2KOOA

Nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 27
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kooA00
2KG8A 2AFEA 2MVUA 1AF8A 2L22A 2K94A 2N50A 2EHTA 3GZMA 2GDXA 2KGEA 2FVAA 2FVEA 3RG2A 4DG9A 2KG9A 2FHSC 2FADA 2K2QA 4NEOA 2KG6A 4BPHA 2CGQA 2K0XA 5KP7B 2KGCA 4BPGA 2AFDA 4PWVB 2KW2A 2LTEA 1KLPA 2LMLA 3GZLA 2KR5A 4MRTC 2FAEA 2L4BA 1HQBA 2MR7A 2KWLA 4R0MA 2QNWA 1L0HA 5EJDA 4CA3A 2KOOA 1L0IA 2MVVA 2AF8A 2JGPA 1ACPA 3EJBA 1F80D 2VSQA 2GDYA 2LPKA 3NY7B 2LIWA 2KGDA 3EJDA 2FACA 1HY8A 2FQ1A 2M5RA 1DNYA 2K0YA 2MD9A 2N5IA 2CQ8A 3EJEA 2LL8A 4H2WC 2FVFA 3CE7A 2KOPA 5KP8B 1X3OA 2FQ0A 2PNGA 4H2YC 2N98A 2LOLA 3LMOA 5CZDB 5HVCA 2KORA 2L9FA 2AVAA 1T8KA 2CNRA 5HV8A 1OR5A 1NQ4A 4BPFA 2N5HA 4HKGA 2N6YA 2N6ZA 2KGAA 2L0QA 2FQ2A 2CG5B 1VKUA 2KOQA 5KP6B 4IZ6A 2EHSA 2JU2A 2LIUA 2DNWA 2JU1A 1DV5A 4PXHB 2JQ4A 2MR8A 2MF4A 2LKIA 4H2XC 2K92A 2ROQA 2GDWA 2MY5A 2XZ1C 2X2BA 2XZ0D 2K93A 2KOSA
chains in the Genus database with same CATH superfamily
1AYIA 2KG8A 2LF4A 3G28A 2VLOA 1K8AQ 3CCMP 1VQKP 5F2OA 2FADA 2CGQA 2K0XA 1K30A 2GZFA 5KP7B 2BHVA 2PEKA 2AFDA 1YHQP 2PEOA 1BAJA 3CCSP 3U43A 4MRTC 4PH0A 2MR7A 1M6NA 2L6EA 1JJ2O 1IMQA 3CC7P 1KC8Q 2AF8A 2JGPA 4QNBA 1M6EX 1K9MQ 2LIWA 1VQPP 1Q81Q 2KGDA 1YJWP 2DGYA 2FQ1A 1EIAA 5JPAA 2K0YA 2N5IA 4U0BA 2Z45A 2KOPA 2ONTA 2FQ0A 3CXCO 2LOLA 3H4EA 5HGNA 2KORA 2L9FA 5HV8A 1T8KA 3G6EP 2K5XA 3DPHA 1VQOP 3NTEA 2CG5B 2JBGA 4U0AA 3G4SP 1VKUA 3DTJA 3DS0A 2Z44A 2NO8A 2VLPA 4XROA 4WYMA 2LIUA 2PEMA 2DNWA 4GR6A 2Z46A 2JU1A 2M8NA 4PXHB 2JQ4A 5HGOA 2MF4A 2GDWA 3G0VA 3CC4P 1AF8A 2L22A 2QA4P 2EHTA 1A43A 3GZMA 2KGEA 1VQ4P 3RG2A 5DCKA 2FHSC 2M8LA 4U0FA 4NEOA 2KG6A 4BPHA 1N8RQ 3CMEP 1W2BO 2VLNA 3E2DA 4PWVB 3CD6P 3G1GA 3GZLA 2KR5A 2L4BA 5BS1A 1L0HA 2BUOA 1ZNVA 4CA3A 1FR2A 2KOOA 1Q86Q 1L0IA 1VQLP 1K73Q 3LRYA 2GDYA 2LPKA 3H47A 5BS2A 4M0IA 3EJDA 1Z6MA 2PEJA 3I55P 1UJZA 2QEXP 3CCUP 2CQ8A 1KD1Q 2FVFA 3G71P 2PNGA 2ERHA 2GZEA 3HZQA 2AVAA 1OR5A 1NQ4A 1IUQA 1GPJA 2JAZA 2GZGA 4HKGA 2M8PA 2N6YA 3CCEP 1VQMP 1VQNP 3HYBA 2GZJA 1VQ8P 1YITP 3G26A 3DS4A 4COCA 2K93A 2FQ2A 2K94A 1E0HA 2GDXA 2FVAA 2GZIA 2FVEA 4IPYA 4DG9A 2KG9A 3H0DA 2K2QA 1VQ7P 2KODA 1M1KQ 2KGCA 2WPTA 1AUMA 1VHNA 2JO0A 3B4QA 2KW2A 2LTEA 4XRQA 3DS2A 2PEQA 2FAEA 1HQBA 3DS1A 2KWLA 4XFZA 4R0MA 1CEIA 2QNWA 1Q7YQ 5EJDA 3VRLC 2PY8A 2JYLA 2MVVA 3GKLC 1ACPA 5HGMA 3EJBA 1EOQA 2VSQA 3M1MA 2JB0A 3CCRP 2FACA 2M5RA 3MGEA 4QKOA 3CCVP 2OARA 2MD9A 3CCJP 2LL8A 3CE7A 1ZMBA 5KP8B 2EG5A 2PEIA 4XFXA 1A8OA 4U0DA 1RNIA 3CMAP 5F2NA 1VQ6P 3RG6C 1NJIQ 2N5HA 3WBHA 3G1IA 2KGAA 2L0QA 3CC2P 5KP6B 4IZ6A 2XT1A 2EHSA 2EIAA 2OTJP 1GXGA 3DS5A 4UHPB 3I56P 1M74A 2ROQA 2XZ1C 2X2BA 1RO0A 2KOSA 1YIJP 1EMVA 1M90Q 4U0CA 1BXIA 2AFEA 2MVUA 2E1MA 2N50A 4U0EA 1QVGO 3B5IA 2PENA 2GYKA 4PH1A 1RO2A 1QRJA 4BPGA 1KLPA 1QVFO 2LMLA 5HGLA 1KQSO 2P9XA 4XFYA 2K0DX 1E6JP 3OW2O 1F80D 3NY7B 1YJNP 1HY8A 3CPWO 1VQ5P 1DNYA 3DS3A 3EJEA 3G29A 4H2WC 5I4TG 2EFJA 1X3OA 3CCLP 2CWOA 4COPA 4H2YC 2N98A 1GXHA 7CEIA 3LMOA 5CZDB 4F37A 5HVCA 2CNRA 1VQ9P 1IMPA 2VLQA 4GR2A 1MZ8A 1UNKA 4BPFA 1YJ9P 1S72P 2N6ZA 3GJNA 2KOQA 2JYGA 2JU2A 2XV6A 5EW5E 1YI2P 1Q82Q 1D1DA 3Q20A 1DV5A 2OTLP 3P05A 2XXMA 3G21A 2MR8A 2LKIA 4H2XC 2K92A 5F2KA 2MY5A 2XZ0D 3CCQP
chains in the Genus database with same CATH topology
2KG8A 2AFEA 2MVUA 1AF8A 2L22A 2K94A 2N50A 2EHTA 3GZMA 2GDXA 2KGEA 2FVAA 2FVEA 3RG2A 4DG9A 2KG9A 2FHSC 2FADA 2K2QA 4NEOA 2KG6A 4BPHA 2CGQA 2K0XA 5KP7B 2KGCA 4BPGA 2AFDA 4PWVB 2KW2A 2LTEA 1KLPA 2LMLA 3GZLA 2KR5A 4MRTC 2FAEA 2L4BA 1HQBA 2MR7A 2KWLA 4R0MA 2QNWA 1L0HA 5EJDA 4CA3A 2KOOA 1L0IA 2MVVA 2AF8A 2JGPA 1ACPA 3EJBA 1F80D 2VSQA 2GDYA 2LPKA 3NY7B 2LIWA 2KGDA 3EJDA 2FACA 1HY8A 2FQ1A 2M5RA 1DNYA 2K0YA 2MD9A 2N5IA 2CQ8A 3EJEA 2LL8A 4H2WC 2FVFA 3CE7A 2KOPA 5KP8B 1X3OA 2FQ0A 2PNGA 4H2YC 2N98A 2LOLA 3LMOA 5CZDB 5HVCA 2KORA 2L9FA 2AVAA 1T8KA 2CNRA 5HV8A 1OR5A 1NQ4A 4BPFA 2N5HA 4HKGA 2N6YA 2N6ZA 2KGAA 2L0QA 2FQ2A 2CG5B 1VKUA 2KOQA 5KP6B 4IZ6A 2EHSA 2JU2A 2LIUA 2DNWA 2JU1A 1DV5A 4PXHB 2JQ4A 2MR8A 2MF4A 2LKIA 4H2XC 2K92A 2ROQA 2GDWA 2MY5A 2XZ1C 2X2BA 2XZ0D 2K93A 2KOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG8 A;  2AFE A;  2MVU A;  1AF8 A;  2L22 A;  2K94 A;  2N50 A;  2EHT A;  3GZM A;  2GDX A;  2KGE A;  2FVA A;  2FVE A;  3RG2 A;  4DG9 A;  2KG9 A;  2FHS C;  2FAD A;  2K2Q A;  4NEO A;  2KG6 A;  4BPH A;  2CGQ A;  2K0X A;  5KP7 B;  2KGC A;  4BPG A;  2AFD A;  4PWV B;  2KW2 A;  2LTE A;  1KLP A;  2LML A;  3GZL A;  2KR5 A;  4MRT C;  2FAE A;  2L4B A;  1HQB A;  2MR7 A;  2KWL A;  4R0M A;  2QNW A;  1L0H A;  5EJD A;  4CA3 A;  2KOO A;  1L0I A;  2MVV A;  2AF8 A;  2JGP A;  1ACP A;  3EJB A;  1F80 D;  2VSQ A;  2GDY A;  2LPK A;  3NY7 B;  2LIW A;  2KGD A;  3EJD A;  2FAC A;  1HY8 A;  2FQ1 A;  2M5R A;  1DNY A;  2K0Y A;  2MD9 A;  2N5I A;  2CQ8 A;  3EJE A;  2LL8 A;  4H2W C;  2FVF A;  3CE7 A;  2KOP A;  5KP8 B;  1X3O A;  2FQ0 A;  2PNG A;  4H2Y C;  2N98 A;  2LOL A;  3LMO A;  5CZD B;  5HVC A;  2KOR A;  2L9F A;  2AVA A;  1T8K A;  2CNR A;  5HV8 A;  1OR5 A;  1NQ4 A;  4BPF A;  2N5H A;  4HKG A;  2N6Y A;  2N6Z A;  2KGA A;  2L0Q A;  2FQ2 A;  2CG5 B;  1VKU A;  2KOQ A;  5KP6 B;  4IZ6 A;  2EHS A;  2JU2 A;  2LIU A;  2DNW A;  2JU1 A;  1DV5 A;  4PXH B;  2JQ4 A;  2MR8 A;  2MF4 A;  2LKI A;  4H2X C;  2K92 A;  2ROQ A;  2GDW A;  2MY5 A;  2XZ1 C;  2X2B A;  2XZ0 D;  2K93 A;  2KOS A; 
#chains in the Genus database with same CATH topology
 1AYI A;  2KG8 A;  2LF4 A;  3G28 A;  2VLO A;  1K8A Q;  3CCM P;  1VQK P;  5F2O A;  2FAD A;  2CGQ A;  2K0X A;  1K30 A;  2GZF A;  5KP7 B;  2BHV A;  2PEK A;  2AFD A;  1YHQ P;  2PEO A;  1BAJ A;  3CCS P;  3U43 A;  4MRT C;  4PH0 A;  2MR7 A;  1M6N A;  2L6E A;  1JJ2 O;  1IMQ A;  3CC7 P;  1KC8 Q;  2AF8 A;  2JGP A;  4QNB A;  1M6E X;  1K9M Q;  2LIW A;  1VQP P;  1Q81 Q;  2KGD A;  1YJW P;  2DGY A;  2FQ1 A;  1EIA A;  5JPA A;  2K0Y A;  2N5I A;  4U0B A;  2Z45 A;  2KOP A;  2ONT A;  2FQ0 A;  3CXC O;  2LOL A;  3H4E A;  5HGN A;  2KOR A;  2L9F A;  5HV8 A;  1T8K A;  3G6E P;  2K5X A;  3DPH A;  1VQO P;  3NTE A;  2CG5 B;  2JBG A;  4U0A A;  3G4S P;  1VKU A;  3DTJ A;  3DS0 A;  2Z44 A;  2NO8 A;  2VLP A;  4XRO A;  4WYM A;  2LIU A;  2PEM A;  2DNW A;  4GR6 A;  2Z46 A;  2JU1 A;  2M8N A;  4PXH B;  2JQ4 A;  5HGO A;  2MF4 A;  2GDW A;  3G0V A;  3CC4 P;  1AF8 A;  2L22 A;  2QA4 P;  2EHT A;  1A43 A;  3GZM A;  2KGE A;  1VQ4 P;  3RG2 A;  5DCK A;  2FHS C;  2M8L A;  4U0F A;  4NEO A;  2KG6 A;  4BPH A;  1N8R Q;  3CME P;  1W2B O;  2VLN A;  3E2D A;  4PWV B;  3CD6 P;  3G1G A;  3GZL A;  2KR5 A;  2L4B A;  5BS1 A;  1L0H A;  2BUO A;  1ZNV A;  4CA3 A;  1FR2 A;  2KOO A;  1Q86 Q;  1L0I A;  1VQL P;  1K73 Q;  3LRY A;  2GDY A;  2LPK A;  3H47 A;  5BS2 A;  4M0I A;  3EJD A;  1Z6M A;  2PEJ A;  3I55 P;  1UJZ A;  2QEX P;  3CCU P;  2CQ8 A;  1KD1 Q;  2FVF A;  3G71 P;  2PNG A;  2ERH A;  2GZE A;  3HZQ A;  2AVA A;  1OR5 A;  1NQ4 A;  1IUQ A;  1GPJ A;  2JAZ A;  2GZG A;  4HKG A;  2M8P A;  2N6Y A;  3CCE P;  1VQM P;  1VQN P;  3HYB A;  2GZJ A;  1VQ8 P;  1YIT P;  3G26 A;  3DS4 A;  4COC A;  2K93 A;  2FQ2 A;  2K94 A;  1E0H A;  2GDX A;  2FVA A;  2GZI A;  2FVE A;  4IPY A;  4DG9 A;  2KG9 A;  3H0D A;  2K2Q A;  1VQ7 P;  2KOD A;  1M1K Q;  2KGC A;  2WPT A;  1AUM A;  1VHN A;  2JO0 A;  3B4Q A;  2KW2 A;  2LTE A;  4XRQ A;  3DS2 A;  2PEQ A;  2FAE A;  1HQB A;  3DS1 A;  2KWL A;  4XFZ A;  4R0M A;  1CEI A;  2QNW A;  1Q7Y Q;  5EJD A;  3VRL C;  2PY8 A;  2JYL A;  2MVV A;  3GKL C;  1ACP A;  5HGM A;  3EJB A;  1EOQ A;  2VSQ A;  3M1M A;  2JB0 A;  3CCR P;  2FAC A;  2M5R A;  3MGE A;  4QKO A;  3CCV P;  2OAR A;  2MD9 A;  3CCJ P;  2LL8 A;  3CE7 A;  1ZMB A;  5KP8 B;  2EG5 A;  2PEI A;  4XFX A;  1A8O A;  4U0D A;  1RNI A;  3CMA P;  5F2N A;  1VQ6 P;  3RG6 C;  1NJI Q;  2N5H A;  3WBH A;  3G1I A;  2KGA A;  2L0Q A;  3CC2 P;  5KP6 B;  4IZ6 A;  2XT1 A;  2EHS A;  2EIA A;  2OTJ P;  1GXG A;  3DS5 A;  4UHP B;  3I56 P;  1M74 A;  2ROQ A;  2XZ1 C;  2X2B A;  1RO0 A;  2KOS A;  1YIJ P;  1EMV A;  1M90 Q;  4U0C A;  1BXI A;  2AFE A;  2MVU A;  2E1M A;  2N50 A;  4U0E A;  1QVG O;  3B5I A;  2PEN A;  2GYK A;  4PH1 A;  1RO2 A;  1QRJ A;  4BPG A;  1KLP A;  1QVF O;  2LML A;  5HGL A;  1KQS O;  2P9X A;  4XFY A;  2K0D X;  1E6J P;  3OW2 O;  1F80 D;  3NY7 B;  1YJN P;  1HY8 A;  3CPW O;  1VQ5 P;  1DNY A;  3DS3 A;  3EJE A;  3G29 A;  4H2W C;  5I4T G;  2EFJ A;  1X3O A;  3CCL P;  2CWO A;  4COP A;  4H2Y C;  2N98 A;  1GXH A;  7CEI A;  3LMO A;  5CZD B;  4F37 A;  5HVC A;  2CNR A;  1VQ9 P;  1IMP A;  2VLQ A;  4GR2 A;  1MZ8 A;  1UNK A;  4BPF A;  1YJ9 P;  1S72 P;  2N6Z A;  3GJN A;  2KOQ A;  2JYG A;  2JU2 A;  2XV6 A;  5EW5 E;  1YI2 P;  1Q82 Q;  1D1D A;  3Q20 A;  1DV5 A;  2OTL P;  3P05 A;  2XXM A;  3G21 A;  2MR8 A;  2LKI A;  4H2X C;  2K92 A;  5F2K A;  2MY5 A;  2XZ0 D;  3CCQ P; 
#chains in the Genus database with same CATH homology
 2KG8 A;  2AFE A;  2MVU A;  1AF8 A;  2L22 A;  2K94 A;  2N50 A;  2EHT A;  3GZM A;  2GDX A;  2KGE A;  2FVA A;  2FVE A;  3RG2 A;  4DG9 A;  2KG9 A;  2FHS C;  2FAD A;  2K2Q A;  4NEO A;  2KG6 A;  4BPH A;  2CGQ A;  2K0X A;  5KP7 B;  2KGC A;  4BPG A;  2AFD A;  4PWV B;  2KW2 A;  2LTE A;  1KLP A;  2LML A;  3GZL A;  2KR5 A;  4MRT C;  2FAE A;  2L4B A;  1HQB A;  2MR7 A;  2KWL A;  4R0M A;  2QNW A;  1L0H A;  5EJD A;  4CA3 A;  2KOO A;  1L0I A;  2MVV A;  2AF8 A;  2JGP A;  1ACP A;  3EJB A;  1F80 D;  2VSQ A;  2GDY A;  2LPK A;  3NY7 B;  2LIW A;  2KGD A;  3EJD A;  2FAC A;  1HY8 A;  2FQ1 A;  2M5R A;  1DNY A;  2K0Y A;  2MD9 A;  2N5I A;  2CQ8 A;  3EJE A;  2LL8 A;  4H2W C;  2FVF A;  3CE7 A;  2KOP A;  5KP8 B;  1X3O A;  2FQ0 A;  2PNG A;  4H2Y C;  2N98 A;  2LOL A;  3LMO A;  5CZD B;  5HVC A;  2KOR A;  2L9F A;  2AVA A;  1T8K A;  2CNR A;  5HV8 A;  1OR5 A;  1NQ4 A;  4BPF A;  2N5H A;  4HKG A;  2N6Y A;  2N6Z A;  2KGA A;  2L0Q A;  2FQ2 A;  2CG5 B;  1VKU A;  2KOQ A;  5KP6 B;  4IZ6 A;  2EHS A;  2JU2 A;  2LIU A;  2DNW A;  2JU1 A;  1DV5 A;  4PXH B;  2JQ4 A;  2MR8 A;  2MF4 A;  2LKI A;  4H2X C;  2K92 A;  2ROQ A;  2GDW A;  2MY5 A;  2XZ1 C;  2X2B A;  2XZ0 D;  2K93 A;  2KOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...