2KOOA

Nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
molecule keywords Acyl carrier protein
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kooA00
2KOSA 2N6ZA 2N98A 2FQ0A 2XZ0D 2N5HA 4BPHA 2MD9A 2LMLA 2K0YA 2X2BA 1ACPA 2KWLA 2KG8A 2LIWA 5KP7B 2MVUA 4H2XC 1AF8A 2JU2A 2KGDA 2VSQA 5HV8A 5HVCA 2KG9A 2K93A 2FQ1A 2PNGA 1X3OA 3CE7A 2JQ4A 1VKUA 2L9FA 4MRTC 2LKIA 2N6YA 1DNYA 4BPFA 5KP6B 1NQ4A 1OR5A 2JGPA 3RG2A 2EHSA 5EJDA 2XZ1C 2KOOA 2AVAA 2MR7A 3GZMA 2DNWA 4PWVB 3LMOA 2FAEA 3GZLA 2LIUA 2GDWA 2FADA 2M5RA 1L0IA 3EJEA 2KG6A 2CQ8A 2KORA 2KW2A 4PXHB 2CGQA 2L0QA 2K94A 4HKGA 2L22A 5KP8B 2KOPA 5CZDB 2MF4A 1HY8A 2LOLA 2CNRA 2FQ2A 2FACA 2GDYA 2GDXA 2N50A 4DG9A 2FVAA 2AF8A 2LPKA 2FHSC 2KR5A 2KGCA 2AFDA 2N5IA 1F80D 2L4BA 2LTEA 4H2YC 1L0HA 2MY5A 2ROQA 4R0MA 2FVEA 2LL8A 3EJBA 2MR8A 1DV5A 4H2WC 4BPGA 4NEOA 2K92A 3EJDA 1HQBA 2AFEA 2KGAA 2EHTA 2QNWA 2JU1A 2CG5B 2KOQA 2FVFA 2MVVA 3NY7B 2K0XA 2KGEA 2K2QA 4CA3A 1T8KA 1KLPA 4IZ6A
chains in the Genus database with same CATH superfamily
2M8NA 2N6ZA 2FQ0A 2N5HA 3DS5A 3CC4P 3DS2A 1RO0A 2OARA 4H2XC 1AF8A 4UHPB 3GJNA 5EW5E 1VQKP 2QA4P 1VQOP 3CXCO 1A8OA 3CCJP 3CE7A 2JQ4A 1RNIA 3RG6C 2LKIA 3LRYA 5KP6B 1GXGA 3RG2A 1M90Q 4GR6A 2KOOA 2OTJP 1VQ7P 1E0HA 3GZMA 3U43A 2VLNA 1VQNP 1Q81Q 1VQLP 2GDWA 1N8RQ 2CQ8A 2JYLA 3I56P 2KORA 2L0QA 5KP8B 2BUOA 2JBGA 5HGOA 2L6EA 5CZDB 1MZ8A 1YJNP 3VRLC 5F2OA 2LOLA 2N50A 1K30A 4DG9A 2FVAA 1QRJA 3H0DA 4IPYA 1L0HA 2MY5A 1GXHA 2MR8A 1DV5A 3Q20A 2M8PA 3H47A 3EJDA 3G6EP 1E6JP 3H4EA 5BS2A 2JU1A 4U0EA 2CG5B 2JB0A 5BS1A 2K0XA 2KGEA 4CA3A 2KOSA 1M1KQ 3CCRP 2N98A 3B5IA 2XZ0D 2PEKA 2MD9A 2PEMA 2PEJA 2KGDA 5HVCA 1UJZA 2K93A 1YHQP 2ERHA 2FQ1A 4PH1A 2PNGA 3E2DA 2E1MA 1QVFO 2XXMA 1YJ9P 1VQMP 2L9FA 4MRTC 4M0IA 1DNYA 1NQ4A 4U0FA 2MR7A 2Z46A 3CMEP 1KC8Q 3DS3A 1W2BO 2DNWA 4PWVB 4U0CA 2FAEA 3DTJA 4U0DA 2VLOA 2LIUA 1AUMA 3G71P 2QEXP 2FADA 2PENA 5F2NA 3CCLP 4U0BA 3CCUP 4PXHB 1ZNVA 2K94A 2L22A 2Z45A 3CCSP 2EIAA 1GPJA 1FR2A 2JYGA 1M6NA 3DPHA 1EIAA 2CNRA 2GDYA 2P9XA 2AF8A 1VQPP 2LPKA 1RO2A 2GZFA 2KR5A 1F80D 2L4BA 1YITP 2KODA 4H2YC 4R0MA 2FVEA 2LL8A 4H2WC 1UNKA 4QKOA 5JPAA 2OTLP 1KD1Q 1HQBA 2LF4A 2KGAA 1CEIA 2MVVA 3CCVP 4IZ6A 2BHVA 1BAJA 4BPHA 3DS1A 2WPTA 2LMLA 2EG5A 2K0YA 2X2BA 1ACPA 2KG8A 2LIWA 5KP7B 2MVUA 2JU2A 2GZGA 2K0DX 2VSQA 5HV8A 2K5XA 1NJIQ 2VLPA 1K73Q 4XFXA 7CEIA 2DGYA 2PY8A 3I55P 2N6YA 1D1DA 1OR5A 2JO0A 4F37A 3M1MA 5F2KA 2PEOA 2XV6A 1IUQA 3WBHA 1VQ5P 2KW2A 3G1IA 4HKGA 3HYBA 1EMVA 3OW2O 2MF4A 4XROA 3G29A 2NO8A 1HY8A 1ZMBA 2FQ2A 2FACA 5HGMA 2GDXA 3HZQA 2GYKA 3DS4A 4PH0A 2FHSC 1YJWP 2KGCA 2LTEA 1YI2P 2ROQA 3EJBA 4NEOA 1IMPA 4XFYA 1JJ2O 2AFEA 4QNBA 3DS0A 1A43A 2EHTA 1VQ9P 1VQ8P 2QNWA 3G26A 4GR2A 3GKLC 4COCA 2GZIA 1BXIA 3P05A 1T8KA 2EFJA 3CCQP 3G28A 3CC7P 2XT1A 1KQSO 3CD6P 2KWLA 1VQ4P 2GZEA 1Z6MA 2KG9A 2PEQA 1X3OA 1EOQA 1YIJP 1VKUA 3MGEA 4BPFA 2JGPA 1IMQA 1AYIA 2CWOA 1Q86Q 2EHSA 5EJDA 2XZ1C 2AVAA 1Q82Q 2Z44A 3LMOA 3B4QA 3GZLA 2M5RA 1L0IA 3EJEA 2KG6A 5I4TG 3G1GA 1M6EX 2CGQA 1QVGO 5DCKA 2KOPA 2JAZA 3G21A 2M8LA 4XFZA 4XRQA 3G4SP 1VHNA 2VLQA 3NTEA 1VQ6P 2N5IA 2AFDA 1K9MQ 1M74A 1Q7YQ 5HGNA 3CC2P 4BPGA 5HGLA 2K92A 3CMAP 4COPA 4WYMA 2GZJA 1S72P 4U0AA 3CCMP 2KOQA 2FVFA 3G0VA 3NY7B 2K2QA 2PEIA 2ONTA 3CCEP 1KLPA 1K8AQ 3CPWO
chains in the Genus database with same CATH topology
2KOSA 2N6ZA 2N98A 2FQ0A 2XZ0D 2N5HA 4BPHA 2MD9A 2LMLA 2K0YA 2X2BA 1ACPA 2KWLA 2KG8A 2LIWA 5KP7B 2MVUA 4H2XC 1AF8A 2JU2A 2KGDA 2VSQA 5HV8A 5HVCA 2KG9A 2K93A 2FQ1A 2PNGA 1X3OA 3CE7A 2JQ4A 1VKUA 2L9FA 4MRTC 2LKIA 2N6YA 1DNYA 4BPFA 5KP6B 1NQ4A 1OR5A 2JGPA 3RG2A 2EHSA 5EJDA 2XZ1C 2KOOA 2AVAA 2MR7A 3GZMA 2DNWA 4PWVB 3LMOA 2FAEA 3GZLA 2LIUA 2GDWA 2FADA 2M5RA 1L0IA 3EJEA 2KG6A 2CQ8A 2KORA 2KW2A 4PXHB 2CGQA 2L0QA 2K94A 4HKGA 2L22A 5KP8B 2KOPA 5CZDB 2MF4A 1HY8A 2LOLA 2CNRA 2FQ2A 2FACA 2GDYA 2GDXA 2N50A 4DG9A 2FVAA 2AF8A 2LPKA 2FHSC 2KR5A 2KGCA 2AFDA 2N5IA 1F80D 2L4BA 2LTEA 4H2YC 1L0HA 2MY5A 2ROQA 4R0MA 2FVEA 2LL8A 3EJBA 2MR8A 1DV5A 4H2WC 4BPGA 4NEOA 2K92A 3EJDA 1HQBA 2AFEA 2KGAA 2EHTA 2QNWA 2JU1A 2CG5B 2KOQA 2FVFA 2MVVA 3NY7B 2K0XA 2KGEA 2K2QA 4CA3A 1T8KA 1KLPA 4IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2N6Z A;  2N98 A;  2FQ0 A;  2XZ0 D;  2N5H A;  4BPH A;  2MD9 A;  2LML A;  2K0Y A;  2X2B A;  1ACP A;  2KWL A;  2KG8 A;  2LIW A;  5KP7 B;  2MVU A;  4H2X C;  1AF8 A;  2JU2 A;  2KGD A;  2VSQ A;  5HV8 A;  5HVC A;  2KG9 A;  2K93 A;  2FQ1 A;  2PNG A;  1X3O A;  3CE7 A;  2JQ4 A;  1VKU A;  2L9F A;  4MRT C;  2LKI A;  2N6Y A;  1DNY A;  4BPF A;  5KP6 B;  1NQ4 A;  1OR5 A;  2JGP A;  3RG2 A;  2EHS A;  5EJD A;  2XZ1 C;  2KOO A;  2AVA A;  2MR7 A;  3GZM A;  2DNW A;  4PWV B;  3LMO A;  2FAE A;  3GZL A;  2LIU A;  2GDW A;  2FAD A;  2M5R A;  1L0I A;  3EJE A;  2KG6 A;  2CQ8 A;  2KOR A;  2KW2 A;  4PXH B;  2CGQ A;  2L0Q A;  2K94 A;  4HKG A;  2L22 A;  5KP8 B;  2KOP A;  5CZD B;  2MF4 A;  1HY8 A;  2LOL A;  2CNR A;  2FQ2 A;  2FAC A;  2GDY A;  2GDX A;  2N50 A;  4DG9 A;  2FVA A;  2AF8 A;  2LPK A;  2FHS C;  2KR5 A;  2KGC A;  2AFD A;  2N5I A;  1F80 D;  2L4B A;  2LTE A;  4H2Y C;  1L0H A;  2MY5 A;  2ROQ A;  4R0M A;  2FVE A;  2LL8 A;  3EJB A;  2MR8 A;  1DV5 A;  4H2W C;  4BPG A;  4NEO A;  2K92 A;  3EJD A;  1HQB A;  2AFE A;  2KGA A;  2EHT A;  2QNW A;  2JU1 A;  2CG5 B;  2KOQ A;  2FVF A;  2MVV A;  3NY7 B;  2K0X A;  2KGE A;  2K2Q A;  4CA3 A;  1T8K A;  1KLP A;  4IZ6 A; 
#chains in the Genus database with same CATH topology
 2M8N A;  2N6Z A;  2FQ0 A;  2N5H A;  3DS5 A;  3CC4 P;  3DS2 A;  1RO0 A;  2OAR A;  4H2X C;  1AF8 A;  4UHP B;  3GJN A;  5EW5 E;  1VQK P;  2QA4 P;  1VQO P;  3CXC O;  1A8O A;  3CCJ P;  3CE7 A;  2JQ4 A;  1RNI A;  3RG6 C;  2LKI A;  3LRY A;  5KP6 B;  1GXG A;  3RG2 A;  1M90 Q;  4GR6 A;  2KOO A;  2OTJ P;  1VQ7 P;  1E0H A;  3GZM A;  3U43 A;  2VLN A;  1VQN P;  1Q81 Q;  1VQL P;  2GDW A;  1N8R Q;  2CQ8 A;  2JYL A;  3I56 P;  2KOR A;  2L0Q A;  5KP8 B;  2BUO A;  2JBG A;  5HGO A;  2L6E A;  5CZD B;  1MZ8 A;  1YJN P;  3VRL C;  5F2O A;  2LOL A;  2N50 A;  1K30 A;  4DG9 A;  2FVA A;  1QRJ A;  3H0D A;  4IPY A;  1L0H A;  2MY5 A;  1GXH A;  2MR8 A;  1DV5 A;  3Q20 A;  2M8P A;  3H47 A;  3EJD A;  3G6E P;  1E6J P;  3H4E A;  5BS2 A;  2JU1 A;  4U0E A;  2CG5 B;  2JB0 A;  5BS1 A;  2K0X A;  2KGE A;  4CA3 A;  2KOS A;  1M1K Q;  3CCR P;  2N98 A;  3B5I A;  2XZ0 D;  2PEK A;  2MD9 A;  2PEM A;  2PEJ A;  2KGD A;  5HVC A;  1UJZ A;  2K93 A;  1YHQ P;  2ERH A;  2FQ1 A;  4PH1 A;  2PNG A;  3E2D A;  2E1M A;  1QVF O;  2XXM A;  1YJ9 P;  1VQM P;  2L9F A;  4MRT C;  4M0I A;  1DNY A;  1NQ4 A;  4U0F A;  2MR7 A;  2Z46 A;  3CME P;  1KC8 Q;  3DS3 A;  1W2B O;  2DNW A;  4PWV B;  4U0C A;  2FAE A;  3DTJ A;  4U0D A;  2VLO A;  2LIU A;  1AUM A;  3G71 P;  2QEX P;  2FAD A;  2PEN A;  5F2N A;  3CCL P;  4U0B A;  3CCU P;  4PXH B;  1ZNV A;  2K94 A;  2L22 A;  2Z45 A;  3CCS P;  2EIA A;  1GPJ A;  1FR2 A;  2JYG A;  1M6N A;  3DPH A;  1EIA A;  2CNR A;  2GDY A;  2P9X A;  2AF8 A;  1VQP P;  2LPK A;  1RO2 A;  2GZF A;  2KR5 A;  1F80 D;  2L4B A;  1YIT P;  2KOD A;  4H2Y C;  4R0M A;  2FVE A;  2LL8 A;  4H2W C;  1UNK A;  4QKO A;  5JPA A;  2OTL P;  1KD1 Q;  1HQB A;  2LF4 A;  2KGA A;  1CEI A;  2MVV A;  3CCV P;  4IZ6 A;  2BHV A;  1BAJ A;  4BPH A;  3DS1 A;  2WPT A;  2LML A;  2EG5 A;  2K0Y A;  2X2B A;  1ACP A;  2KG8 A;  2LIW A;  5KP7 B;  2MVU A;  2JU2 A;  2GZG A;  2K0D X;  2VSQ A;  5HV8 A;  2K5X A;  1NJI Q;  2VLP A;  1K73 Q;  4XFX A;  7CEI A;  2DGY A;  2PY8 A;  3I55 P;  2N6Y A;  1D1D A;  1OR5 A;  2JO0 A;  4F37 A;  3M1M A;  5F2K A;  2PEO A;  2XV6 A;  1IUQ A;  3WBH A;  1VQ5 P;  2KW2 A;  3G1I A;  4HKG A;  3HYB A;  1EMV A;  3OW2 O;  2MF4 A;  4XRO A;  3G29 A;  2NO8 A;  1HY8 A;  1ZMB A;  2FQ2 A;  2FAC A;  5HGM A;  2GDX A;  3HZQ A;  2GYK A;  3DS4 A;  4PH0 A;  2FHS C;  1YJW P;  2KGC A;  2LTE A;  1YI2 P;  2ROQ A;  3EJB A;  4NEO A;  1IMP A;  4XFY A;  1JJ2 O;  2AFE A;  4QNB A;  3DS0 A;  1A43 A;  2EHT A;  1VQ9 P;  1VQ8 P;  2QNW A;  3G26 A;  4GR2 A;  3GKL C;  4COC A;  2GZI A;  1BXI A;  3P05 A;  1T8K A;  2EFJ A;  3CCQ P;  3G28 A;  3CC7 P;  2XT1 A;  1KQS O;  3CD6 P;  2KWL A;  1VQ4 P;  2GZE A;  1Z6M A;  2KG9 A;  2PEQ A;  1X3O A;  1EOQ A;  1YIJ P;  1VKU A;  3MGE A;  4BPF A;  2JGP A;  1IMQ A;  1AYI A;  2CWO A;  1Q86 Q;  2EHS A;  5EJD A;  2XZ1 C;  2AVA A;  1Q82 Q;  2Z44 A;  3LMO A;  3B4Q A;  3GZL A;  2M5R A;  1L0I A;  3EJE A;  2KG6 A;  5I4T G;  3G1G A;  1M6E X;  2CGQ A;  1QVG O;  5DCK A;  2KOP A;  2JAZ A;  3G21 A;  2M8L A;  4XFZ A;  4XRQ A;  3G4S P;  1VHN A;  2VLQ A;  3NTE A;  1VQ6 P;  2N5I A;  2AFD A;  1K9M Q;  1M74 A;  1Q7Y Q;  5HGN A;  3CC2 P;  4BPG A;  5HGL A;  2K92 A;  3CMA P;  4COP A;  4WYM A;  2GZJ A;  1S72 P;  4U0A A;  3CCM P;  2KOQ A;  2FVF A;  3G0V A;  3NY7 B;  2K2Q A;  2PEI A;  2ONT A;  3CCE P;  1KLP A;  1K8A Q;  3CPW O; 
#chains in the Genus database with same CATH homology
 2KOS A;  2N6Z A;  2N98 A;  2FQ0 A;  2XZ0 D;  2N5H A;  4BPH A;  2MD9 A;  2LML A;  2K0Y A;  2X2B A;  1ACP A;  2KWL A;  2KG8 A;  2LIW A;  5KP7 B;  2MVU A;  4H2X C;  1AF8 A;  2JU2 A;  2KGD A;  2VSQ A;  5HV8 A;  5HVC A;  2KG9 A;  2K93 A;  2FQ1 A;  2PNG A;  1X3O A;  3CE7 A;  2JQ4 A;  1VKU A;  2L9F A;  4MRT C;  2LKI A;  2N6Y A;  1DNY A;  4BPF A;  5KP6 B;  1NQ4 A;  1OR5 A;  2JGP A;  3RG2 A;  2EHS A;  5EJD A;  2XZ1 C;  2KOO A;  2AVA A;  2MR7 A;  3GZM A;  2DNW A;  4PWV B;  3LMO A;  2FAE A;  3GZL A;  2LIU A;  2GDW A;  2FAD A;  2M5R A;  1L0I A;  3EJE A;  2KG6 A;  2CQ8 A;  2KOR A;  2KW2 A;  4PXH B;  2CGQ A;  2L0Q A;  2K94 A;  4HKG A;  2L22 A;  5KP8 B;  2KOP A;  5CZD B;  2MF4 A;  1HY8 A;  2LOL A;  2CNR A;  2FQ2 A;  2FAC A;  2GDY A;  2GDX A;  2N50 A;  4DG9 A;  2FVA A;  2AF8 A;  2LPK A;  2FHS C;  2KR5 A;  2KGC A;  2AFD A;  2N5I A;  1F80 D;  2L4B A;  2LTE A;  4H2Y C;  1L0H A;  2MY5 A;  2ROQ A;  4R0M A;  2FVE A;  2LL8 A;  3EJB A;  2MR8 A;  1DV5 A;  4H2W C;  4BPG A;  4NEO A;  2K92 A;  3EJD A;  1HQB A;  2AFE A;  2KGA A;  2EHT A;  2QNW A;  2JU1 A;  2CG5 B;  2KOQ A;  2FVF A;  2MVV A;  3NY7 B;  2K0X A;  2KGE A;  2K2Q A;  4CA3 A;  1T8K A;  1KLP A;  4IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...