2JYLA

Solution structure of a double mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
total genus 17
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jylA00
1A43A 2JYLA 2LF4A 1A8OA 2M8NA 4U0EA 4U0BA 4XFZA 1AUMA 3NTEA 4XROA 3DS3A 4M0IA 4U0CA 5HGOA 2XV6A 1EOQA 1EIAA 3MGEA 2JO0A 4U0AA 4COCA 2XXMA 2M8PA 2KODA 2JYGA 3H4EA 4IPYA 3P05A 5DCKA 5HGMA 3DS1A 5I4TG 3G0VA 4PH1A 4XFXA 1BAJA 2XT1A 3DS5A 1D1DA 3VRLC 1QRJA 4QNBA 2M8LA 4COPA 4XFYA 4PH0A 3LRYA 4WYMA 3G26A 3H47A 3G1GA 3DS2A 3G21A 2L6EA 4U0DA 3G1IA 3DPHA 5JPAA 1E6JP 2BUOA 3DS4A 3DTJA 3DS0A 3G28A 4U0FA 2EIAA 4XRQA 5HGNA 5HGLA 2ONTA 3G29A
chains in the Genus database with same CATH superfamily
1T8KA 3CCSP 2XV6A 2VLPA 4XFXA 3G26A 3CCQP 1HY8A 3GKLC 2FVAA 3DS0A 2AVAA 5HGLA 2GDYA 3H0DA 2KG6A 1L0IA 1OR5A 4U0AA 2PEKA 1HQBA 3CCRP 4HKGA 1X3OA 2JU1A 2WPTA 2FQ2A 4BPFA 1VQ6P 1F80D 1ZMBA 2FAEA 5F2KA 4XFYA 2LTEA 1L0HA 2KW2A 5KP8B 4MRTC 3G1GA 5CZDB 1VQMP 1YI2P 2OARA 2K93A 4UHPB 4NEOA 2MVUA 3G28A 5F2OA 2KWLA 2JAZA 1Z6MA 2QEXP 2GDXA 3MGEA 4COCA 2FADA 3RG6C 3RG2A 2AFDA 4PH1A 4GR6A 5BS1A 3G6EP 2AF8A 1VQPP 2KGCA 3H47A 2GYKA 3DPHA 3G71P 1Q86Q 3CCMP 2K2QA 1QVFO 2ERHA 1QVGO 2N6ZA 3CD6P 3VRLC 1VQLP 1YITP 4PXHB 3CC7P 2DGYA 1GPJA 2FHSC 2K92A 2VLOA 5F2NA 3EJDA 3EJEA 2LOLA 1A8OA 3DS3A 2JO0A 2EFJA 2PNGA 2PEIA 3CC2P 2N5IA 1KD1Q 7CEIA 1YJNP 2KGAA 3CMEP 1W2BO 2L6EA 1IUQA 2K0DX 3OW2O 5HGNA 2KOOA 2NO8A 2KORA 3GJNA 3I55P 4U0CA 1EOQA 2XXMA 2XZ0D 3CCJP 5I4TG 2GZJA 2K0XA 2FQ1A 2L4BA 1DNYA 2XT1A 2PEOA 2L22A 2JQ4A 1VQOP 2GZGA 4BPHA 1Q82Q 4XRQA 1K9MQ 2XZ1C 4U0BA 1VQ5P 4F37A 4IPYA 3U43A 1RNIA 1K8AQ 1VKUA 2AFEA 2OTJP 1CEIA 1GXGA 1YJ9P 3CCEP 4H2XC 1S72P 2JB0A 2BHVA 3DS4A 1DV5A 4U0FA 2FACA 4XFZA 1Q7YQ 2FVEA 1KC8Q 2PEQA 4M0IA 1KLPA 2KG8A 2KGDA 3H4EA 2VLQA 2GZIA 1M6EX 1D1DA 3B5IA 2MVVA 4PH0A 1UNKA 1N8RQ 2KR5A 2CQ8A 3G1IA 4H2YC 1AF8A 2GZEA 2Z45A 2OTLP 3I56P 1VQ8P 5DCKA 2EHTA 2DNWA 2PY8A 4COPA 2Z46A 1BXIA 4WYMA 1Q81Q 3DS2A 2L9FA 2GDWA 3CC4P 2N6YA 3G29A 2CNRA 2QNWA 2M8PA 3CMAP 4R0MA 2JBGA 4DG9A 4CA3A 1M6NA 3CPWO 2ROQA 2LL8A 1VQ7P 5HVCA 3EJBA 4BPGA 2KGEA 5HGMA 2JYGA 3P05A 1YIJP 3G0VA 3DS5A 2M8LA 2P9XA 3LRYA 3CXCO 2JU2A 5KP7B 1M90Q 1M74A 2LIUA 3NY7B 1UJZA 1NQ4A 1K30A 5EJDA 2MY5A 3NTEA 2FQ0A 2LMLA 1YJWP 1NJIQ 1YHQP 2N98A 1RO0A 2BUOA 2QA4P 2MF4A 1VHNA 1A43A 5KP6B 2PEJA 4H2WC 4U0EA 3CCVP 4XROA 1AUMA 1EIAA 1VQ4P 3DS1A 2JGPA 1E0HA 2Z44A 4PWVB 2PEMA 2MR8A 2N5HA 2KOPA 1GXHA 4U0DA 2X2BA 2LPKA 5JPAA 2MR7A 1VQ9P 2GZFA 2EG5A 5EW5E 2L0QA 2N50A 1EMVA 2M5RA 2KODA 2K0YA 1IMQA 1BAJA 3B4QA 4QNBA 1VQNP 1ACPA 2K5XA 3G21A 2K94A 1ZNVA 3HYBA 3HZQA 2EIAA 2ONTA 2M8NA 3E2DA 3M1MA 2VLNA 1AYIA 3G4SP 1JJ2O 5HV8A 4QKOA 1M1KQ 2CWOA 4GR2A 2FVFA 1IMPA 3DTJA 2E1MA 1KQSO 2MD9A 2JYLA 2LF4A 1MZ8A 1K73Q 3CE7A 5HGOA 3WBHA 2KOQA 2LKIA 2CGQA 4IZ6A 3CCUP 1QRJA 3CCLP 2KOSA 3GZMA 2KG9A 3Q20A 5BS2A 2CG5B 1FR2A 2PENA 3GZLA 2EHSA 1VQKP 1E6JP 3LMOA 2VSQA 1RO2A 2LIWA
chains in the Genus database with same CATH topology
1A43A 1A8OA 2PEJA 4U0EA 3CCVP 4XROA 1AUMA 3DS3A 3CCSP 1VQ8P 2XV6A 1EIAA 2JO0A 1VQ4P 5DCKA 2EFJA 3DS1A 4XFXA 2Z44A 2PEIA 2PEMA 3CC2P 1KD1Q 2PY8A 4COPA 2Z46A 4WYMA 1YJNP 1Q81Q 3G26A 3CCQP 3CMEP 3DS2A 1W2BO 2L6EA 4U0DA 5JPAA 3CC4P 1IUQA 3DS0A 3OW2O 1VQ9P 5HGNA 5HGLA 3G29A 2EG5A 3H0DA 3I55P 4U0CA 1EOQA 4U0AA 2PEKA 2XXMA 2M8PA 3CCRP 2KODA 3CMAP 3CCJP 5I4TG 1BAJA 2XT1A 2PEOA 1VQ6P 4QNBA 1ZMBA 1VQNP 5F2KA 4XFYA 1M6NA 3G1GA 3G21A 1VQMP 1VQOP 3CPWO 1YI2P 2OARA 3HYBA 1Q82Q 3G28A 3HZQA 4XRQA 2EIAA 5F2OA 1K9MQ 2ONTA 1VQ7P 2M8NA 3E2DA 4U0BA 2QEXP 3M1MA 1VQ5P 3MGEA 4COCA 3RG6C 4IPYA 2JYGA 5HGMA 3P05A 1RNIA 3G4SP 1JJ2O 1YIJP 3G0VA 4PH1A 4GR6A 5BS1A 3DS5A 1K8AQ 2OTJP 3G6EP 1M1KQ 1VQPP 2CWOA 2M8LA 2P9XA 3LRYA 3CXCO 3H47A 1YJ9P 1M90Q 3CCEP 1M74A 1S72P 4GR2A 3DPHA 2BHVA 3G71P 3DS4A 3DTJA 2E1MA 4U0FA 1K30A 1Q86Q 4XFZA 1KQSO 3CCMP 1Q7YQ 2JYLA 2LF4A 1KC8Q 1K73Q 2PEQA 3NTEA 4M0IA 5HGOA 3WBHA 1YJWP 3H4EA 1QVFO 3CCUP 1QVGO 1M6EX 1NJIQ 1D1DA 3CD6P 3VRLC 1QRJA 1VQLP 3CCLP 1YHQP 3B5IA 4PH0A 1YITP 3Q20A 5BS2A 2PENA 3CC7P 1N8RQ 1RO0A 2DGYA 3G1IA 1VQKP 1E6JP 2BUOA 2QA4P 2Z45A 5F2NA 2OTLP 3I56P 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A43 A;  2JYL A;  2LF4 A;  1A8O A;  2M8N A;  4U0E A;  4U0B A;  4XFZ A;  1AUM A;  3NTE A;  4XRO A;  3DS3 A;  4M0I A;  4U0C A;  5HGO A;  2XV6 A;  1EOQ A;  1EIA A;  3MGE A;  2JO0 A;  4U0A A;  4COC A;  2XXM A;  2M8P A;  2KOD A;  2JYG A;  3H4E A;  4IPY A;  3P05 A;  5DCK A;  5HGM A;  3DS1 A;  5I4T G;  3G0V A;  4PH1 A;  4XFX A;  1BAJ A;  2XT1 A;  3DS5 A;  1D1D A;  3VRL C;  1QRJ A;  4QNB A;  2M8L A;  4COP A;  4XFY A;  4PH0 A;  3LRY A;  4WYM A;  3G26 A;  3H47 A;  3G1G A;  3DS2 A;  3G21 A;  2L6E A;  4U0D A;  3G1I A;  3DPH A;  5JPA A;  1E6J P;  2BUO A;  3DS4 A;  3DTJ A;  3DS0 A;  3G28 A;  4U0F A;  2EIA A;  4XRQ A;  5HGN A;  5HGL A;  2ONT A;  3G29 A; 
#chains in the Genus database with same CATH topology
 1T8K A;  3CCS P;  2XV6 A;  2VLP A;  4XFX A;  3G26 A;  3CCQ P;  1HY8 A;  3GKL C;  2FVA A;  3DS0 A;  2AVA A;  5HGL A;  2GDY A;  3H0D A;  2KG6 A;  1L0I A;  1OR5 A;  4U0A A;  2PEK A;  1HQB A;  3CCR P;  4HKG A;  1X3O A;  2JU1 A;  2WPT A;  2FQ2 A;  4BPF A;  1VQ6 P;  1F80 D;  1ZMB A;  2FAE A;  5F2K A;  4XFY A;  2LTE A;  1L0H A;  2KW2 A;  5KP8 B;  4MRT C;  3G1G A;  5CZD B;  1VQM P;  1YI2 P;  2OAR A;  2K93 A;  4UHP B;  4NEO A;  2MVU A;  3G28 A;  5F2O A;  2KWL A;  2JAZ A;  1Z6M A;  2QEX P;  2GDX A;  3MGE A;  4COC A;  2FAD A;  3RG6 C;  3RG2 A;  2AFD A;  4PH1 A;  4GR6 A;  5BS1 A;  3G6E P;  2AF8 A;  1VQP P;  2KGC A;  3H47 A;  2GYK A;  3DPH A;  3G71 P;  1Q86 Q;  3CCM P;  2K2Q A;  1QVF O;  2ERH A;  1QVG O;  2N6Z A;  3CD6 P;  3VRL C;  1VQL P;  1YIT P;  4PXH B;  3CC7 P;  2DGY A;  1GPJ A;  2FHS C;  2K92 A;  2VLO A;  5F2N A;  3EJD A;  3EJE A;  2LOL A;  1A8O A;  3DS3 A;  2JO0 A;  2EFJ A;  2PNG A;  2PEI A;  3CC2 P;  2N5I A;  1KD1 Q;  7CEI A;  1YJN P;  2KGA A;  3CME P;  1W2B O;  2L6E A;  1IUQ A;  2K0D X;  3OW2 O;  5HGN A;  2KOO A;  2NO8 A;  2KOR A;  3GJN A;  3I55 P;  4U0C A;  1EOQ A;  2XXM A;  2XZ0 D;  3CCJ P;  5I4T G;  2GZJ A;  2K0X A;  2FQ1 A;  2L4B A;  1DNY A;  2XT1 A;  2PEO A;  2L22 A;  2JQ4 A;  1VQO P;  2GZG A;  4BPH A;  1Q82 Q;  4XRQ A;  1K9M Q;  2XZ1 C;  4U0B A;  1VQ5 P;  4F37 A;  4IPY A;  3U43 A;  1RNI A;  1K8A Q;  1VKU A;  2AFE A;  2OTJ P;  1CEI A;  1GXG A;  1YJ9 P;  3CCE P;  4H2X C;  1S72 P;  2JB0 A;  2BHV A;  3DS4 A;  1DV5 A;  4U0F A;  2FAC A;  4XFZ A;  1Q7Y Q;  2FVE A;  1KC8 Q;  2PEQ A;  4M0I A;  1KLP A;  2KG8 A;  2KGD A;  3H4E A;  2VLQ A;  2GZI A;  1M6E X;  1D1D A;  3B5I A;  2MVV A;  4PH0 A;  1UNK A;  1N8R Q;  2KR5 A;  2CQ8 A;  3G1I A;  4H2Y C;  1AF8 A;  2GZE A;  2Z45 A;  2OTL P;  3I56 P;  1VQ8 P;  5DCK A;  2EHT A;  2DNW A;  2PY8 A;  4COP A;  2Z46 A;  1BXI A;  4WYM A;  1Q81 Q;  3DS2 A;  2L9F A;  2GDW A;  3CC4 P;  2N6Y A;  3G29 A;  2CNR A;  2QNW A;  2M8P A;  3CMA P;  4R0M A;  2JBG A;  4DG9 A;  4CA3 A;  1M6N A;  3CPW O;  2ROQ A;  2LL8 A;  1VQ7 P;  5HVC A;  3EJB A;  4BPG A;  2KGE A;  5HGM A;  2JYG A;  3P05 A;  1YIJ P;  3G0V A;  3DS5 A;  2M8L A;  2P9X A;  3LRY A;  3CXC O;  2JU2 A;  5KP7 B;  1M90 Q;  1M74 A;  2LIU A;  3NY7 B;  1UJZ A;  1NQ4 A;  1K30 A;  5EJD A;  2MY5 A;  3NTE A;  2FQ0 A;  2LML A;  1YJW P;  1NJI Q;  1YHQ P;  2N98 A;  1RO0 A;  2BUO A;  2QA4 P;  2MF4 A;  1VHN A;  1A43 A;  5KP6 B;  2PEJ A;  4H2W C;  4U0E A;  3CCV P;  4XRO A;  1AUM A;  1EIA A;  1VQ4 P;  3DS1 A;  2JGP A;  1E0H A;  2Z44 A;  4PWV B;  2PEM A;  2MR8 A;  2N5H A;  2KOP A;  1GXH A;  4U0D A;  2X2B A;  2LPK A;  5JPA A;  2MR7 A;  1VQ9 P;  2GZF A;  2EG5 A;  5EW5 E;  2L0Q A;  2N50 A;  1EMV A;  2M5R A;  2KOD A;  2K0Y A;  1IMQ A;  1BAJ A;  3B4Q A;  4QNB A;  1VQN P;  1ACP A;  2K5X A;  3G21 A;  2K94 A;  1ZNV A;  3HYB A;  3HZQ A;  2EIA A;  2ONT A;  2M8N A;  3E2D A;  3M1M A;  2VLN A;  1AYI A;  3G4S P;  1JJ2 O;  5HV8 A;  4QKO A;  1M1K Q;  2CWO A;  4GR2 A;  2FVF A;  1IMP A;  3DTJ A;  2E1M A;  1KQS O;  2MD9 A;  2JYL A;  2LF4 A;  1MZ8 A;  1K73 Q;  3CE7 A;  5HGO A;  3WBH A;  2KOQ A;  2LKI A;  2CGQ A;  4IZ6 A;  3CCU P;  1QRJ A;  3CCL P;  2KOS A;  3GZM A;  2KG9 A;  3Q20 A;  5BS2 A;  2CG5 B;  1FR2 A;  2PEN A;  3GZL A;  2EHS A;  1VQK P;  1E6J P;  3LMO A;  2VSQ A;  1RO2 A;  2LIW A; 
#chains in the Genus database with same CATH homology
 1A43 A;  1A8O A;  2PEJ A;  4U0E A;  3CCV P;  4XRO A;  1AUM A;  3DS3 A;  3CCS P;  1VQ8 P;  2XV6 A;  1EIA A;  2JO0 A;  1VQ4 P;  5DCK A;  2EFJ A;  3DS1 A;  4XFX A;  2Z44 A;  2PEI A;  2PEM A;  3CC2 P;  1KD1 Q;  2PY8 A;  4COP A;  2Z46 A;  4WYM A;  1YJN P;  1Q81 Q;  3G26 A;  3CCQ P;  3CME P;  3DS2 A;  1W2B O;  2L6E A;  4U0D A;  5JPA A;  3CC4 P;  1IUQ A;  3DS0 A;  3OW2 O;  1VQ9 P;  5HGN A;  5HGL A;  3G29 A;  2EG5 A;  3H0D A;  3I55 P;  4U0C A;  1EOQ A;  4U0A A;  2PEK A;  2XXM A;  2M8P A;  3CCR P;  2KOD A;  3CMA P;  3CCJ P;  5I4T G;  1BAJ A;  2XT1 A;  2PEO A;  1VQ6 P;  4QNB A;  1ZMB A;  1VQN P;  5F2K A;  4XFY A;  1M6N A;  3G1G A;  3G21 A;  1VQM P;  1VQO P;  3CPW O;  1YI2 P;  2OAR A;  3HYB A;  1Q82 Q;  3G28 A;  3HZQ A;  4XRQ A;  2EIA A;  5F2O A;  1K9M Q;  2ONT A;  1VQ7 P;  2M8N A;  3E2D A;  4U0B A;  2QEX P;  3M1M A;  1VQ5 P;  3MGE A;  4COC A;  3RG6 C;  4IPY A;  2JYG A;  5HGM A;  3P05 A;  1RNI A;  3G4S P;  1JJ2 O;  1YIJ P;  3G0V A;  4PH1 A;  4GR6 A;  5BS1 A;  3DS5 A;  1K8A Q;  2OTJ P;  3G6E P;  1M1K Q;  1VQP P;  2CWO A;  2M8L A;  2P9X A;  3LRY A;  3CXC O;  3H47 A;  1YJ9 P;  1M90 Q;  3CCE P;  1M74 A;  1S72 P;  4GR2 A;  3DPH A;  2BHV A;  3G71 P;  3DS4 A;  3DTJ A;  2E1M A;  4U0F A;  1K30 A;  1Q86 Q;  4XFZ A;  1KQS O;  3CCM P;  1Q7Y Q;  2JYL A;  2LF4 A;  1KC8 Q;  1K73 Q;  2PEQ A;  3NTE A;  4M0I A;  5HGO A;  3WBH A;  1YJW P;  3H4E A;  1QVF O;  3CCU P;  1QVG O;  1M6E X;  1NJI Q;  1D1D A;  3CD6 P;  3VRL C;  1QRJ A;  1VQL P;  3CCL P;  1YHQ P;  3B5I A;  4PH0 A;  1YIT P;  3Q20 A;  5BS2 A;  2PEN A;  3CC7 P;  1N8R Q;  1RO0 A;  2DGY A;  3G1I A;  1VQK P;  1E6J P;  2BUO A;  2QA4 P;  2Z45 A;  5F2N A;  2OTL P;  3I56 P;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...