4B A;  1NQ4 A;  2KOR A;  5HVC A;  3NY7 B;  2CGQ A;  4NEO A;  2N98 A;  1ACP A;  3RG2 A;  2FAC A;  1L0H A;  1HY8 A;  2PNG A;  5HV8 A;  2FQ1 A;  2CG5 B;  2CQ8 A;  4HKG A;  4PXH B;  1HQB A;  2FAE A;  2GDX A;  2LML A;  1KLP A;  4H2Y C;  1X3O A;  2JU2 A;  2KGD A;  2K0Y A;  2N5H A;  2EHS A;  2LTE A;  1F80 D;  1DV5 A;  2FAD A;  3GZM A;  3CE7 A;  4BPG A;  2CNR A;  2KG8 A;  4H2X C;  2K94 A;  2KG9 A;  1T8K A;  2X2B A;  2FVA A;  2JGP A;  4R0M A;  2LKI A;  2KG6 A;  2N5I A;  2LPK A;  2LOL A;  1OR5 A;  2KR5 A;  2L22 A;  2K93 A;  2KOQ A;  2AVA A;  4BPF A;  2N6Z A;  1AF8 A;  2DNW A;  2FHS C;  2FVE A;  2N50 A;  2KGA A;  2MVV A;  2FQ0 A;  1VKU A;  1DNY A;  2KOS A;  2QNW A;  3EJE A;  5KP6 B;  2K2Q A;  2XZ1 C;  2KGC A;  2MD9 A;  5EJD A;  2ROQ A;  4IZ6 A;  2JU1 A;  2FVF A;  2MVU A;  2VSQ A;  2MF4 A;  2MR7 A;  4MRT C;  4BPH A;  3EJD A;  4CA3 A;  2AF8 A;  2EHT A;  4PWV B;  1L0I A;  2GDY A;  5KP7 B;  2L0Q A;  5KP8 B;  2KGE A;  2XZ0 D;  2LL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...