2PENA

Crystal structure of rbcx, crystal form i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 49
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2penA00
2PEMA 2PEJA 3Q20A 3RG6C 5BS1A 2Z45A 2PENA 4GR2A 2PEIA 2Z44A 2Z46A 2PEOA 4GR6A 2PEKA 5BS2A 3HYBA 2PY8A 2PEQA
chains in the Genus database with same CATH superfamily
2K0YA 1Z6MA 1VQPP 2PEJA 2FQ1A 3CCMP 3G1IA 2PEMA 2K94A 2GYKA 2OARA 3NY7B 2XV6A 2KODA 3B4QA 2JYGA 2PEIA 1CEIA 1VQ7P 3DS2A 1OR5A 4U0EA 5KP6B 3DS5A 3GZLA 2OTLP 3EJDA 2ONTA 1K73Q 1NQ4A 2LTEA 1BAJA 2AVAA 2CWOA 2EHSA 2XXMA 1HQBA 1F80D 2WPTA 1VKUA 2L6EA 1QVFO 3DS0A 4QNBA 2QA4P 1A43A 2KGAA 2FVFA 2XZ1C 4R0MA 2N98A 3G1GA 1Q86Q 1VQ8P 2OTJP 1X3OA 1KQSO 4M0IA 4XFYA 1L0IA 2KORA 1VQOP 3CCJP 1YIJP 2DGYA 2LOLA 2KG6A 1UJZA 2FHSC 3CC7P 3RG6C 2KGEA 1VQKP 4BPGA 3CCQP 2M8LA 2PEOA 1YHQP 2KWLA 2JAZA 5EW5E 2N50A 1E0HA 2MY5A 3GKLC 5JPAA 1K8AQ 2CGQA 1IMPA 1EMVA 5HGLA 4H2XC 2AF8A 2ROQA 1KC8Q 3DS3A 3RG2A 1AYIA 2PNGA 2P9XA 1AUMA 2LMLA 1DV5A 1VQ4P 1NJIQ 3CD6P 2LPKA 4UHPB 2N6ZA 3HYBA 3P05A 2NO8A 2X2BA 4U0BA 1E6JP 3CCEP 2LF4A 4PWVB 2BHVA 2EG5A 1BXIA 2PEQA 3U43A 1KLPA 4NEOA 4PXHB 4XFXA 1KD1Q 3G26A 2QNWA 4COCA 3H4EA 4U0AA 2L22A 2L4BA 3G29A 3DS1A 4F37A 4CA3A 4IPYA 2VLNA 1YJNP 2VLPA 2KR5A 2XZ0D 5F2NA 5KP8B 3GJNA 2AFDA 3G4SP 2K5XA 2BUOA 2N5IA 1HY8A 2MF4A 3DTJA 2LL8A 3H0DA 2KOSA 3CMAP 2JB0A 3CPWO 4HKGA 2K2QA 2MVVA 5HGMA 1VQNP 1AF8A 1JJ2O 1VQ6P 1IMQA 1D1DA 4IZ6A 1RNIA 2MR8A 3LMOA 3G28A 4XFZA 4GR6A 2LIUA 1Q82Q 5F2KA 2EHTA 3LRYA 3DPHA 2KOQA 2KOOA 3DS4A 3I55P 2DNWA 1W2BO 2Z45A 1S72P 3OW2O 5DCKA 1M1KQ 4BPHA 1N8RQ 2GZEA 2N6YA 3CXCO 1ZMBA 2GDXA 4BPFA 1K30A 3HZQA 2KW2A 3EJBA 2K92A 2K0XA 4GR2A 2KGDA 4PH0A 1Q81Q 1ACPA 2KOPA 2ERHA 2E1MA 1QVGO 3CE7A 5BS1A 5HVCA 1GXHA 4U0CA 2CG5B 1UNKA 5BS2A 1VQMP 2GZFA 2QEXP 3CMEP 4WYMA 2PEKA 2KG9A 2FVEA 4U0FA 1VQ5P 2XT1A 1MZ8A 1EIAA 1M6NA 2FADA 2GZJA 2JU2A 2FAEA 2FACA 1A8OA 5EJDA 2JBGA 2LKIA 1ZNVA 1VHNA 2MD9A 3M1MA 2VLOA 2JQ4A 4MRTC 4H2WC 1L0HA 2PY8A 1DNYA 1FR2A 4H2YC 1EOQA 2JYLA 4COPA 2L0QA 1YJ9P 2GDYA 1K9MQ 1QRJA 1M90Q 1T8KA 1YJWP 1YITP 3Q20A 3WBHA 2K93A 2KGCA 1GXGA 3CCRP 2FVAA 2GZGA 2FQ0A 2M8PA 2VLQA 1RO0A 1M6EX 5HGOA 2L9FA 3G21A 4XROA 4PH1A 2FQ2A 2CNRA 2JGPA 2K0DX 1VQ9P 2JO0A 4XRQA 7CEIA 2MR7A 3MGEA 3CC2P 3CCLP 2M5RA 2GDWA 3GZMA 2Z46A 2LIWA 2VSQA 3EJEA 1GPJA 3G71P 5F2OA 3NTEA 2EFJA 5KP7B 2CQ8A 2M8NA 3G6EP 1YI2P 3CCSP 2GZIA 5HV8A 5I4TG 3H47A 2AFEA 3E2DA 3CC4P 3CCVP 3VRLC 3G0VA 1IUQA 1VQLP 1M74A 3CCUP 2Z44A 4U0DA 2N5HA 1Q7YQ 3I56P 5CZDB 2EIAA 1RO2A 2PENA 2KG8A 4QKOA 3B5IA 4DG9A 5HGNA 2MVUA 2JU1A
chains in the Genus database with same CATH topology
3G28A 1YJ9P 5HGLA 4XFZA 1K9MQ 4GR6A 1QRJA 1M90Q 1Q82Q 1VQPP 1YJWP 5F2KA 3LRYA 2PEJA 3DPHA 3Q20A 3WBHA 1YITP 3DS3A 1KC8Q 3CCMP 3G1IA 3DS4A 3CCRP 3I55P 1W2BO 2P9XA 2M8PA 2PEMA 1AUMA 1RO0A 1M6EX 2Z45A 1S72P 5HGOA 2OARA 3G21A 4XROA 4PH1A 3OW2O 1VQ4P 2XV6A 5DCKA 1M1KQ 1NJIQ 3CD6P 2KODA 2JYGA 1N8RQ 2PEIA 1VQ9P 2JO0A 4XRQA 3HYBA 3CXCO 3P05A 1ZMBA 3MGEA 4U0BA 3CC2P 3CCLP 1E6JP 3CCEP 1VQ7P 3DS2A 4U0EA 1K30A 2LF4A 3DS5A 2OTLP 2BHVA 2Z46A 3HZQA 2ONTA 2EG5A 1K73Q 2PEQA 4XFXA 4GR2A 1KD1Q 3G71P 1BAJA 3G26A 4COCA 3H4EA 2CWOA 4U0AA 5F2OA 2XXMA 4PH0A 3G29A 1Q81Q 3NTEA 3DS0A 2L6EA 2EFJA 4QNBA 2QA4P 1QVFO 2E1MA 2M8NA 3DS1A 1A43A 3G6EP 1QVGO 5BS1A 4U0CA 4IPYA 5BS2A 1VQMP 1YI2P 3CCSP 3G1GA 1YJNP 1Q86Q 2QEXP 1VQ8P 3CMEP 2OTJP 4WYMA 2PEKA 1KQSO 4M0IA 5F2NA 4U0FA 5I4TG 3H47A 3E2DA 1VQ5P 3CC4P 4XFYA 2XT1A 3VRLC 3CCVP 1EIAA 1M6NA 1IUQA 3G0VA 3CCJP 1VQOP 1YIJP 2DGYA 1M74A 1VQLP 3G4SP 3CCUP 2BUOA 2Z44A 4U0DA 3DTJA 1A8OA 3H0DA 3CC7P 3CMAP 3RG6C 1Q7YQ 3I56P 3CPWO 1VQKP 3CCQP 2EIAA 1RO2A 2PENA 3M1MA 5HGMA 2M8LA 2PEOA 1YHQP 1VQNP 1JJ2O 1VQ6P 5JPAA 1D1DA 1K8AQ 1RNIA 2PY8A 3B5IA 1EOQA 2JYLA 5HGNA 4COPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEM A;  2PEJ A;  3Q20 A;  3RG6 C;  5BS1 A;  2Z45 A;  2PEN A;  4GR2 A;  2PEI A;  2Z44 A;  2Z46 A;  2PEO A;  4GR6 A;  2PEK A;  5BS2 A;  3HYB A;  2PY8 A;  2PEQ A; 
#chains in the Genus database with same CATH topology
 2K0Y A;  1Z6M A;  1VQP P;  2PEJ A;  2FQ1 A;  3CCM P;  3G1I A;  2PEM A;  2K94 A;  2GYK A;  2OAR A;  3NY7 B;  2XV6 A;  2KOD A;  3B4Q A;  2JYG A;  2PEI A;  1CEI A;  1VQ7 P;  3DS2 A;  1OR5 A;  4U0E A;  5KP6 B;  3DS5 A;  3GZL A;  2OTL P;  3EJD A;  2ONT A;  1K73 Q;  1NQ4 A;  2LTE A;  1BAJ A;  2AVA A;  2CWO A;  2EHS A;  2XXM A;  1HQB A;  1F80 D;  2WPT A;  1VKU A;  2L6E A;  1QVF O;  3DS0 A;  4QNB A;  2QA4 P;  1A43 A;  2KGA A;  2FVF A;  2XZ1 C;  4R0M A;  2N98 A;  3G1G A;  1Q86 Q;  1VQ8 P;  2OTJ P;  1X3O A;  1KQS O;  4M0I A;  4XFY A;  1L0I A;  2KOR A;  1VQO P;  3CCJ P;  1YIJ P;  2DGY A;  2LOL A;  2KG6 A;  1UJZ A;  2FHS C;  3CC7 P;  3RG6 C;  2KGE A;  1VQK P;  4BPG A;  3CCQ P;  2M8L A;  2PEO A;  1YHQ P;  2KWL A;  2JAZ A;  5EW5 E;  2N50 A;  1E0H A;  2MY5 A;  3GKL C;  5JPA A;  1K8A Q;  2CGQ A;  1IMP A;  1EMV A;  5HGL A;  4H2X C;  2AF8 A;  2ROQ A;  1KC8 Q;  3DS3 A;  3RG2 A;  1AYI A;  2PNG A;  2P9X A;  1AUM A;  2LML A;  1DV5 A;  1VQ4 P;  1NJI Q;  3CD6 P;  2LPK A;  4UHP B;  2N6Z A;  3HYB A;  3P05 A;  2NO8 A;  2X2B A;  4U0B A;  1E6J P;  3CCE P;  2LF4 A;  4PWV B;  2BHV A;  2EG5 A;  1BXI A;  2PEQ A;  3U43 A;  1KLP A;  4NEO A;  4PXH B;  4XFX A;  1KD1 Q;  3G26 A;  2QNW A;  4COC A;  3H4E A;  4U0A A;  2L22 A;  2L4B A;  3G29 A;  3DS1 A;  4F37 A;  4CA3 A;  4IPY A;  2VLN A;  1YJN P;  2VLP A;  2KR5 A;  2XZ0 D;  5F2N A;  5KP8 B;  3GJN A;  2AFD A;  3G4S P;  2K5X A;  2BUO A;  2N5I A;  1HY8 A;  2MF4 A;  3DTJ A;  2LL8 A;  3H0D A;  2KOS A;  3CMA P;  2JB0 A;  3CPW O;  4HKG A;  2K2Q A;  2MVV A;  5HGM A;  1VQN P;  1AF8 A;  1JJ2 O;  1VQ6 P;  1IMQ A;  1D1D A;  4IZ6 A;  1RNI A;  2MR8 A;  3LMO A;  3G28 A;  4XFZ A;  4GR6 A;  2LIU A;  1Q82 Q;  5F2K A;  2EHT A;  3LRY A;  3DPH A;  2KOQ A;  2KOO A;  3DS4 A;  3I55 P;  2DNW A;  1W2B O;  2Z45 A;  1S72 P;  3OW2 O;  5DCK A;  1M1K Q;  4BPH A;  1N8R Q;  2GZE A;  2N6Y A;  3CXC O;  1ZMB A;  2GDX A;  4BPF A;  1K30 A;  3HZQ A;  2KW2 A;  3EJB A;  2K92 A;  2K0X A;  4GR2 A;  2KGD A;  4PH0 A;  1Q81 Q;  1ACP A;  2KOP A;  2ERH A;  2E1M A;  1QVG O;  3CE7 A;  5BS1 A;  5HVC A;  1GXH A;  4U0C A;  2CG5 B;  1UNK A;  5BS2 A;  1VQM P;  2GZF A;  2QEX P;  3CME P;  4WYM A;  2PEK A;  2KG9 A;  2FVE A;  4U0F A;  1VQ5 P;  2XT1 A;  1MZ8 A;  1EIA A;  1M6N A;  2FAD A;  2GZJ A;  2JU2 A;  2FAE A;  2FAC A;  1A8O A;  5EJD A;  2JBG A;  2LKI A;  1ZNV A;  1VHN A;  2MD9 A;  3M1M A;  2VLO A;  2JQ4 A;  4MRT C;  4H2W C;  1L0H A;  2PY8 A;  1DNY A;  1FR2 A;  4H2Y C;  1EOQ A;  2JYL A;  4COP A;  2L0Q A;  1YJ9 P;  2GDY A;  1K9M Q;  1QRJ A;  1M90 Q;  1T8K A;  1YJW P;  1YIT P;  3Q20 A;  3WBH A;  2K93 A;  2KGC A;  1GXG A;  3CCR P;  2FVA A;  2GZG A;  2FQ0 A;  2M8P A;  2VLQ A;  1RO0 A;  1M6E X;  5HGO A;  2L9F A;  3G21 A;  4XRO A;  4PH1 A;  2FQ2 A;  2CNR A;  2JGP A;  2K0D X;  1VQ9 P;  2JO0 A;  4XRQ A;  7CEI A;  2MR7 A;  3MGE A;  3CC2 P;  3CCL P;  2M5R A;  2GDW A;  3GZM A;  2Z46 A;  2LIW A;  2VSQ A;  3EJE A;  1GPJ A;  3G71 P;  5F2O A;  3NTE A;  2EFJ A;  5KP7 B;  2CQ8 A;  2M8N A;  3G6E P;  1YI2 P;  3CCS P;  2GZI A;  5HV8 A;  5I4T G;  3H47 A;  2AFE A;  3E2D A;  3CC4 P;  3CCV P;  3VRL C;  3G0V A;  1IUQ A;  1VQL P;  1M74 A;  3CCU P;  2Z44 A;  4U0D A;  2N5H A;  1Q7Y Q;  3I56 P;  5CZD B;  2EIA A;  1RO2 A;  2PEN A;  2KG8 A;  4QKO A;  3B5I A;  4DG9 A;  5HGN A;  2MVU A;  2JU1 A; 
#chains in the Genus database with same CATH homology
 3G28 A;  1YJ9 P;  5HGL A;  4XFZ A;  1K9M Q;  4GR6 A;  1QRJ A;  1M90 Q;  1Q82 Q;  1VQP P;  1YJW P;  5F2K A;  3LRY A;  2PEJ A;  3DPH A;  3Q20 A;  3WBH A;  1YIT P;  3DS3 A;  1KC8 Q;  3CCM P;  3G1I A;  3DS4 A;  3CCR P;  3I55 P;  1W2B O;  2P9X A;  2M8P A;  2PEM A;  1AUM A;  1RO0 A;  1M6E X;  2Z45 A;  1S72 P;  5HGO A;  2OAR A;  3G21 A;  4XRO A;  4PH1 A;  3OW2 O;  1VQ4 P;  2XV6 A;  5DCK A;  1M1K Q;  1NJI Q;  3CD6 P;  2KOD A;  2JYG A;  1N8R Q;  2PEI A;  1VQ9 P;  2JO0 A;  4XRQ A;  3HYB A;  3CXC O;  3P05 A;  1ZMB A;  3MGE A;  4U0B A;  3CC2 P;  3CCL P;  1E6J P;  3CCE P;  1VQ7 P;  3DS2 A;  4U0E A;  1K30 A;  2LF4 A;  3DS5 A;  2OTL P;  2BHV A;  2Z46 A;  3HZQ A;  2ONT A;  2EG5 A;  1K73 Q;  2PEQ A;  4XFX A;  4GR2 A;  1KD1 Q;  3G71 P;  1BAJ A;  3G26 A;  4COC A;  3H4E A;  2CWO A;  4U0A A;  5F2O A;  2XXM A;  4PH0 A;  3G29 A;  1Q81 Q;  3NTE A;  3DS0 A;  2L6E A;  2EFJ A;  4QNB A;  2QA4 P;  1QVF O;  2E1M A;  2M8N A;  3DS1 A;  1A43 A;  3G6E P;  1QVG O;  5BS1 A;  4U0C A;  4IPY A;  5BS2 A;  1VQM P;  1YI2 P;  3CCS P;  3G1G A;  1YJN P;  1Q86 Q;  2QEX P;  1VQ8 P;  3CME P;  2OTJ P;  4WYM A;  2PEK A;  1KQS O;  4M0I A;  5F2N A;  4U0F A;  5I4T G;  3H47 A;  3E2D A;  1VQ5 P;  3CC4 P;  4XFY A;  2XT1 A;  3VRL C;  3CCV P;  1EIA A;  1M6N A;  1IUQ A;  3G0V A;  3CCJ P;  1VQO P;  1YIJ P;  2DGY A;  1M74 A;  1VQL P;  3G4S P;  3CCU P;  2BUO A;  2Z44 A;  4U0D A;  3DTJ A;  1A8O A;  3H0D A;  3CC7 P;  3CMA P;  3RG6 C;  1Q7Y Q;  3I56 P;  3CPW O;  1VQK P;  3CCQ P;  2EIA A;  1RO2 A;  2PEN A;  3M1M A;  5HGM A;  2M8L A;  2PEO A;  1YHQ P;  1VQN P;  1JJ2 O;  1VQ6 P;  5JPA A;  1D1D A;  1K8A Q;  1RNI A;  2PY8 A;  3B5I A;  1EOQ A;  2JYL A;  5HGN A;  4COP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...