2JYLA

Solution structure of a double mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24 (CA)
publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 17
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jylA00
4U0FA 4QNBA 1A43A 2KODA 4M0IA 4XFXA 2LF4A 3VRLC 5DCKA 3H4EA 2M8LA 4COCA 2L6EA 3LRYA 4U0CA 5JPAA 1EIAA 4PH0A 3G26A 2JYLA 2XT1A 3G28A 2XV6A 4PH1A 3DTJA 4XFZA 3DS0A 2JYGA 4U0AA 3H47A 2XXMA 1E6JP 3MGEA 3NTEA 2M8NA 2ONTA 4XFYA 4IPYA 5HGOA 3G21A 5I4TG 4WYMA 4XROA 4U0EA 3DS1A 4XRQA 1A8OA 2BUOA 4COPA 1BAJA 3G29A 1AUMA 1EOQA 3G1IA 1D1DA 2JO0A 2EIAA 3P05A 3DS5A 5HGNA 5HGLA 5HGMA 3DPHA 3G0VA 3G1GA 3DS2A 3DS4A 1QRJA 4U0DA 4U0BA 2M8PA 3DS3A
chains in the Genus database with same CATH superfamily
2N6YA 3CCSP 2JGPA 5F2OA 4COCA 4GR6A 5I4TG 1Q81Q 2GZIA 2DGYA 1A8OA 1GXHA 1X3OA 1VQ4P 2KG9A 3CCMP 2GZGA 1VQLP 2FQ2A 4H2YC 1T8KA 4PWVB 5EJDA 1E0HA 1L0HA 5BS2A 1S72P 2N6ZA 3G28A 2EFJA 2Z46A 4BPHA 1Z6MA 2XZ0D 2AVAA 3CCQP 3E2DA 1YITP 2PEIA 2EIAA 2GZJA 1VQ6P 3DS5A 3RG6C 1M90Q 2MY5A 2LOLA 2GDWA 4MRTC 2FAEA 4PXHB 3I56P 1K30A 3CC7P 1DNYA 1YI2P 5HGOA 5KP7B 2CG5B 1UNKA 2Z44A 2M5RA 2L6EA 3HYBA 5HGMA 3G71P 1A43A 2KODA 2CWOA 1HQBA 2JQ4A 4GR2A 3U43A 1IMPA 2BHVA 3RG2A 3CCRP 1RNIA 2ONTA 1RO2A 2BUOA 4H2WC 2QEXP 1BXIA 2KORA 1OR5A 2K2QA 4F37A 1HY8A 2FVEA 5CZDB 3GZLA 2AFEA 2PEJA 3CE7A 2DNWA 2CNRA 2PENA 4NEOA 3CCEP 4HKGA 2VLQA 3CMEP 2FHSC 7CEIA 2NO8A 3DPHA 3G1GA 3DS2A 1QRJA 3DS3A 2GZFA 2KGCA 2FQ0A 3VRLC 1IMQA 5BS1A 4BPGA 2JAZA 4PH1A 2PY8A 2JU2A 2JYGA 2WPTA 2QNWA 2VLPA 2N50A 2JB0A 2OTJP 2LL8A 5HGNA 5HGLA 1RO0A 2K5XA 3OW2O 3EJEA 2L22A 1EIAA 3CMAP 2PEOA 2GDXA 3CC2P 3CC4P 3CCJP 2KWLA 3NY7B 4U0EA 4UHPB 1VQ8P 2JBGA 3GJNA 2KOOA 3G0VA 2KR5A 1Q82Q 2K94A 1L0IA 2LKIA 2LTEA 3B5IA 3I55P 1GPJA 2XT1A 1FR2A 3B4QA 4U0AA 2KGEA 2VLNA 4IZ6A 2ROQA 1AF8A 1N8RQ 4BPFA 4R0MA 3EJDA 1AYIA 2LF4A 1VQNP 3HZQA 1Q7YQ 2LMLA 2CQ8A 1JJ2O 4PH0A 1VKUA 2XV6A 2AF8A 3MGEA 2L4BA 2N5HA 3WBHA 2OTLP 1KLPA 2XZ1C 1YIJP 4U0DA 1CEIA 5KP8B 1GXGA 2PEMA 1YJ9P 1YJNP 1IUQA 1M6EX 2KG6A 5JPAA 2CGQA 2LIUA 3LRYA 1K9MQ 2PEQA 1VHNA 2ERHA 1MZ8A 2XXMA 1NQ4A 2KW2A 2VSQA 3CCLP 4IPYA 4XROA 1YJWP 5F2KA 4U0BA 4U0FA 4CA3A 1KC8Q 1YHQP 2K93A 1K73Q 2K0YA 2MD9A 4U0CA 2MVUA 3H47A 1E6JP 1K8AQ 1VQPP 3M1MA 3EJBA 2LIWA 2P9XA 4H2XC 2PEKA 3G6EP 2L0QA 1M6NA 2QA4P 3H4EA 3CD6P 1VQ5P 2GDYA 4XFYA 1ZNVA 3NTEA 1VQ9P 4WYMA 3H0DA 2EHTA 1ZMBA 2N98A 2K0XA 3Q20A 2EG5A 3P05A 2KOSA 3G21A 2FACA 4QNBA 1VQKP 4QKOA 3CCUP 3G26A 2JYLA 2AFDA 1UJZA 3DS1A 1D1DA 5HV8A 2MR8A 2Z45A 1W2BO 3DS4A 3GZMA 2KGAA 1DV5A 3CXCO 2K92A 2L9FA 4M0IA 2GYKA 5KP6B 2FVFA 2M8LA 1QVFO 2FADA 1VQMP 2KOQA 2OARA 3DS0A 2PNGA 2VLOA 4XRQA 1M1KQ 2LPKA 1M74A 2JU1A 2MR7A 2X2BA 5F2NA 2K0DX 2KGDA 3G4SP 1EMVA 2M8PA 4XFXA 5DCKA 3DTJA 4XFZA 2GZEA 1KQSO 2M8NA 2KG8A 2FVAA 2KOPA 2FQ1A 1VQ7P 3G1IA 2JO0A 1QVGO 1NJIQ 1ACPA 2MF4A 3GKLC 2EHSA 3CPWO 2N5IA 2MVVA 5HVCA 1KD1Q 1Q86Q 1F80D 4COPA 1BAJA 3G29A 2E1MA 1AUMA 1EOQA 1VQOP 3LMOA 5EW5E 4DG9A 3CCVP
chains in the Genus database with same CATH topology
4QNBA 3CCSP 1VQKP 2LF4A 1VQNP 3HZQA 1Q7YQ 5F2OA 4COCA 2PEJA 4GR6A 3CCUP 1JJ2O 4PH0A 3G26A 2JYLA 2XV6A 2PENA 3MGEA 3CCEP 5I4TG 1Q81Q 2DGYA 3DS1A 1A8OA 3WBHA 2OTLP 3CMEP 1D1DA 1VQ4P 1YIJP 3CCMP 2Z45A 3DPHA 3G1GA 4U0DA 3DS2A 3DS4A 1QRJA 1W2BO 1VQLP 3DS3A 2PEMA 3CXCO 1YJ9P 1YJNP 1IUQA 4M0IA 3VRLC 1M6EX 5BS2A 1S72P 2M8LA 5BS1A 5JPAA 3LRYA 1QVFO 1VQMP 3G28A 4PH1A 2PY8A 2PEQA 1K9MQ 2OARA 3DS0A 2EFJA 2JYGA 2Z46A 2XXMA 3CCLP 4IPYA 4XROA 4XRQA 1M1KQ 1YJWP 3CCQP 1M74A 3E2DA 1YITP 2PEIA 2EIAA 1VQ6P 2OTJP 5F2NA 3DS5A 5HGNA 3RG6C 5HGLA 1RO0A 3OW2O 3G4SP 1M90Q 5F2KA 4U0BA 2M8PA 4U0FA 1KC8Q 1YHQP 4XFXA 5DCKA 3I56P 1K73Q 1K30A 3CC7P 4U0CA 1EIAA 3CMAP 1YI2P 2PEOA 3DTJA 4XFZA 3CC2P 3H47A 1KQSO 1E6JP 3CC4P 2M8NA 3CCJP 5HGOA 1K8AQ 4U0EA 1VQPP 3M1MA 2Z44A 1VQ7P 3G1IA 2P9XA 2JO0A 1VQ8P 2PEKA 3G6EP 3G0VA 1QVGO 1NJIQ 2L6EA 3HYBA 5HGMA 1Q82Q 3G71P 1M6NA 1A43A 2KODA 2CWOA 2QA4P 3H4EA 3CPWO 3B5IA 3I55P 3CD6P 4GR2A 2XT1A 1VQ5P 2BHVA 3CCRP 1RNIA 4U0AA 4XFYA 1VQ9P 3NTEA 1KD1Q 2ONTA 1Q86Q 4WYMA 1RO2A 2BUOA 4COPA 1BAJA 3G29A 3H0DA 2E1MA 2QEXP 1AUMA 1ZMBA 1EOQA 1VQOP 3Q20A 1N8RQ 2EG5A 3P05A 3G21A 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0F A;  4QNB A;  1A43 A;  2KOD A;  4M0I A;  4XFX A;  2LF4 A;  3VRL C;  5DCK A;  3H4E A;  2M8L A;  4COC A;  2L6E A;  3LRY A;  4U0C A;  5JPA A;  1EIA A;  4PH0 A;  3G26 A;  2JYL A;  2XT1 A;  3G28 A;  2XV6 A;  4PH1 A;  3DTJ A;  4XFZ A;  3DS0 A;  2JYG A;  4U0A A;  3H47 A;  2XXM A;  1E6J P;  3MGE A;  3NTE A;  2M8N A;  2ONT A;  4XFY A;  4IPY A;  5HGO A;  3G21 A;  5I4T G;  4WYM A;  4XRO A;  4U0E A;  3DS1 A;  4XRQ A;  1A8O A;  2BUO A;  4COP A;  1BAJ A;  3G29 A;  1AUM A;  1EOQ A;  3G1I A;  1D1D A;  2JO0 A;  2EIA A;  3P05 A;  3DS5 A;  5HGN A;  5HGL A;  5HGM A;  3DPH A;  3G0V A;  3G1G A;  3DS2 A;  3DS4 A;  1QRJ A;  4U0D A;  4U0B A;  2M8P A;  3DS3 A; 
#chains in the Genus database with same CATH topology
 2N6Y A;  3CCS P;  2JGP A;  5F2O A;  4COC A;  4GR6 A;  5I4T G;  1Q81 Q;  2GZI A;  2DGY A;  1A8O A;  1GXH A;  1X3O A;  1VQ4 P;  2KG9 A;  3CCM P;  2GZG A;  1VQL P;  2FQ2 A;  4H2Y C;  1T8K A;  4PWV B;  5EJD A;  1E0H A;  1L0H A;  5BS2 A;  1S72 P;  2N6Z A;  3G28 A;  2EFJ A;  2Z46 A;  4BPH A;  1Z6M A;  2XZ0 D;  2AVA A;  3CCQ P;  3E2D A;  1YIT P;  2PEI A;  2EIA A;  2GZJ A;  1VQ6 P;  3DS5 A;  3RG6 C;  1M90 Q;  2MY5 A;  2LOL A;  2GDW A;  4MRT C;  2FAE A;  4PXH B;  3I56 P;  1K30 A;  3CC7 P;  1DNY A;  1YI2 P;  5HGO A;  5KP7 B;  2CG5 B;  1UNK A;  2Z44 A;  2M5R A;  2L6E A;  3HYB A;  5HGM A;  3G71 P;  1A43 A;  2KOD A;  2CWO A;  1HQB A;  2JQ4 A;  4GR2 A;  3U43 A;  1IMP A;  2BHV A;  3RG2 A;  3CCR P;  1RNI A;  2ONT A;  1RO2 A;  2BUO A;  4H2W C;  2QEX P;  1BXI A;  2KOR A;  1OR5 A;  2K2Q A;  4F37 A;  1HY8 A;  2FVE A;  5CZD B;  3GZL A;  2AFE A;  2PEJ A;  3CE7 A;  2DNW A;  2CNR A;  2PEN A;  4NEO A;  3CCE P;  4HKG A;  2VLQ A;  3CME P;  2FHS C;  7CEI A;  2NO8 A;  3DPH A;  3G1G A;  3DS2 A;  1QRJ A;  3DS3 A;  2GZF A;  2KGC A;  2FQ0 A;  3VRL C;  1IMQ A;  5BS1 A;  4BPG A;  2JAZ A;  4PH1 A;  2PY8 A;  2JU2 A;  2JYG A;  2WPT A;  2QNW A;  2VLP A;  2N50 A;  2JB0 A;  2OTJ P;  2LL8 A;  5HGN A;  5HGL A;  1RO0 A;  2K5X A;  3OW2 O;  3EJE A;  2L22 A;  1EIA A;  3CMA P;  2PEO A;  2GDX A;  3CC2 P;  3CC4 P;  3CCJ P;  2KWL A;  3NY7 B;  4U0E A;  4UHP B;  1VQ8 P;  2JBG A;  3GJN A;  2KOO A;  3G0V A;  2KR5 A;  1Q82 Q;  2K94 A;  1L0I A;  2LKI A;  2LTE A;  3B5I A;  3I55 P;  1GPJ A;  2XT1 A;  1FR2 A;  3B4Q A;  4U0A A;  2KGE A;  2VLN A;  4IZ6 A;  2ROQ A;  1AF8 A;  1N8R Q;  4BPF A;  4R0M A;  3EJD A;  1AYI A;  2LF4 A;  1VQN P;  3HZQ A;  1Q7Y Q;  2LML A;  2CQ8 A;  1JJ2 O;  4PH0 A;  1VKU A;  2XV6 A;  2AF8 A;  3MGE A;  2L4B A;  2N5H A;  3WBH A;  2OTL P;  1KLP A;  2XZ1 C;  1YIJ P;  4U0D A;  1CEI A;  5KP8 B;  1GXG A;  2PEM A;  1YJ9 P;  1YJN P;  1IUQ A;  1M6E X;  2KG6 A;  5JPA A;  2CGQ A;  2LIU A;  3LRY A;  1K9M Q;  2PEQ A;  1VHN A;  2ERH A;  1MZ8 A;  2XXM A;  1NQ4 A;  2KW2 A;  2VSQ A;  3CCL P;  4IPY A;  4XRO A;  1YJW P;  5F2K A;  4U0B A;  4U0F A;  4CA3 A;  1KC8 Q;  1YHQ P;  2K93 A;  1K73 Q;  2K0Y A;  2MD9 A;  4U0C A;  2MVU A;  3H47 A;  1E6J P;  1K8A Q;  1VQP P;  3M1M A;  3EJB A;  2LIW A;  2P9X A;  4H2X C;  2PEK A;  3G6E P;  2L0Q A;  1M6N A;  2QA4 P;  3H4E A;  3CD6 P;  1VQ5 P;  2GDY A;  4XFY A;  1ZNV A;  3NTE A;  1VQ9 P;  4WYM A;  3H0D A;  2EHT A;  1ZMB A;  2N98 A;  2K0X A;  3Q20 A;  2EG5 A;  3P05 A;  2KOS A;  3G21 A;  2FAC A;  4QNB A;  1VQK P;  4QKO A;  3CCU P;  3G26 A;  2JYL A;  2AFD A;  1UJZ A;  3DS1 A;  1D1D A;  5HV8 A;  2MR8 A;  2Z45 A;  1W2B O;  3DS4 A;  3GZM A;  2KGA A;  1DV5 A;  3CXC O;  2K92 A;  2L9F A;  4M0I A;  2GYK A;  5KP6 B;  2FVF A;  2M8L A;  1QVF O;  2FAD A;  1VQM P;  2KOQ A;  2OAR A;  3DS0 A;  2PNG A;  2VLO A;  4XRQ A;  1M1K Q;  2LPK A;  1M74 A;  2JU1 A;  2MR7 A;  2X2B A;  5F2N A;  2K0D X;  2KGD A;  3G4S P;  1EMV A;  2M8P A;  4XFX A;  5DCK A;  3DTJ A;  4XFZ A;  2GZE A;  1KQS O;  2M8N A;  2KG8 A;  2FVA A;  2KOP A;  2FQ1 A;  1VQ7 P;  3G1I A;  2JO0 A;  1QVG O;  1NJI Q;  1ACP A;  2MF4 A;  3GKL C;  2EHS A;  3CPW O;  2N5I A;  2MVV A;  5HVC A;  1KD1 Q;  1Q86 Q;  1F80 D;  4COP A;  1BAJ A;  3G29 A;  2E1M A;  1AUM A;  1EOQ A;  1VQO P;  3LMO A;  5EW5 E;  4DG9 A;  3CCV P; 
#chains in the Genus database with same CATH homology
 4QNB A;  3CCS P;  1VQK P;  2LF4 A;  1VQN P;  3HZQ A;  1Q7Y Q;  5F2O A;  4COC A;  2PEJ A;  4GR6 A;  3CCU P;  1JJ2 O;  4PH0 A;  3G26 A;  2JYL A;  2XV6 A;  2PEN A;  3MGE A;  3CCE P;  5I4T G;  1Q81 Q;  2DGY A;  3DS1 A;  1A8O A;  3WBH A;  2OTL P;  3CME P;  1D1D A;  1VQ4 P;  1YIJ P;  3CCM P;  2Z45 A;  3DPH A;  3G1G A;  4U0D A;  3DS2 A;  3DS4 A;  1QRJ A;  1W2B O;  1VQL P;  3DS3 A;  2PEM A;  3CXC O;  1YJ9 P;  1YJN P;  1IUQ A;  4M0I A;  3VRL C;  1M6E X;  5BS2 A;  1S72 P;  2M8L A;  5BS1 A;  5JPA A;  3LRY A;  1QVF O;  1VQM P;  3G28 A;  4PH1 A;  2PY8 A;  2PEQ A;  1K9M Q;  2OAR A;  3DS0 A;  2EFJ A;  2JYG A;  2Z46 A;  2XXM A;  3CCL P;  4IPY A;  4XRO A;  4XRQ A;  1M1K Q;  1YJW P;  3CCQ P;  1M74 A;  3E2D A;  1YIT P;  2PEI A;  2EIA A;  1VQ6 P;  2OTJ P;  5F2N A;  3DS5 A;  5HGN A;  3RG6 C;  5HGL A;  1RO0 A;  3OW2 O;  3G4S P;  1M90 Q;  5F2K A;  4U0B A;  2M8P A;  4U0F A;  1KC8 Q;  1YHQ P;  4XFX A;  5DCK A;  3I56 P;  1K73 Q;  1K30 A;  3CC7 P;  4U0C A;  1EIA A;  3CMA P;  1YI2 P;  2PEO A;  3DTJ A;  4XFZ A;  3CC2 P;  3H47 A;  1KQS O;  1E6J P;  3CC4 P;  2M8N A;  3CCJ P;  5HGO A;  1K8A Q;  4U0E A;  1VQP P;  3M1M A;  2Z44 A;  1VQ7 P;  3G1I A;  2P9X A;  2JO0 A;  1VQ8 P;  2PEK A;  3G6E P;  3G0V A;  1QVG O;  1NJI Q;  2L6E A;  3HYB A;  5HGM A;  1Q82 Q;  3G71 P;  1M6N A;  1A43 A;  2KOD A;  2CWO A;  2QA4 P;  3H4E A;  3CPW O;  3B5I A;  3I55 P;  3CD6 P;  4GR2 A;  2XT1 A;  1VQ5 P;  2BHV A;  3CCR P;  1RNI A;  4U0A A;  4XFY A;  1VQ9 P;  3NTE A;  1KD1 Q;  2ONT A;  1Q86 Q;  4WYM A;  1RO2 A;  2BUO A;  4COP A;  1BAJ A;  3G29 A;  3H0D A;  2E1M A;  2QEX P;  1AUM A;  1ZMB A;  1EOQ A;  1VQO P;  3Q20 A;  1N8R Q;  2EG5 A;  3P05 A;  3G21 A;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...