2JYLA

Solution structure of a double mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 17
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jylA00
2XT1A 3G1GA 4QNBA 4U0FA 4IPYA 3DS4A 2ONTA 3P05A 5HGMA 1A8OA 1D1DA 4XFYA 3NTEA 3H4EA 2JO0A 2XXMA 2JYGA 2JYLA 4U0CA 3LRYA 1E6JP 5HGNA 2BUOA 4PH1A 4COPA 5I4TG 1BAJA 3DS3A 1EIAA 4U0BA 5HGLA 1AUMA 5JPAA 2KODA 3G1IA 4COCA 4XRQA 2XV6A 5HGOA 1A43A 5DCKA 3G28A 2L6EA 3DS5A 3G29A 3DTJA 4M0IA 4U0AA 3VRLC 1QRJA 2LF4A 3G0VA 4XFXA 1EOQA 4U0EA 4XROA 3G21A 4XFZA 3H47A 4WYMA 2EIAA 4U0DA 3DPHA 2M8PA 3MGEA 2M8LA 4PH0A 3DS2A 2M8NA 3DS1A 3DS0A 3G26A
chains in the Genus database with same CATH superfamily
2XT1A 2KORA 2KG8A 5KP7B 3G71P 1VQKP 1NQ4A 5BS1A 2FHSC 3G6EP 2VLPA 3CCMP 1AYIA 2KG9A 2PENA 3U43A 2N6YA 1RNIA 2KOOA 2VLQA 4U0DA 3RG6C 2E1MA 2CG5B 4QNBA 1NJIQ 1M1KQ 1IUQA 2MY5A 2JO0A 2NO8A 4U0CA 1YI2P 1K8AQ 1X3OA 4H2YC 1A43A 1VQ5P 2FQ1A 3CCVP 5BS2A 2KOPA 1HQBA 2KGDA 5F2NA 1JJ2O 2LL8A 3MGEA 2LKIA 2AVAA 1IMPA 2QEXP 1VKUA 2PEIA 7CEIA 1W2BO 2FADA 1KC8Q 3G4SP 1T8KA 2MD9A 2JB0A 2XZ1C 4GR6A 3DTJA 2VLOA 2LF4A 2MVUA 2FACA 2EHSA 2GZJA 1KD1Q 3CCEP 2K93A 2PEKA 1Q82Q 4WYMA 3DPHA 5F2KA 3G1GA 3P05A 2Z44A 3H4EA 2XXMA 5JPAA 1K30A 4U0AA 3CD6P 5F2OA 4BPGA 1ZMBA 2CWOA 1OR5A 2EHTA 4U0FA 3HZQA 3H0DA 1FR2A 3OW2O 1IMQA 2CQ8A 3G29A 1MZ8A 1K9MQ 3B4QA 2GZIA 1Q7YQ 2LMLA 2QNWA 3EJEA 1RO0A 2L4BA 4QKOA 4BPHA 2ROQA 3CPWO 2DGYA 1M74A 1VQ6P 3LMOA 4PH1A 3Q20A 2FAEA 1EIAA 2KGAA 1AUMA 3GZMA 5DCKA 4PWVB 1CEIA 2KOSA 2GDYA 1E0HA 2K2QA 1VQOP 3G21A 2FQ2A 2PEJA 2JQ4A 1YJWP 2KGCA 2PY8A 2MR7A 2K94A 1VQ4P 1UJZA 2OTJP 1VQNP 2KWLA 1DNYA 2GZGA 3CC2P 2ERHA 2GZFA 1K73Q 3CCSP 2MVVA 4XFZA 1VQMP 1QVGO 1Q81Q 2M8NA 3G26A 1RO2A 1A8OA 2KR5A 4DG9A 1E6JP 3EJBA 2KOQA 4F37A 3CE7A 4R0MA 2CNRA 2JAZA 3CCRP 1YHQP 2OTLP 2N5HA 3DS2A 1VQ8P 5KP8B 1VQ7P 1L0HA 2LIUA 2M5RA 2KG6A 3GKLC 3GZLA 3I56P 2PEOA 1VQ9P 1L0IA 1QRJA 1UNKA 1F80D 2Z46A 2PNGA 1QVFO 4MRTC 2FQ0A 2K92A 5EJDA 1KLPA 1YJNP 4PXHB 1GXHA 3DS0A 2JBGA 1Z6MA 2GYKA 2K0YA 4XFYA 2KGEA 2AF8A 3E2DA 1ZNVA 5HGLA 2K0DX 4H2XC 3CC7P 2L6EA 3G0VA 4XFXA 2WPTA 2L22A 1YITP 2LIWA 5HGMA 2JU2A 3CMAP 4BPFA 2Z45A 1YJ9P 1BAJA 2X2BA 2LTEA 1N8RQ 1HY8A 2AFEA 1S72P 3I55P 2JGPA 2PEMA 4M0IA 3CCLP 2GZEA 2K0XA 2GDWA 1ACPA 1VQPP 3CC4P 3B5IA 2N50A 2AFDA 1M6NA 2EG5A 2LPKA 2VLNA 5KP6B 1GPJA 3DS3A 3G1IA 5EW5E 2L9FA 2JU1A 4XRQA 2XV6A 3GJNA 3HYBA 5HV8A 3NY7B 3H47A 1KQSO 1BXIA 1VQLP 3DS1A 1EMVA 2N6ZA 3NTEA 2CGQA 3CMEP 1YIJP 4U0BA 2EFJA 3G28A 2QA4P 2N5IA 3VRLC 5HVCA 4HKGA 2BHVA 3CCJP 4PH0A 1Q86Q 2K5XA 2KW2A 2DNWA 5I4TG 1AF8A 5HGOA 2PEQA 2LOLA 3WBHA 2XZ0D 2FVEA 4U0EA 2GDXA 3M1MA 5CZDB 1DV5A 2EIAA 2M8PA 2M8LA 2FVFA 3CXCO 4COPA 2MF4A 4COCA 3CCQP 3DS4A 4GR2A 2OARA 2JYGA 2JYLA 3CCUP 5HGNA 2L0QA 1GXGA 2P9XA 4XROA 1M6EX 2FVAA 2MR8A 3RG2A 4IPYA 2ONTA 1D1DA 4H2WC 4NEOA 3EJDA 3LRYA 4UHPB 2BUOA 2KODA 4IZ6A 2N98A 2VSQA 3DS5A 1EOQA 1M90Q 1VHNA 4CA3A
chains in the Genus database with same CATH topology
1VQ7P 2XT1A 4U0FA 3NTEA 3HZQA 3I56P 3CMEP 1YIJP 4U0BA 3G71P 3H0DA 2PEOA 2EFJA 1VQKP 5BS1A 3G6EP 1VQ9P 3OW2O 3G28A 3G29A 2QA4P 3CCMP 1K9MQ 3VRLC 1QRJA 2PENA 1Q7YQ 2Z46A 1RNIA 2BHVA 1QVFO 3CCJP 4U0DA 3RG6C 4PH0A 1Q86Q 1YJNP 3DS0A 2E1MA 1RO0A 4QNBA 1NJIQ 1M1KQ 4XFYA 1IUQA 3CPWO 2JO0A 2DGYA 1M74A 3E2DA 4U0CA 1VQ6P 4PH1A 5I4TG 3Q20A 1YI2P 1EIAA 5HGLA 1K8AQ 1AUMA 3CC7P 5HGOA 1A43A 2PEQA 5DCKA 1VQ5P 2L6EA 3CCVP 3WBHA 5BS2A 3G0VA 4XFXA 1VQOP 4U0EA 3G21A 3M1MA 2EIAA 5F2NA 1YITP 2PEJA 1JJ2O 2M8PA 3MGEA 2M8LA 1YJWP 3CXCO 2PY8A 4COPA 4COCA 3CCQP 5HGMA 3DS4A 4GR2A 1VQ4P 3CMAP 2OARA 2Z45A 1YJ9P 2JYGA 2JYLA 2QEXP 3CCUP 5HGNA 1VQNP 2OTJP 2PEIA 1W2BO 1BAJA 1KC8Q 1N8RQ 3G4SP 1S72P 2PEMA 3I55P 4GR6A 3DTJA 4M0IA 3CC2P 3CCLP 2P9XA 1K73Q 2LF4A 3CCSP 1KD1Q 3CCEP 4XROA 4XFZA 2PEKA 1VQMP 4WYMA 1Q82Q 1M6EX 1QVGO 1VQPP 3CC4P 3DPHA 1Q81Q 5F2KA 2M8NA 3B5IA 3G26A 1RO2A 3G1GA 1M6NA 4IPYA 2EG5A 2ONTA 2Z44A 1A8OA 3P05A 1D1DA 3H4EA 2XXMA 3LRYA 1E6JP 2BUOA 3DS3A 5JPAA 2KODA 3G1IA 1K30A 4XRQA 2XV6A 3HYBA 3DS5A 4U0AA 3CD6P 1EOQA 5F2OA 3H47A 3CCRP 1YHQP 1ZMBA 1M90Q 1KQSO 2OTLP 3DS2A 1VQLP 1VQ8P 2CWOA 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT1 A;  3G1G A;  4QNB A;  4U0F A;  4IPY A;  3DS4 A;  2ONT A;  3P05 A;  5HGM A;  1A8O A;  1D1D A;  4XFY A;  3NTE A;  3H4E A;  2JO0 A;  2XXM A;  2JYG A;  2JYL A;  4U0C A;  3LRY A;  1E6J P;  5HGN A;  2BUO A;  4PH1 A;  4COP A;  5I4T G;  1BAJ A;  3DS3 A;  1EIA A;  4U0B A;  5HGL A;  1AUM A;  5JPA A;  2KOD A;  3G1I A;  4COC A;  4XRQ A;  2XV6 A;  5HGO A;  1A43 A;  5DCK A;  3G28 A;  2L6E A;  3DS5 A;  3G29 A;  3DTJ A;  4M0I A;  4U0A A;  3VRL C;  1QRJ A;  2LF4 A;  3G0V A;  4XFX A;  1EOQ A;  4U0E A;  4XRO A;  3G21 A;  4XFZ A;  3H47 A;  4WYM A;  2EIA A;  4U0D A;  3DPH A;  2M8P A;  3MGE A;  2M8L A;  4PH0 A;  3DS2 A;  2M8N A;  3DS1 A;  3DS0 A;  3G26 A; 
#chains in the Genus database with same CATH topology
 2XT1 A;  2KOR A;  2KG8 A;  5KP7 B;  3G71 P;  1VQK P;  1NQ4 A;  5BS1 A;  2FHS C;  3G6E P;  2VLP A;  3CCM P;  1AYI A;  2KG9 A;  2PEN A;  3U43 A;  2N6Y A;  1RNI A;  2KOO A;  2VLQ A;  4U0D A;  3RG6 C;  2E1M A;  2CG5 B;  4QNB A;  1NJI Q;  1M1K Q;  1IUQ A;  2MY5 A;  2JO0 A;  2NO8 A;  4U0C A;  1YI2 P;  1K8A Q;  1X3O A;  4H2Y C;  1A43 A;  1VQ5 P;  2FQ1 A;  3CCV P;  5BS2 A;  2KOP A;  1HQB A;  2KGD A;  5F2N A;  1JJ2 O;  2LL8 A;  3MGE A;  2LKI A;  2AVA A;  1IMP A;  2QEX P;  1VKU A;  2PEI A;  7CEI A;  1W2B O;  2FAD A;  1KC8 Q;  3G4S P;  1T8K A;  2MD9 A;  2JB0 A;  2XZ1 C;  4GR6 A;  3DTJ A;  2VLO A;  2LF4 A;  2MVU A;  2FAC A;  2EHS A;  2GZJ A;  1KD1 Q;  3CCE P;  2K93 A;  2PEK A;  1Q82 Q;  4WYM A;  3DPH A;  5F2K A;  3G1G A;  3P05 A;  2Z44 A;  3H4E A;  2XXM A;  5JPA A;  1K30 A;  4U0A A;  3CD6 P;  5F2O A;  4BPG A;  1ZMB A;  2CWO A;  1OR5 A;  2EHT A;  4U0F A;  3HZQ A;  3H0D A;  1FR2 A;  3OW2 O;  1IMQ A;  2CQ8 A;  3G29 A;  1MZ8 A;  1K9M Q;  3B4Q A;  2GZI A;  1Q7Y Q;  2LML A;  2QNW A;  3EJE A;  1RO0 A;  2L4B A;  4QKO A;  4BPH A;  2ROQ A;  3CPW O;  2DGY A;  1M74 A;  1VQ6 P;  3LMO A;  4PH1 A;  3Q20 A;  2FAE A;  1EIA A;  2KGA A;  1AUM A;  3GZM A;  5DCK A;  4PWV B;  1CEI A;  2KOS A;  2GDY A;  1E0H A;  2K2Q A;  1VQO P;  3G21 A;  2FQ2 A;  2PEJ A;  2JQ4 A;  1YJW P;  2KGC A;  2PY8 A;  2MR7 A;  2K94 A;  1VQ4 P;  1UJZ A;  2OTJ P;  1VQN P;  2KWL A;  1DNY A;  2GZG A;  3CC2 P;  2ERH A;  2GZF A;  1K73 Q;  3CCS P;  2MVV A;  4XFZ A;  1VQM P;  1QVG O;  1Q81 Q;  2M8N A;  3G26 A;  1RO2 A;  1A8O A;  2KR5 A;  4DG9 A;  1E6J P;  3EJB A;  2KOQ A;  4F37 A;  3CE7 A;  4R0M A;  2CNR A;  2JAZ A;  3CCR P;  1YHQ P;  2OTL P;  2N5H A;  3DS2 A;  1VQ8 P;  5KP8 B;  1VQ7 P;  1L0H A;  2LIU A;  2M5R A;  2KG6 A;  3GKL C;  3GZL A;  3I56 P;  2PEO A;  1VQ9 P;  1L0I A;  1QRJ A;  1UNK A;  1F80 D;  2Z46 A;  2PNG A;  1QVF O;  4MRT C;  2FQ0 A;  2K92 A;  5EJD A;  1KLP A;  1YJN P;  4PXH B;  1GXH A;  3DS0 A;  2JBG A;  1Z6M A;  2GYK A;  2K0Y A;  4XFY A;  2KGE A;  2AF8 A;  3E2D A;  1ZNV A;  5HGL A;  2K0D X;  4H2X C;  3CC7 P;  2L6E A;  3G0V A;  4XFX A;  2WPT A;  2L22 A;  1YIT P;  2LIW A;  5HGM A;  2JU2 A;  3CMA P;  4BPF A;  2Z45 A;  1YJ9 P;  1BAJ A;  2X2B A;  2LTE A;  1N8R Q;  1HY8 A;  2AFE A;  1S72 P;  3I55 P;  2JGP A;  2PEM A;  4M0I A;  3CCL P;  2GZE A;  2K0X A;  2GDW A;  1ACP A;  1VQP P;  3CC4 P;  3B5I A;  2N50 A;  2AFD A;  1M6N A;  2EG5 A;  2LPK A;  2VLN A;  5KP6 B;  1GPJ A;  3DS3 A;  3G1I A;  5EW5 E;  2L9F A;  2JU1 A;  4XRQ A;  2XV6 A;  3GJN A;  3HYB A;  5HV8 A;  3NY7 B;  3H47 A;  1KQS O;  1BXI A;  1VQL P;  3DS1 A;  1EMV A;  2N6Z A;  3NTE A;  2CGQ A;  3CME P;  1YIJ P;  4U0B A;  2EFJ A;  3G28 A;  2QA4 P;  2N5I A;  3VRL C;  5HVC A;  4HKG A;  2BHV A;  3CCJ P;  4PH0 A;  1Q86 Q;  2K5X A;  2KW2 A;  2DNW A;  5I4T G;  1AF8 A;  5HGO A;  2PEQ A;  2LOL A;  3WBH A;  2XZ0 D;  2FVE A;  4U0E A;  2GDX A;  3M1M A;  5CZD B;  1DV5 A;  2EIA A;  2M8P A;  2M8L A;  2FVF A;  3CXC O;  4COP A;  2MF4 A;  4COC A;  3CCQ P;  3DS4 A;  4GR2 A;  2OAR A;  2JYG A;  2JYL A;  3CCU P;  5HGN A;  2L0Q A;  1GXG A;  2P9X A;  4XRO A;  1M6E X;  2FVA A;  2MR8 A;  3RG2 A;  4IPY A;  2ONT A;  1D1D A;  4H2W C;  4NEO A;  3EJD A;  3LRY A;  4UHP B;  2BUO A;  2KOD A;  4IZ6 A;  2N98 A;  2VSQ A;  3DS5 A;  1EOQ A;  1M90 Q;  1VHN A;  4CA3 A; 
#chains in the Genus database with same CATH homology
 1VQ7 P;  2XT1 A;  4U0F A;  3NTE A;  3HZQ A;  3I56 P;  3CME P;  1YIJ P;  4U0B A;  3G71 P;  3H0D A;  2PEO A;  2EFJ A;  1VQK P;  5BS1 A;  3G6E P;  1VQ9 P;  3OW2 O;  3G28 A;  3G29 A;  2QA4 P;  3CCM P;  1K9M Q;  3VRL C;  1QRJ A;  2PEN A;  1Q7Y Q;  2Z46 A;  1RNI A;  2BHV A;  1QVF O;  3CCJ P;  4U0D A;  3RG6 C;  4PH0 A;  1Q86 Q;  1YJN P;  3DS0 A;  2E1M A;  1RO0 A;  4QNB A;  1NJI Q;  1M1K Q;  4XFY A;  1IUQ A;  3CPW O;  2JO0 A;  2DGY A;  1M74 A;  3E2D A;  4U0C A;  1VQ6 P;  4PH1 A;  5I4T G;  3Q20 A;  1YI2 P;  1EIA A;  5HGL A;  1K8A Q;  1AUM A;  3CC7 P;  5HGO A;  1A43 A;  2PEQ A;  5DCK A;  1VQ5 P;  2L6E A;  3CCV P;  3WBH A;  5BS2 A;  3G0V A;  4XFX A;  1VQO P;  4U0E A;  3G21 A;  3M1M A;  2EIA A;  5F2N A;  1YIT P;  2PEJ A;  1JJ2 O;  2M8P A;  3MGE A;  2M8L A;  1YJW P;  3CXC O;  2PY8 A;  4COP A;  4COC A;  3CCQ P;  5HGM A;  3DS4 A;  4GR2 A;  1VQ4 P;  3CMA P;  2OAR A;  2Z45 A;  1YJ9 P;  2JYG A;  2JYL A;  2QEX P;  3CCU P;  5HGN A;  1VQN P;  2OTJ P;  2PEI A;  1W2B O;  1BAJ A;  1KC8 Q;  1N8R Q;  3G4S P;  1S72 P;  2PEM A;  3I55 P;  4GR6 A;  3DTJ A;  4M0I A;  3CC2 P;  3CCL P;  2P9X A;  1K73 Q;  2LF4 A;  3CCS P;  1KD1 Q;  3CCE P;  4XRO A;  4XFZ A;  2PEK A;  1VQM P;  4WYM A;  1Q82 Q;  1M6E X;  1QVG O;  1VQP P;  3CC4 P;  3DPH A;  1Q81 Q;  5F2K A;  2M8N A;  3B5I A;  3G26 A;  1RO2 A;  3G1G A;  1M6N A;  4IPY A;  2EG5 A;  2ONT A;  2Z44 A;  1A8O A;  3P05 A;  1D1D A;  3H4E A;  2XXM A;  3LRY A;  1E6J P;  2BUO A;  3DS3 A;  5JPA A;  2KOD A;  3G1I A;  1K30 A;  4XRQ A;  2XV6 A;  3HYB A;  3DS5 A;  4U0A A;  3CD6 P;  1EOQ A;  5F2O A;  3H47 A;  3CCR P;  1YHQ P;  1ZMB A;  1M90 Q;  1KQS O;  2OTL P;  3DS2 A;  1VQL P;  1VQ8 P;  2CWO A;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...