2KOOA

Nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
b'AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kooA00
2FVFA 2K93A 2X2BA 4H2YC 2CNRA 2MR8A 2FADA 2MF4A 2LKIA 2ROQA 3EJEA 2LTEA 3EJDA 4IZ6A 2CGQA 2N6YA 3RG2A 3EJBA 2N6ZA 2N98A 2N5IA 2LIWA 3GZLA 2KOSA 2KGAA 3LMOA 1KLPA 2JU2A 2KGCA 4MRTC 2N50A 2GDXA 4DG9A 4PWVB 2KG9A 2N5HA 2L9FA 2LPKA 2GDYA 2KWLA 1HY8A 2CQ8A 2DNWA 2AF8A 5CZDB 2MY5A 4H2XC 2LL8A 4BPGA 2KGEA 1X3OA 4H2WC 1L0HA 2L0QA 1VKUA 2VSQA 2FVAA 2K0XA 4CA3A 5KP7B 3NY7B 2CG5B 4R0MA 1DNYA 2AFEA 4HKGA 1DV5A 2K2QA 4BPFA 2FQ0A 2LOLA 2FACA 2QNWA 2MVUA 2MD9A 2FAEA 2K92A 2KGDA 4NEOA 2XZ1C 2JGPA 2LMLA 1OR5A 5HV8A 2EHSA 5HVCA 2L22A 2KR5A 1T8KA 2KOQA 2AFDA 3CE7A 2LIUA 5KP8B 2KOPA 2K94A 3GZMA 1ACPA 1HQBA 2FQ2A 2K0YA 2KG6A 2MVVA 1NQ4A 2L4BA 2KOOA 1AF8A 2KG8A 2EHTA 2PNGA 2MR7A 2M5RA 4PXHB 2FHSC 1L0IA 2FQ1A 2KORA 2FVEA 2JU1A 2XZ0D 2GDWA 4BPHA 2AVAA 1F80D 2JQ4A 2KW2A 5KP6B 5EJDA
chains in the Genus database with same CATH superfamily
1K9MQ 2FVFA 1VQ4P 2MR8A 1GXHA 2MF4A 3EJEA 1MZ8A 4XFXA 3EJDA 3CCJP 2CGQA 2ERHA 2N6ZA 3GZLA 1QVGO 2XT1A 2N50A 2WPTA 2L6EA 4XFZA 2QA4P 2KODA 2CWOA 2N5HA 3DPHA 3CMAP 2MY5A 2LL8A 1AUMA 2KGEA 2L0QA 1Q86Q 2EG5A 2FVAA 4CA3A 5KP7B 2VLNA 3G28A 1IMPA 2OTLP 4COPA 3VRLC 3CCSP 2PEMA 2PEIA 2Z45A 4GR2A 2QNWA 1A8OA 2GZFA 2K92A 1VQNP 1ZNVA 2K5XA 2XZ1C 3B5IA 3GKLC 1VQ8P 2P9XA 4GR6A 1OR5A 5HV8A 3G71P 1VQ5P 2KOQA 2BUOA 3CE7A 1UJZA 5KP8B 1M90Q 1ACPA 1VQPP 2JYLA 2FQ2A 7CEIA 1NQ4A 2DGYA 2MR7A 2FHSC 2FQ1A 1IUQA 2ONTA 1EIAA 4U0EA 3HYBA 3CCUP 1IMQA 3NTEA 2KW2A 1F80D 5EJDA 1AYIA 3G26A 2K93A 2X2BA 2VLPA 3MGEA 1GXGA 2ROQA 2OARA 1E0HA 1Q82Q 3B4QA 3G21A 4IZ6A 2EFJA 3LRYA 3RG2A 1RO2A 1BXIA 3H47A 1M6NA 1K73Q 2JU2A 2KGCA 4MRTC 2NO8A 4PWVB 2KG9A 2L9FA 1YJ9P 2KWLA 2VLQA 1HY8A 2PEOA 5HGLA 4XROA 4BPGA 5JPAA 1X3OA 3DS4A 1VKUA 1YJNP 2M8LA 3CCMP 1CEIA 1DV5A 1BAJA 2LF4A 2JYGA 3I56P 2JB0A 2MVUA 2FAEA 3G1GA 2KGDA 3CCLP 2PEKA 1JJ2O 2EHSA 2M8PA 2L22A 1T8KA 5I4TG 2LIUA 1Q81Q 1UNKA 3GZMA 3CXCO 2K0YA 2M8NA 5HGMA 2MVVA 1S72P 1K8AQ 2KORA 4U0CA 3DS2A 1VQMP 2JU1A 2XZ0D 2GZGA 3G29A 3DS0A 5F2NA 2Z46A 2CNRA 4IPYA 3H4EA 5BS1A 2LKIA 2JO0A 1KC8Q 4U0BA 1VQOP 4F37A 1YJWP 2N6YA 4WYMA 1KLPA 1M6EX 3P05A 4PH1A 2GDXA 4DG9A 3H0DA 3DS1A 2GZJA 1KD1Q 2LPKA 4U0AA 4PH0A 2DNWA 1VHNA 3CC2P 2VSQA 1VQ6P 4R0MA 4HKGA 1Z6MA 2E1MA 1RNIA 3G1IA 2JAZA 3CCEP 2FQ0A 5DCKA 2LOLA 2FACA 3DS5A 4NEOA 2GZEA 2JGPA 4XFYA 2PEQA 4XRQA 1NJIQ 2QEXP 2PY8A 1YI2P 2EIAA 2AFDA 3G6EP 2KOPA 2L4BA 2KOOA 2EHTA 2PNGA 2M5RA 4U0DA 3U43A 1L0IA 5HGOA 2FVEA 3CCRP 1Q7YQ 4UHPB 2GDWA 3Q20A 4BPHA 2AVAA 1M74A 5KP6B 5EW5E 4QKOA 5F2OA 5BS2A 4H2YC 3CCQP 1W2BO 2XXMA 2FADA 4COCA 2JBGA 1QVFO 4M0IA 2LTEA 1EOQA 2GYKA 3EJBA 2BHVA 3CC7P 2N98A 2N5IA 2LIWA 2XV6A 2KGAA 2KOSA 3LMOA 3I55P 1KQSO 1VQ9P 5F2KA 2GDYA 2CQ8A 2AF8A 5CZDB 3OW2O 4H2XC 3CPWO 3HZQA 4H2WC 1L0HA 3CD6P 2K0XA 2Z44A 3NY7B 2GZIA 2CG5B 1A43A 1DNYA 2AFEA 3DTJA 1VQ7P 2K2QA 4BPFA 2VLOA 3RG6C 2MD9A 2OTJP 1QRJA 3E2DA 1RO0A 3G0VA 1YHQP 1YITP 1ZMBA 2LMLA 5HVCA 1E6JP 3DS3A 1M1KQ 3GJNA 1K30A 1VQLP 2KR5A 1GPJA 2PEJA 3CMEP 4QNBA 3G4SP 1D1DA 2K94A 3M1MA 1HQBA 2KG6A 3CCVP 1AF8A 2KG8A 5HGNA 3CC4P 1N8RQ 4PXHB 3WBHA 1FR2A 4U0FA 2PENA 1YIJP 2K0DX 1VQKP 1EMVA 2JQ4A
chains in the Genus database with same CATH topology
2FVFA 2K93A 2X2BA 4H2YC 2CNRA 2MR8A 2FADA 2MF4A 2LKIA 2ROQA 3EJEA 2LTEA 3EJDA 4IZ6A 2CGQA 2N6YA 3RG2A 3EJBA 2N6ZA 2N98A 2N5IA 2LIWA 3GZLA 2KOSA 2KGAA 3LMOA 1KLPA 2JU2A 2KGCA 4MRTC 2N50A 2GDXA 4DG9A 4PWVB 2KG9A 2N5HA 2L9FA 2LPKA 2GDYA 2KWLA 1HY8A 2CQ8A 2DNWA 2AF8A 5CZDB 2MY5A 4H2XC 2LL8A 4BPGA 2KGEA 1X3OA 4H2WC 1L0HA 2L0QA 1VKUA 2VSQA 2FVAA 2K0XA 4CA3A 5KP7B 3NY7B 2CG5B 4R0MA 1DNYA 2AFEA 4HKGA 1DV5A 2K2QA 4BPFA 2FQ0A 2LOLA 2FACA 2QNWA 2MVUA 2MD9A 2FAEA 2K92A 2KGDA 4NEOA 2XZ1C 2JGPA 2LMLA 1OR5A 5HV8A 2EHSA 5HVCA 2L22A 2KR5A 1T8KA 2KOQA 2AFDA 3CE7A 2LIUA 5KP8B 2KOPA 2K94A 3GZMA 1ACPA 1HQBA 2FQ2A 2K0YA 2KG6A 2MVVA 1NQ4A 2L4BA 2KOOA 1AF8A 2KG8A 2EHTA 2PNGA 2MR7A 2M5RA 4PXHB 2FHSC 1L0IA 2FQ1A 2KORA 2FVEA 2JU1A 2XZ0D 2GDWA 4BPHA 2AVAA 1F80D 2JQ4A 2KW2A 5KP6B 5EJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVF A;  2K93 A;  2X2B A;  4H2Y C;  2CNR A;  2MR8 A;  2FAD A;  2MF4 A;  2LKI A;  2ROQ A;  3EJE A;  2LTE A;  3EJD A;  4IZ6 A;  2CGQ A;  2N6Y A;  3RG2 A;  3EJB A;  2N6Z A;  2N98 A;  2N5I A;  2LIW A;  3GZL A;  2KOS A;  2KGA A;  3LMO A;  1KLP A;  2JU2 A;  2KGC A;  4MRT C;  2N50 A;  2GDX A;  4DG9 A;  4PWV B;  2KG9 A;  2N5H A;  2L9F A;  2LPK A;  2GDY A;  2KWL A;  1HY8 A;  2CQ8 A;  2DNW A;  2AF8 A;  5CZD B;  2MY5 A;  4H2X C;  2LL8 A;  4BPG A;  2KGE A;  1X3O A;  4H2W C;  1L0H A;  2L0Q A;  1VKU A;  2VSQ A;  2FVA A;  2K0X A;  4CA3 A;  5KP7 B;  3NY7 B;  2CG5 B;  4R0M A;  1DNY A;  2AFE A;  4HKG A;  1DV5 A;  2K2Q A;  4BPF A;  2FQ0 A;  2LOL A;  2FAC A;  2QNW A;  2MVU A;  2MD9 A;  2FAE A;  2K92 A;  2KGD A;  4NEO A;  2XZ1 C;  2JGP A;  2LML A;  1OR5 A;  5HV8 A;  2EHS A;  5HVC A;  2L22 A;  2KR5 A;  1T8K A;  2KOQ A;  2AFD A;  3CE7 A;  2LIU A;  5KP8 B;  2KOP A;  2K94 A;  3GZM A;  1ACP A;  1HQB A;  2FQ2 A;  2K0Y A;  2KG6 A;  2MVV A;  1NQ4 A;  2L4B A;  2KOO A;  1AF8 A;  2KG8 A;  2EHT A;  2PNG A;  2MR7 A;  2M5R A;  4PXH B;  2FHS C;  1L0I A;  2FQ1 A;  2KOR A;  2FVE A;  2JU1 A;  2XZ0 D;  2GDW A;  4BPH A;  2AVA A;  1F80 D;  2JQ4 A;  2KW2 A;  5KP6 B;  5EJD A; 
#chains in the Genus database with same CATH topology
 1K9M Q;  2FVF A;  1VQ4 P;  2MR8 A;  1GXH A;  2MF4 A;  3EJE A;  1MZ8 A;  4XFX A;  3EJD A;  3CCJ P;  2CGQ A;  2ERH A;  2N6Z A;  3GZL A;  1QVG O;  2XT1 A;  2N50 A;  2WPT A;  2L6E A;  4XFZ A;  2QA4 P;  2KOD A;  2CWO A;  2N5H A;  3DPH A;  3CMA P;  2MY5 A;  2LL8 A;  1AUM A;  2KGE A;  2L0Q A;  1Q86 Q;  2EG5 A;  2FVA A;  4CA3 A;  5KP7 B;  2VLN A;  3G28 A;  1IMP A;  2OTL P;  4COP A;  3VRL C;  3CCS P;  2PEM A;  2PEI A;  2Z45 A;  4GR2 A;  2QNW A;  1A8O A;  2GZF A;  2K92 A;  1VQN P;  1ZNV A;  2K5X A;  2XZ1 C;  3B5I A;  3GKL C;  1VQ8 P;  2P9X A;  4GR6 A;  1OR5 A;  5HV8 A;  3G71 P;  1VQ5 P;  2KOQ A;  2BUO A;  3CE7 A;  1UJZ A;  5KP8 B;  1M90 Q;  1ACP A;  1VQP P;  2JYL A;  2FQ2 A;  7CEI A;  1NQ4 A;  2DGY A;  2MR7 A;  2FHS C;  2FQ1 A;  1IUQ A;  2ONT A;  1EIA A;  4U0E A;  3HYB A;  3CCU P;  1IMQ A;  3NTE A;  2KW2 A;  1F80 D;  5EJD A;  1AYI A;  3G26 A;  2K93 A;  2X2B A;  2VLP A;  3MGE A;  1GXG A;  2ROQ A;  2OAR A;  1E0H A;  1Q82 Q;  3B4Q A;  3G21 A;  4IZ6 A;  2EFJ A;  3LRY A;  3RG2 A;  1RO2 A;  1BXI A;  3H47 A;  1M6N A;  1K73 Q;  2JU2 A;  2KGC A;  4MRT C;  2NO8 A;  4PWV B;  2KG9 A;  2L9F A;  1YJ9 P;  2KWL A;  2VLQ A;  1HY8 A;  2PEO A;  5HGL A;  4XRO A;  4BPG A;  5JPA A;  1X3O A;  3DS4 A;  1VKU A;  1YJN P;  2M8L A;  3CCM P;  1CEI A;  1DV5 A;  1BAJ A;  2LF4 A;  2JYG A;  3I56 P;  2JB0 A;  2MVU A;  2FAE A;  3G1G A;  2KGD A;  3CCL P;  2PEK A;  1JJ2 O;  2EHS A;  2M8P A;  2L22 A;  1T8K A;  5I4T G;  2LIU A;  1Q81 Q;  1UNK A;  3GZM A;  3CXC O;  2K0Y A;  2M8N A;  5HGM A;  2MVV A;  1S72 P;  1K8A Q;  2KOR A;  4U0C A;  3DS2 A;  1VQM P;  2JU1 A;  2XZ0 D;  2GZG A;  3G29 A;  3DS0 A;  5F2N A;  2Z46 A;  2CNR A;  4IPY A;  3H4E A;  5BS1 A;  2LKI A;  2JO0 A;  1KC8 Q;  4U0B A;  1VQO P;  4F37 A;  1YJW P;  2N6Y A;  4WYM A;  1KLP A;  1M6E X;  3P05 A;  4PH1 A;  2GDX A;  4DG9 A;  3H0D A;  3DS1 A;  2GZJ A;  1KD1 Q;  2LPK A;  4U0A A;  4PH0 A;  2DNW A;  1VHN A;  3CC2 P;  2VSQ A;  1VQ6 P;  4R0M A;  4HKG A;  1Z6M A;  2E1M A;  1RNI A;  3G1I A;  2JAZ A;  3CCE P;  2FQ0 A;  5DCK A;  2LOL A;  2FAC A;  3DS5 A;  4NEO A;  2GZE A;  2JGP A;  4XFY A;  2PEQ A;  4XRQ A;  1NJI Q;  2QEX P;  2PY8 A;  1YI2 P;  2EIA A;  2AFD A;  3G6E P;  2KOP A;  2L4B A;  2KOO A;  2EHT A;  2PNG A;  2M5R A;  4U0D A;  3U43 A;  1L0I A;  5HGO A;  2FVE A;  3CCR P;  1Q7Y Q;  4UHP B;  2GDW A;  3Q20 A;  4BPH A;  2AVA A;  1M74 A;  5KP6 B;  5EW5 E;  4QKO A;  5F2O A;  5BS2 A;  4H2Y C;  3CCQ P;  1W2B O;  2XXM A;  2FAD A;  4COC A;  2JBG A;  1QVF O;  4M0I A;  2LTE A;  1EOQ A;  2GYK A;  3EJB A;  2BHV A;  3CC7 P;  2N98 A;  2N5I A;  2LIW A;  2XV6 A;  2KGA A;  2KOS A;  3LMO A;  3I55 P;  1KQS O;  1VQ9 P;  5F2K A;  2GDY A;  2CQ8 A;  2AF8 A;  5CZD B;  3OW2 O;  4H2X C;  3CPW O;  3HZQ A;  4H2W C;  1L0H A;  3CD6 P;  2K0X A;  2Z44 A;  3NY7 B;  2GZI A;  2CG5 B;  1A43 A;  1DNY A;  2AFE A;  3DTJ A;  1VQ7 P;  2K2Q A;  4BPF A;  2VLO A;  3RG6 C;  2MD9 A;  2OTJ P;  1QRJ A;  3E2D A;  1RO0 A;  3G0V A;  1YHQ P;  1YIT P;  1ZMB A;  2LML A;  5HVC A;  1E6J P;  3DS3 A;  1M1K Q;  3GJN A;  1K30 A;  1VQL P;  2KR5 A;  1GPJ A;  2PEJ A;  3CME P;  4QNB A;  3G4S P;  1D1D A;  2K94 A;  3M1M A;  1HQB A;  2KG6 A;  3CCV P;  1AF8 A;  2KG8 A;  5HGN A;  3CC4 P;  1N8R Q;  4PXH B;  3WBH A;  1FR2 A;  4U0F A;  2PEN A;  1YIJ P;  2K0D X;  1VQK P;  1EMV A;  2JQ4 A; 
#chains in the Genus database with same CATH homology
 2FVF A;  2K93 A;  2X2B A;  4H2Y C;  2CNR A;  2MR8 A;  2FAD A;  2MF4 A;  2LKI A;  2ROQ A;  3EJE A;  2LTE A;  3EJD A;  4IZ6 A;  2CGQ A;  2N6Y A;  3RG2 A;  3EJB A;  2N6Z A;  2N98 A;  2N5I A;  2LIW A;  3GZL A;  2KOS A;  2KGA A;  3LMO A;  1KLP A;  2JU2 A;  2KGC A;  4MRT C;  2N50 A;  2GDX A;  4DG9 A;  4PWV B;  2KG9 A;  2N5H A;  2L9F A;  2LPK A;  2GDY A;  2KWL A;  1HY8 A;  2CQ8 A;  2DNW A;  2AF8 A;  5CZD B;  2MY5 A;  4H2X C;  2LL8 A;  4BPG A;  2KGE A;  1X3O A;  4H2W C;  1L0H A;  2L0Q A;  1VKU A;  2VSQ A;  2FVA A;  2K0X A;  4CA3 A;  5KP7 B;  3NY7 B;  2CG5 B;  4R0M A;  1DNY A;  2AFE A;  4HKG A;  1DV5 A;  2K2Q A;  4BPF A;  2FQ0 A;  2LOL A;  2FAC A;  2QNW A;  2MVU A;  2MD9 A;  2FAE A;  2K92 A;  2KGD A;  4NEO A;  2XZ1 C;  2JGP A;  2LML A;  1OR5 A;  5HV8 A;  2EHS A;  5HVC A;  2L22 A;  2KR5 A;  1T8K A;  2KOQ A;  2AFD A;  3CE7 A;  2LIU A;  5KP8 B;  2KOP A;  2K94 A;  3GZM A;  1ACP A;  1HQB A;  2FQ2 A;  2K0Y A;  2KG6 A;  2MVV A;  1NQ4 A;  2L4B A;  2KOO A;  1AF8 A;  2KG8 A;  2EHT A;  2PNG A;  2MR7 A;  2M5R A;  4PXH B;  2FHS C;  1L0I A;  2FQ1 A;  2KOR A;  2FVE A;  2JU1 A;  2XZ0 D;  2GDW A;  4BPH A;  2AVA A;  1F80 D;  2JQ4 A;  2KW2 A;  5KP6 B;  5EJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...