2KOOA

Nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kooA00
4R0MA 5KP7B 2KOPA 1OR5A 2AF8A 2MR8A 1L0HA 2KR5A 2LOLA 2MY5A 1L0IA 2LMLA 4BPGA 2CNRA 2LTEA 5CZDB 2LL8A 2JU2A 2L4BA 4HKGA 4IZ6A 2JU1A 2FHSC 4DG9A 2LKIA 2MVUA 2FQ2A 4H2YC 1F80D 2KORA 2LIUA 2LPKA 1NQ4A 2K2QA 2KGAA 2PNGA 1DNYA 3CE7A 2N50A 3GZLA 2KOOA 2JGPA 5KP6B 3EJEA 2EHTA 2KGCA 2MVVA 2N6ZA 2EHSA 2M5RA 2FVEA 2K93A 2GDXA 2ROQA 1AF8A 2DNWA 4H2WC 2N98A 2GDWA 4H2XC 2KG8A 4PWVB 2KW2A 1HQBA 1VKUA 2FVFA 3EJBA 3GZMA 4BPFA 2FQ0A 3NY7B 5EJDA 2K0XA 2AFEA 2FQ1A 2KWLA 3LMOA 3RG2A 2K94A 4NEOA 4MRTC 2CG5B 2FVAA 2KGEA 2FADA 2MD9A 1DV5A 2XZ1C 5HVCA 2MR7A 1X3OA 3EJDA 2LIWA 2FACA 2FAEA 2KG6A 2L22A 2N5IA 2L0QA 5KP8B 2MF4A 1HY8A 1T8KA 2KG9A 2KOQA 2CQ8A 2GDYA 2N6YA 2K92A 2N5HA 2JQ4A 2AVAA 4PXHB 2L9FA 2X2BA 1ACPA 2QNWA 2CGQA 2XZ0D 2VSQA 2KOSA 2K0YA 2AFDA 5HV8A 1KLPA 2KGDA 4CA3A 4BPHA
chains in the Genus database with same CATH superfamily
3DPHA 2KOPA 2AF8A 2K5XA 1YJNP 1W2BO 2JBGA 1L0HA 3DS2A 2GZGA 1VQ6P 2JU1A 3DS3A 4XROA 1NJIQ 3G1GA 1F80D 2KORA 2EG5A 4QNBA 3CCQP 1K30A 2PNGA 1Q82Q 1YJ9P 2N50A 4COPA 2MVVA 3G29A 1YIJP 1AF8A 2OARA 3H0DA 5F2KA 5HGMA 2DNWA 2JYGA 1VQ7P 2KG8A 4U0DA 2ERHA 1K73Q 2K0XA 2FQ1A 4WYMA 1K8AQ 1M90Q 3CXCO 5BS1A 2K94A 2VLNA 2XXMA 4MRTC 2CG5B 2FADA 4U0FA 3CCJP 3DS1A 1D1DA 1VQ4P 1ZNVA 2KG6A 3OW2O 1IMQA 1UNKA 1HY8A 2KOQA 2CQ8A 2N5HA 1Q86Q 4M0IA 1VQOP 1ACPA 3CPWO 2QNWA 5I4TG 2VSQA 2EIAA 3CMEP 2K0YA 2GZJA 5HV8A 2KGDA 4COCA 3CD6P 2GZFA 5BS2A 2KR5A 2MY5A 1L0IA 4BPGA 1GXGA 2LTEA 2JU2A 2L4BA 2FHSC 3LRYA 2FQ2A 2Z44A 1M1KQ 4U0AA 1VQKP 1K9MQ 1VQ5P 3CE7A 4XFYA 3GZLA 1VQ9P 2KGCA 2EHSA 3DS0A 3GJNA 2Z46A 4IPYA 3Q20A 1IUQA 1M74A 2LF4A 3I55P 2GDWA 3G4SP 2PEOA 4PWVB 2KW2A 1FR2A 3EJBA 4BPFA 2FQ0A 3CMAP 1QRJA 2AFEA 4PH1A 4QKOA 2KODA 3LMOA 1M6NA 3RG2A 3DTJA 3HZQA 4NEOA 4UHPB 1VQLP 3CC7P 2VLQA 1A8OA 1DV5A 1IMPA 1E6JP 2FAEA 3CC4P 2PEIA 2MF4A 3G21A 2KG9A 5HGOA 2K92A 2AVAA 4PXHB 2X2BA 2CGQA 2XZ0D 3CCSP 1MZ8A 1KLPA 2NO8A 4CA3A 2XV6A 2K0DX 4R0MA 3P05A 2GZEA 3CCRP 1Z6MA 1QVFO 1GXHA 5CZDB 2LL8A 4IZ6A 3WBHA 3GKLC 1Q81Q 2LKIA 2MVUA 1YITP 1VHNA 2LPKA 5DCKA 2K2QA 1AUMA 1DNYA 4GR2A 4U0BA 5KP6B 3EJEA 3G28A 2N6ZA 2FVEA 1ZMBA 2K93A 2GDXA 3B5IA 1GPJA 4H2WC 2EFJA 2BHVA 3M1MA 4XRQA 2E1MA 3GZMA 3NY7B 5EJDA 1RNIA 1BAJA 3B4QA 2DGYA 5F2OA 2KWLA 3U43A 4XFXA 2OTLP 1EOQA 2BUOA 3DS4A 2P9XA 2XT1A 1JJ2O 2OTJP 2KGEA 2L6EA 2MD9A 1VQPP 4F37A 2XZ1C 2LIWA 2L0QA 5KP8B 1YI2P 1AYIA 3CCUP 2N6YA 2PEMA 3HYBA 2JQ4A 1EMVA 2Z45A 2JB0A 2KOSA 2VLPA 3E2DA 2AFDA 4XFZA 5F2NA 5KP7B 1VQ8P 1OR5A 1UJZA 2GZIA 2MR8A 2LOLA 2LMLA 2CNRA 4HKGA 3NTEA 4DG9A 2M8LA 4H2YC 3CCMP 1EIAA 2LIUA 3H4EA 1NQ4A 2PY8A 1A43A 1QVGO 4PH0A 2KGAA 3G71P 1YJWP 5HGNA 1VQNP 2VLOA 3CCVP 2PEKA 3MGEA 2KOOA 2JGPA 5HGLA 2EHTA 3G0VA 1RO2A 2M5RA 2WPTA 2ROQA 3G26A 5EW5E 2N98A 1N8RQ 2CWOA 4GR6A 2GYKA 2ONTA 4H2XC 1M6EX 1BXIA 1KC8Q 1HQBA 2JO0A 1VKUA 3CC2P 2FVFA 1VQMP 2QEXP 3I56P 3VRLC 1KD1Q 1KQSO 3DS5A 3RG6C 2JAZA 2M8PA 2QA4P 2M8NA 2PEJA 1S72P 3H47A 2FVAA 2PEQA 2PENA 1RO0A 1CEIA 3CCLP 2JYLA 5HVCA 2MR7A 1X3OA 3EJDA 2L22A 2FACA 2N5IA 1Q7YQ 4U0CA 5JPAA 4U0EA 1T8KA 3CCEP 2GDYA 1E0HA 7CEIA 3G1IA 2L9FA 1YHQP 4BPHA 3G6EP
chains in the Genus database with same CATH topology
4R0MA 5KP7B 2KOPA 1OR5A 2AF8A 2MR8A 1L0HA 2KR5A 2LOLA 2MY5A 1L0IA 2LMLA 4BPGA 2CNRA 2LTEA 5CZDB 2LL8A 2JU2A 2L4BA 4HKGA 4IZ6A 2JU1A 2FHSC 4DG9A 2LKIA 2MVUA 2FQ2A 4H2YC 1F80D 2KORA 2LIUA 2LPKA 1NQ4A 2K2QA 2KGAA 2PNGA 1DNYA 3CE7A 2N50A 3GZLA 2KOOA 2JGPA 5KP6B 3EJEA 2EHTA 2KGCA 2MVVA 2N6ZA 2EHSA 2M5RA 2FVEA 2K93A 2GDXA 2ROQA 1AF8A 2DNWA 4H2WC 2N98A 2GDWA 4H2XC 2KG8A 4PWVB 2KW2A 1HQBA 1VKUA 2FVFA 3EJBA 3GZMA 4BPFA 2FQ0A 3NY7B 5EJDA 2K0XA 2AFEA 2FQ1A 2KWLA 3LMOA 3RG2A 2K94A 4NEOA 4MRTC 2CG5B 2FVAA 2KGEA 2FADA 2MD9A 1DV5A 2XZ1C 5HVCA 2MR7A 1X3OA 3EJDA 2LIWA 2FACA 2FAEA 2KG6A 2L22A 2N5IA 2L0QA 5KP8B 2MF4A 1HY8A 1T8KA 2KG9A 2KOQA 2CQ8A 2GDYA 2N6YA 2K92A 2N5HA 2JQ4A 2AVAA 4PXHB 2L9FA 2X2BA 1ACPA 2QNWA 2CGQA 2XZ0D 2VSQA 2KOSA 2K0YA 2AFDA 5HV8A 1KLPA 2KGDA 4CA3A 4BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0M A;  5KP7 B;  2KOP A;  1OR5 A;  2AF8 A;  2MR8 A;  1L0H A;  2KR5 A;  2LOL A;  2MY5 A;  1L0I A;  2LML A;  4BPG A;  2CNR A;  2LTE A;  5CZD B;  2LL8 A;  2JU2 A;  2L4B A;  4HKG A;  4IZ6 A;  2JU1 A;  2FHS C;  4DG9 A;  2LKI A;  2MVU A;  2FQ2 A;  4H2Y C;  1F80 D;  2KOR A;  2LIU A;  2LPK A;  1NQ4 A;  2K2Q A;  2KGA A;  2PNG A;  1DNY A;  3CE7 A;  2N50 A;  3GZL A;  2KOO A;  2JGP A;  5KP6 B;  3EJE A;  2EHT A;  2KGC A;  2MVV A;  2N6Z A;  2EHS A;  2M5R A;  2FVE A;  2K93 A;  2GDX A;  2ROQ A;  1AF8 A;  2DNW A;  4H2W C;  2N98 A;  2GDW A;  4H2X C;  2KG8 A;  4PWV B;  2KW2 A;  1HQB A;  1VKU A;  2FVF A;  3EJB A;  3GZM A;  4BPF A;  2FQ0 A;  3NY7 B;  5EJD A;  2K0X A;  2AFE A;  2FQ1 A;  2KWL A;  3LMO A;  3RG2 A;  2K94 A;  4NEO A;  4MRT C;  2CG5 B;  2FVA A;  2KGE A;  2FAD A;  2MD9 A;  1DV5 A;  2XZ1 C;  5HVC A;  2MR7 A;  1X3O A;  3EJD A;  2LIW A;  2FAC A;  2FAE A;  2KG6 A;  2L22 A;  2N5I A;  2L0Q A;  5KP8 B;  2MF4 A;  1HY8 A;  1T8K A;  2KG9 A;  2KOQ A;  2CQ8 A;  2GDY A;  2N6Y A;  2K92 A;  2N5H A;  2JQ4 A;  2AVA A;  4PXH B;  2L9F A;  2X2B A;  1ACP A;  2QNW A;  2CGQ A;  2XZ0 D;  2VSQ A;  2KOS A;  2K0Y A;  2AFD A;  5HV8 A;  1KLP A;  2KGD A;  4CA3 A;  4BPH A; 
#chains in the Genus database with same CATH topology
 3DPH A;  2KOP A;  2AF8 A;  2K5X A;  1YJN P;  1W2B O;  2JBG A;  1L0H A;  3DS2 A;  2GZG A;  1VQ6 P;  2JU1 A;  3DS3 A;  4XRO A;  1NJI Q;  3G1G A;  1F80 D;  2KOR A;  2EG5 A;  4QNB A;  3CCQ P;  1K30 A;  2PNG A;  1Q82 Q;  1YJ9 P;  2N50 A;  4COP A;  2MVV A;  3G29 A;  1YIJ P;  1AF8 A;  2OAR A;  3H0D A;  5F2K A;  5HGM A;  2DNW A;  2JYG A;  1VQ7 P;  2KG8 A;  4U0D A;  2ERH A;  1K73 Q;  2K0X A;  2FQ1 A;  4WYM A;  1K8A Q;  1M90 Q;  3CXC O;  5BS1 A;  2K94 A;  2VLN A;  2XXM A;  4MRT C;  2CG5 B;  2FAD A;  4U0F A;  3CCJ P;  3DS1 A;  1D1D A;  1VQ4 P;  1ZNV A;  2KG6 A;  3OW2 O;  1IMQ A;  1UNK A;  1HY8 A;  2KOQ A;  2CQ8 A;  2N5H A;  1Q86 Q;  4M0I A;  1VQO P;  1ACP A;  3CPW O;  2QNW A;  5I4T G;  2VSQ A;  2EIA A;  3CME P;  2K0Y A;  2GZJ A;  5HV8 A;  2KGD A;  4COC A;  3CD6 P;  2GZF A;  5BS2 A;  2KR5 A;  2MY5 A;  1L0I A;  4BPG A;  1GXG A;  2LTE A;  2JU2 A;  2L4B A;  2FHS C;  3LRY A;  2FQ2 A;  2Z44 A;  1M1K Q;  4U0A A;  1VQK P;  1K9M Q;  1VQ5 P;  3CE7 A;  4XFY A;  3GZL A;  1VQ9 P;  2KGC A;  2EHS A;  3DS0 A;  3GJN A;  2Z46 A;  4IPY A;  3Q20 A;  1IUQ A;  1M74 A;  2LF4 A;  3I55 P;  2GDW A;  3G4S P;  2PEO A;  4PWV B;  2KW2 A;  1FR2 A;  3EJB A;  4BPF A;  2FQ0 A;  3CMA P;  1QRJ A;  2AFE A;  4PH1 A;  4QKO A;  2KOD A;  3LMO A;  1M6N A;  3RG2 A;  3DTJ A;  3HZQ A;  4NEO A;  4UHP B;  1VQL P;  3CC7 P;  2VLQ A;  1A8O A;  1DV5 A;  1IMP A;  1E6J P;  2FAE A;  3CC4 P;  2PEI A;  2MF4 A;  3G21 A;  2KG9 A;  5HGO A;  2K92 A;  2AVA A;  4PXH B;  2X2B A;  2CGQ A;  2XZ0 D;  3CCS P;  1MZ8 A;  1KLP A;  2NO8 A;  4CA3 A;  2XV6 A;  2K0D X;  4R0M A;  3P05 A;  2GZE A;  3CCR P;  1Z6M A;  1QVF O;  1GXH A;  5CZD B;  2LL8 A;  4IZ6 A;  3WBH A;  3GKL C;  1Q81 Q;  2LKI A;  2MVU A;  1YIT P;  1VHN A;  2LPK A;  5DCK A;  2K2Q A;  1AUM A;  1DNY A;  4GR2 A;  4U0B A;  5KP6 B;  3EJE A;  3G28 A;  2N6Z A;  2FVE A;  1ZMB A;  2K93 A;  2GDX A;  3B5I A;  1GPJ A;  4H2W C;  2EFJ A;  2BHV A;  3M1M A;  4XRQ A;  2E1M A;  3GZM A;  3NY7 B;  5EJD A;  1RNI A;  1BAJ A;  3B4Q A;  2DGY A;  5F2O A;  2KWL A;  3U43 A;  4XFX A;  2OTL P;  1EOQ A;  2BUO A;  3DS4 A;  2P9X A;  2XT1 A;  1JJ2 O;  2OTJ P;  2KGE A;  2L6E A;  2MD9 A;  1VQP P;  4F37 A;  2XZ1 C;  2LIW A;  2L0Q A;  5KP8 B;  1YI2 P;  1AYI A;  3CCU P;  2N6Y A;  2PEM A;  3HYB A;  2JQ4 A;  1EMV A;  2Z45 A;  2JB0 A;  2KOS A;  2VLP A;  3E2D A;  2AFD A;  4XFZ A;  5F2N A;  5KP7 B;  1VQ8 P;  1OR5 A;  1UJZ A;  2GZI A;  2MR8 A;  2LOL A;  2LML A;  2CNR A;  4HKG A;  3NTE A;  4DG9 A;  2M8L A;  4H2Y C;  3CCM P;  1EIA A;  2LIU A;  3H4E A;  1NQ4 A;  2PY8 A;  1A43 A;  1QVG O;  4PH0 A;  2KGA A;  3G71 P;  1YJW P;  5HGN A;  1VQN P;  2VLO A;  3CCV P;  2PEK A;  3MGE A;  2KOO A;  2JGP A;  5HGL A;  2EHT A;  3G0V A;  1RO2 A;  2M5R A;  2WPT A;  2ROQ A;  3G26 A;  5EW5 E;  2N98 A;  1N8R Q;  2CWO A;  4GR6 A;  2GYK A;  2ONT A;  4H2X C;  1M6E X;  1BXI A;  1KC8 Q;  1HQB A;  2JO0 A;  1VKU A;  3CC2 P;  2FVF A;  1VQM P;  2QEX P;  3I56 P;  3VRL C;  1KD1 Q;  1KQS O;  3DS5 A;  3RG6 C;  2JAZ A;  2M8P A;  2QA4 P;  2M8N A;  2PEJ A;  1S72 P;  3H47 A;  2FVA A;  2PEQ A;  2PEN A;  1RO0 A;  1CEI A;  3CCL P;  2JYL A;  5HVC A;  2MR7 A;  1X3O A;  3EJD A;  2L22 A;  2FAC A;  2N5I A;  1Q7Y Q;  4U0C A;  5JPA A;  4U0E A;  1T8K A;  3CCE P;  2GDY A;  1E0H A;  7CEI A;  3G1I A;  2L9F A;  1YHQ P;  4BPH A;  3G6E P; 
#chains in the Genus database with same CATH homology
 4R0M A;  5KP7 B;  2KOP A;  1OR5 A;  2AF8 A;  2MR8 A;  1L0H A;  2KR5 A;  2LOL A;  2MY5 A;  1L0I A;  2LML A;  4BPG A;  2CNR A;  2LTE A;  5CZD B;  2LL8 A;  2JU2 A;  2L4B A;  4HKG A;  4IZ6 A;  2JU1 A;  2FHS C;  4DG9 A;  2LKI A;  2MVU A;  2FQ2 A;  4H2Y C;  1F80 D;  2KOR A;  2LIU A;  2LPK A;  1NQ4 A;  2K2Q A;  2KGA A;  2PNG A;  1DNY A;  3CE7 A;  2N50 A;  3GZL A;  2KOO A;  2JGP A;  5KP6 B;  3EJE A;  2EHT A;  2KGC A;  2MVV A;  2N6Z A;  2EHS A;  2M5R A;  2FVE A;  2K93 A;  2GDX A;  2ROQ A;  1AF8 A;  2DNW A;  4H2W C;  2N98 A;  2GDW A;  4H2X C;  2KG8 A;  4PWV B;  2KW2 A;  1HQB A;  1VKU A;  2FVF A;  3EJB A;  3GZM A;  4BPF A;  2FQ0 A;  3NY7 B;  5EJD A;  2K0X A;  2AFE A;  2FQ1 A;  2KWL A;  3LMO A;  3RG2 A;  2K94 A;  4NEO A;  4MRT C;  2CG5 B;  2FVA A;  2KGE A;  2FAD A;  2MD9 A;  1DV5 A;  2XZ1 C;  5HVC A;  2MR7 A;  1X3O A;  3EJD A;  2LIW A;  2FAC A;  2FAE A;  2KG6 A;  2L22 A;  2N5I A;  2L0Q A;  5KP8 B;  2MF4 A;  1HY8 A;  1T8K A;  2KG9 A;  2KOQ A;  2CQ8 A;  2GDY A;  2N6Y A;  2K92 A;  2N5H A;  2JQ4 A;  2AVA A;  4PXH B;  2L9F A;  2X2B A;  1ACP A;  2QNW A;  2CGQ A;  2XZ0 D;  2VSQ A;  2KOS A;  2K0Y A;  2AFD A;  5HV8 A;  1KLP A;  2KGD A;  4CA3 A;  4BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...