2PENA

Crystal structure of rbcx, crystal form i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 49
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2penA00
2PEIA 3HYBA 2PY8A 4GR2A 2PEOA 3Q20A 2PENA 2PEQA 4GR6A 3RG6C 5BS2A 2Z45A 2Z44A 5BS1A 2PEMA 2Z46A 2PEKA 2PEJA
chains in the Genus database with same CATH superfamily
5HVCA 4U0AA 1M6NA 1HQBA 1ZNVA 2KGAA 2LIWA 2VLOA 5F2OA 3LMOA 2ONTA 2MVVA 1YHQP 4COCA 2KR5A 3CCUP 2ROQA 2CQ8A 2LMLA 2QA4P 4BPHA 4UHPB 2L22A 2NO8A 3VRLC 1VQ8P 3CCMP 2N98A 2FVEA 2GDWA 1YJNP 1M1KQ 2QEXP 2MR8A 2GDYA 1Q7YQ 2L4BA 2LIUA 5I4TG 2PEJA 2EG5A 1YI2P 3GJNA 1K8AQ 1UJZA 2M8PA 5CZDB 1AF8A 3GZLA 3B4QA 1VQ5P 2FQ1A 3EJDA 4XFYA 2JAZA 3OW2O 2K0YA 3CCSP 2KWLA 2FQ0A 3E2DA 2QNWA 1A43A 1JJ2O 1GXGA 2K94A 1GPJA 2JBGA 1L0IA 2KOQA 3CCLP 7CEIA 3DS2A 3GZMA 1IUQA 2BUOA 4PH0A 1RO0A 2K5XA 2PEOA 3EJBA 1S72P 2KODA 1DNYA 2N6ZA 4XFZA 2GZEA 5EW5E 5KP7B 1M74A 4M0IA 4PXHB 1QRJA 3G1GA 4IPYA 3HZQA 1RNIA 4XFXA 3MGEA 5JPAA 2JGPA 5KP8B 1VQKP 1L0HA 3CMAP 1Q86Q 2MR7A 1GXHA 3G6EP 5BS1A 4H2XC 4PH1A 4U0DA 2AFEA 1VHNA 1X3OA 1KC8Q 1D1DA 2L6EA 3LRYA 3CC7P 2OTJP 2ERHA 1K73Q 1YITP 1KQSO 2KOOA 1YJ9P 1E0HA 2PEKA 3WBHA 4U0BA 1BXIA 2GZIA 3G4SP 2Z46A 2JO0A 1QVGO 2PY8A 2K0DX 2LTEA 2CGQA 3I55P 2K0XA 1BAJA 1VQNP 2XV6A 1VQMP 1KD1Q 2M8NA 2JB0A 1K30A 4U0EA 1VQ6P 1VQOP 1IMQA 2GZFA 3CCRP 1VQ4P 3H4EA 2E1MA 4XRQA 3B5IA 1M6EX 1VQPP 2KG8A 2KGDA 1M90Q 2LL8A 1VQLP 3P05A 4H2YC 3DS4A 3CCJP 2CWOA 2MF4A 5DCKA 1F80D 2N6YA 4NEOA 2PENA 1A8OA 2GZGA 2K92A 1VQ7P 3GKLC 3G21A 1EOQA 1RO2A 2LF4A 3RG6C 1E6JP 2EHSA 2LOLA 2VLQA 2XZ0D 2VLPA 5EJDA 3DS3A 4HKGA 3CC4P 4XROA 2PEIA 1NQ4A 4GR6A 4QKOA 2FACA 4H2WC 3NTEA 2OTLP 2GYKA 4IZ6A 1HY8A 4CA3A 2X2BA 3DS1A 1YJWP 1NJIQ 2N50A 3CPWO 2AFDA 3CCQP 3I56P 2FAEA 2KW2A 3EJEA 2M5RA 4R0MA 2P9XA 3CC2P 3CMEP 2JYGA 1CEIA 2N5IA 2MD9A 1Q82Q 2FADA 2LKIA 1VQ9P 5HGLA 2GDXA 2PNGA 1AYIA 4WYMA 2L9FA 2FHSC 1FR2A 3DS5A 2KGEA 3NY7B 1Z6MA 5HGOA 5KP6B 2XXMA 2EIAA 2FVFA 2XZ1C 2JU2A 3G29A 2KG6A 2KOSA 1VKUA 2MVUA 3DTJA 2AF8A 2K2QA 3RG2A 4BPGA 3DS0A 2OARA 2DGYA 1OR5A 2BHVA 1K9MQ 2L0QA 5HGMA 3U43A 4QNBA 2GZJA 2N5HA 1EMVA 2VLNA 2JYLA 2PEMA 2KG9A 1QVFO 5HGNA 3M1MA 3CE7A 2M8LA 4U0FA 2FVAA 3CXCO 4COPA 4F37A 5BS2A 1Q81Q 1MZ8A 3CD6P 2CNRA 2KOPA 2VSQA 1UNKA 3DPHA 4PWVB 3HYBA 1IMPA 3H0DA 2EFJA 2EHTA 3G28A 2XT1A 2KORA 3G0VA 4U0CA 2WPTA 3H47A 2JU1A 3G26A 2FQ2A 2LPKA 1EIAA 5F2NA 2Z44A 4BPFA 1N8RQ 2MY5A 3Q20A 3CCVP 2AVAA 2DNWA 3G1IA 3CCEP 4DG9A 4GR2A 1DV5A 1YIJP 2CG5B 1T8KA 2JQ4A 1ACPA 4MRTC 2KGCA 1W2BO 5F2KA 3G71P 2K93A 1KLPA 5HV8A 1ZMBA 2PEQA 2Z45A 1AUMA
chains in the Genus database with same CATH topology
4PH0A 1RO0A 4U0AA 1M6NA 2PEOA 3DS4A 1S72P 2KODA 3DTJA 3CCJP 4XFZA 5F2OA 2CWOA 2ONTA 1YHQP 1M74A 5DCKA 4M0IA 4COCA 1QRJA 3G1GA 3DS0A 2OARA 4IPYA 3HZQA 1RNIA 4XFXA 3MGEA 5JPAA 2DGYA 2PENA 1A8OA 2BHVA 1VQKP 3CMAP 1Q86Q 1K9MQ 5HGMA 1VQ7P 3CCUP 4QNBA 3G21A 1EOQA 1RO2A 3G6EP 2LF4A 1E6JP 3RG6C 5BS1A 4PH1A 2QA4P 4U0DA 2JYLA 2PEMA 1QVFO 1KC8Q 5HGNA 3DS3A 1D1DA 3CC4P 4XROA 2PEIA 3M1MA 2M8LA 3VRLC 1VQ8P 4U0FA 2L6EA 3CCMP 4GR6A 3LRYA 3CXCO 3CC7P 2OTJP 2OTLP 3NTEA 4COPA 1YJNP 5BS2A 1K73Q 1Q81Q 1M1KQ 3CD6P 2QEXP 1YITP 3DPHA 1KQSO 1Q7YQ 3DS1A 5I4TG 1YJ9P 1YJWP 1NJIQ 2PEJA 3HYBA 2EG5A 3CPWO 3H0DA 2EFJA 1YI2P 3G28A 2XT1A 3CCQP 1K8AQ 3G0VA 3I56P 2PEKA 3WBHA 4U0CA 2M8PA 4U0BA 2P9XA 3H47A 3G4SP 2Z46A 3G26A 3CC2P 1N8RQ 2Z44A 1EIAA 2JO0A 2JYGA 2PY8A 5F2NA 1VQ5P 1QVGO 3CMEP 3I55P 3Q20A 4XFYA 3CCVP 1BAJA 3OW2O 1VQNP 3G1IA 1Q82Q 2XV6A 1VQ9P 3CCEP 5HGLA 3CCSP 1VQMP 1KD1Q 2M8NA 1K30A 4GR2A 3E2DA 4U0EA 1YIJP 4WYMA 1A43A 1VQ6P 1VQOP 1JJ2O 3CCRP 1VQ4P 3DS5A 3H4EA 1W2BO 5F2KA 2E1MA 3G71P 4XRQA 5HGOA 3B5IA 1M6EX 1VQPP 3CCLP 2XXMA 2EIAA 3DS2A 1M90Q 1ZMBA 2PEQA 3G29A 1IUQA 2BUOA 1VQLP 2Z45A 3P05A 1AUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEI A;  3HYB A;  2PY8 A;  4GR2 A;  2PEO A;  3Q20 A;  2PEN A;  2PEQ A;  4GR6 A;  3RG6 C;  5BS2 A;  2Z45 A;  2Z44 A;  5BS1 A;  2PEM A;  2Z46 A;  2PEK A;  2PEJ A; 
#chains in the Genus database with same CATH topology
 5HVC A;  4U0A A;  1M6N A;  1HQB A;  1ZNV A;  2KGA A;  2LIW A;  2VLO A;  5F2O A;  3LMO A;  2ONT A;  2MVV A;  1YHQ P;  4COC A;  2KR5 A;  3CCU P;  2ROQ A;  2CQ8 A;  2LML A;  2QA4 P;  4BPH A;  4UHP B;  2L22 A;  2NO8 A;  3VRL C;  1VQ8 P;  3CCM P;  2N98 A;  2FVE A;  2GDW A;  1YJN P;  1M1K Q;  2QEX P;  2MR8 A;  2GDY A;  1Q7Y Q;  2L4B A;  2LIU A;  5I4T G;  2PEJ A;  2EG5 A;  1YI2 P;  3GJN A;  1K8A Q;  1UJZ A;  2M8P A;  5CZD B;  1AF8 A;  3GZL A;  3B4Q A;  1VQ5 P;  2FQ1 A;  3EJD A;  4XFY A;  2JAZ A;  3OW2 O;  2K0Y A;  3CCS P;  2KWL A;  2FQ0 A;  3E2D A;  2QNW A;  1A43 A;  1JJ2 O;  1GXG A;  2K94 A;  1GPJ A;  2JBG A;  1L0I A;  2KOQ A;  3CCL P;  7CEI A;  3DS2 A;  3GZM A;  1IUQ A;  2BUO A;  4PH0 A;  1RO0 A;  2K5X A;  2PEO A;  3EJB A;  1S72 P;  2KOD A;  1DNY A;  2N6Z A;  4XFZ A;  2GZE A;  5EW5 E;  5KP7 B;  1M74 A;  4M0I A;  4PXH B;  1QRJ A;  3G1G A;  4IPY A;  3HZQ A;  1RNI A;  4XFX A;  3MGE A;  5JPA A;  2JGP A;  5KP8 B;  1VQK P;  1L0H A;  3CMA P;  1Q86 Q;  2MR7 A;  1GXH A;  3G6E P;  5BS1 A;  4H2X C;  4PH1 A;  4U0D A;  2AFE A;  1VHN A;  1X3O A;  1KC8 Q;  1D1D A;  2L6E A;  3LRY A;  3CC7 P;  2OTJ P;  2ERH A;  1K73 Q;  1YIT P;  1KQS O;  2KOO A;  1YJ9 P;  1E0H A;  2PEK A;  3WBH A;  4U0B A;  1BXI A;  2GZI A;  3G4S P;  2Z46 A;  2JO0 A;  1QVG O;  2PY8 A;  2K0D X;  2LTE A;  2CGQ A;  3I55 P;  2K0X A;  1BAJ A;  1VQN P;  2XV6 A;  1VQM P;  1KD1 Q;  2M8N A;  2JB0 A;  1K30 A;  4U0E A;  1VQ6 P;  1VQO P;  1IMQ A;  2GZF A;  3CCR P;  1VQ4 P;  3H4E A;  2E1M A;  4XRQ A;  3B5I A;  1M6E X;  1VQP P;  2KG8 A;  2KGD A;  1M90 Q;  2LL8 A;  1VQL P;  3P05 A;  4H2Y C;  3DS4 A;  3CCJ P;  2CWO A;  2MF4 A;  5DCK A;  1F80 D;  2N6Y A;  4NEO A;  2PEN A;  1A8O A;  2GZG A;  2K92 A;  1VQ7 P;  3GKL C;  3G21 A;  1EOQ A;  1RO2 A;  2LF4 A;  3RG6 C;  1E6J P;  2EHS A;  2LOL A;  2VLQ A;  2XZ0 D;  2VLP A;  5EJD A;  3DS3 A;  4HKG A;  3CC4 P;  4XRO A;  2PEI A;  1NQ4 A;  4GR6 A;  4QKO A;  2FAC A;  4H2W C;  3NTE A;  2OTL P;  2GYK A;  4IZ6 A;  1HY8 A;  4CA3 A;  2X2B A;  3DS1 A;  1YJW P;  1NJI Q;  2N50 A;  3CPW O;  2AFD A;  3CCQ P;  3I56 P;  2FAE A;  2KW2 A;  3EJE A;  2M5R A;  4R0M A;  2P9X A;  3CC2 P;  3CME P;  2JYG A;  1CEI A;  2N5I A;  2MD9 A;  1Q82 Q;  2FAD A;  2LKI A;  1VQ9 P;  5HGL A;  2GDX A;  2PNG A;  1AYI A;  4WYM A;  2L9F A;  2FHS C;  1FR2 A;  3DS5 A;  2KGE A;  3NY7 B;  1Z6M A;  5HGO A;  5KP6 B;  2XXM A;  2EIA A;  2FVF A;  2XZ1 C;  2JU2 A;  3G29 A;  2KG6 A;  2KOS A;  1VKU A;  2MVU A;  3DTJ A;  2AF8 A;  2K2Q A;  3RG2 A;  4BPG A;  3DS0 A;  2OAR A;  2DGY A;  1OR5 A;  2BHV A;  1K9M Q;  2L0Q A;  5HGM A;  3U43 A;  4QNB A;  2GZJ A;  2N5H A;  1EMV A;  2VLN A;  2JYL A;  2PEM A;  2KG9 A;  1QVF O;  5HGN A;  3M1M A;  3CE7 A;  2M8L A;  4U0F A;  2FVA A;  3CXC O;  4COP A;  4F37 A;  5BS2 A;  1Q81 Q;  1MZ8 A;  3CD6 P;  2CNR A;  2KOP A;  2VSQ A;  1UNK A;  3DPH A;  4PWV B;  3HYB A;  1IMP A;  3H0D A;  2EFJ A;  2EHT A;  3G28 A;  2XT1 A;  2KOR A;  3G0V A;  4U0C A;  2WPT A;  3H47 A;  2JU1 A;  3G26 A;  2FQ2 A;  2LPK A;  1EIA A;  5F2N A;  2Z44 A;  4BPF A;  1N8R Q;  2MY5 A;  3Q20 A;  3CCV P;  2AVA A;  2DNW A;  3G1I A;  3CCE P;  4DG9 A;  4GR2 A;  1DV5 A;  1YIJ P;  2CG5 B;  1T8K A;  2JQ4 A;  1ACP A;  4MRT C;  2KGC A;  1W2B O;  5F2K A;  3G71 P;  2K93 A;  1KLP A;  5HV8 A;  1ZMB A;  2PEQ A;  2Z45 A;  1AUM A; 
#chains in the Genus database with same CATH homology
 4PH0 A;  1RO0 A;  4U0A A;  1M6N A;  2PEO A;  3DS4 A;  1S72 P;  2KOD A;  3DTJ A;  3CCJ P;  4XFZ A;  5F2O A;  2CWO A;  2ONT A;  1YHQ P;  1M74 A;  5DCK A;  4M0I A;  4COC A;  1QRJ A;  3G1G A;  3DS0 A;  2OAR A;  4IPY A;  3HZQ A;  1RNI A;  4XFX A;  3MGE A;  5JPA A;  2DGY A;  2PEN A;  1A8O A;  2BHV A;  1VQK P;  3CMA P;  1Q86 Q;  1K9M Q;  5HGM A;  1VQ7 P;  3CCU P;  4QNB A;  3G21 A;  1EOQ A;  1RO2 A;  3G6E P;  2LF4 A;  1E6J P;  3RG6 C;  5BS1 A;  4PH1 A;  2QA4 P;  4U0D A;  2JYL A;  2PEM A;  1QVF O;  1KC8 Q;  5HGN A;  3DS3 A;  1D1D A;  3CC4 P;  4XRO A;  2PEI A;  3M1M A;  2M8L A;  3VRL C;  1VQ8 P;  4U0F A;  2L6E A;  3CCM P;  4GR6 A;  3LRY A;  3CXC O;  3CC7 P;  2OTJ P;  2OTL P;  3NTE A;  4COP A;  1YJN P;  5BS2 A;  1K73 Q;  1Q81 Q;  1M1K Q;  3CD6 P;  2QEX P;  1YIT P;  3DPH A;  1KQS O;  1Q7Y Q;  3DS1 A;  5I4T G;  1YJ9 P;  1YJW P;  1NJI Q;  2PEJ A;  3HYB A;  2EG5 A;  3CPW O;  3H0D A;  2EFJ A;  1YI2 P;  3G28 A;  2XT1 A;  3CCQ P;  1K8A Q;  3G0V A;  3I56 P;  2PEK A;  3WBH A;  4U0C A;  2M8P A;  4U0B A;  2P9X A;  3H47 A;  3G4S P;  2Z46 A;  3G26 A;  3CC2 P;  1N8R Q;  2Z44 A;  1EIA A;  2JO0 A;  2JYG A;  2PY8 A;  5F2N A;  1VQ5 P;  1QVG O;  3CME P;  3I55 P;  3Q20 A;  4XFY A;  3CCV P;  1BAJ A;  3OW2 O;  1VQN P;  3G1I A;  1Q82 Q;  2XV6 A;  1VQ9 P;  3CCE P;  5HGL A;  3CCS P;  1VQM P;  1KD1 Q;  2M8N A;  1K30 A;  4GR2 A;  3E2D A;  4U0E A;  1YIJ P;  4WYM A;  1A43 A;  1VQ6 P;  1VQO P;  1JJ2 O;  3CCR P;  1VQ4 P;  3DS5 A;  3H4E A;  1W2B O;  5F2K A;  2E1M A;  3G71 P;  4XRQ A;  5HGO A;  3B5I A;  1M6E X;  1VQP P;  3CCL P;  2XXM A;  2EIA A;  3DS2 A;  1M90 Q;  1ZMB A;  2PEQ A;  3G29 A;  1IUQ A;  2BUO A;  1VQL P;  2Z45 A;  3P05 A;  1AUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...