2PENA

Crystal structure of rbcx, crystal form i
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 49
structure length 110
sequence length 110
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2penA00
3Q20A 2PEIA 4GR2A 2PEOA 2PEKA 5BS2A 2PY8A 4GR6A 2PEQA 3HYBA 2PEMA 2Z45A 5BS1A 2Z44A 2PEJA 3RG6C 2PENA 2Z46A
chains in the Genus database with same CATH superfamily
2ROQA 2WPTA 2LL8A 3RG6C 3Q20A 2M8PA 4XFXA 3G26A 5HVCA 2JYGA 2FAEA 5EJDA 2PEOA 2CQ8A 5F2KA 1VHNA 2LIUA 2MY5A 1RO0A 3EJBA 1UJZA 2OARA 2MVUA 3CPWO 2JQ4A 5KP7B 1QVFO 3WBHA 2AF8A 4U0BA 1BXIA 1VKUA 1GXGA 3GJNA 1EOQA 1YJNP 2XT1A 4IZ6A 2GZFA 2VLOA 2DGYA 5HGNA 2FACA 2JU1A 1NJIQ 2KODA 3CCJP 2KGCA 2LMLA 3CC4P 1VQ6P 5BS1A 2LOLA 1AUMA 1AF8A 2FVEA 2CNRA 2OTJP 2FQ2A 2MF4A 1Q86Q 1M6NA 4COPA 4COCA 2KW2A 2K0DX 7CEIA 1YITP 4H2YC 2DNWA 2Z44A 4QNBA 3GKLC 4GR2A 2LIWA 3CMAP 2L6EA 1Q82Q 2XXMA 5KP8B 2JAZA 2Z45A 4PH0A 1M1KQ 1GXHA 2JO0A 2NO8A 2PY8A 3DTJA 3E2DA 1X3OA 3VRLC 2PEIA 2K92A 2MVVA 1VQKP 3MGEA 1EMVA 2N6YA 3NY7B 4U0DA 2EFJA 4DG9A 1T8KA 4BPGA 5HGOA 3CCUP 1K73Q 2JGPA 3CXCO 2K93A 2BUOA 2LF4A 3P05A 2K5XA 3CCEP 1K8AQ 4U0AA 3CCMP 2GDWA 2KOOA 1HY8A 2KGEA 3H47A 3DS5A 2JBGA 2N5HA 4IPYA 5DCKA 1QVGO 2PEMA 2KORA 3HZQA 2GDXA 1ZNVA 1CEIA 1L0IA 4WYMA 4XFYA 3EJEA 1KD1Q 2KGAA 1UNKA 5I4TG 1JJ2O 3DS1A 4XRQA 4PH1A 1YI2P 2L4BA 5KP6B 3CCQP 5CZDB 3CCVP 2M5RA 3CD6P 2EHSA 2M8NA 1IMPA 1A8OA 1VQ5P 1K9MQ 1YJWP 4H2XC 5F2NA 2FQ0A 2FVFA 2MD9A 1YJ9P 1EIAA 4QKOA 2FADA 1MZ8A 2VSQA 1IUQA 1KQSO 2BHVA 2PEQA 2GZGA 2JYLA 2CGQA 2QA4P 2N98A 2ERHA 4XROA 2LTEA 1Q81Q 3DS3A 2KOQA 2M8LA 3I55P 2GZEA 1RO2A 3DS4A 3G28A 1M74A 1Q7YQ 5EW5E 1YHQP 2N50A 3CC7P 2PEKA 3LRYA 5F2OA 3GZMA 3CC2P 3LMOA 2LKIA 1K30A 2CWOA 2L0QA 2K0XA 1E6JP 2VLQA 1DV5A 2K2QA 1ZMBA 2GZJA 2K94A 1IMQA 1OR5A 2KG6A 3B5IA 4XFZA 2KWLA 2JU2A 3RG2A 2VLPA 4F37A 2N5IA 1W2BO 1E0HA 3OW2O 2PENA 2FVAA 4CA3A 1M6EX 1F80D 4M0IA 1GPJA 1KC8Q 3CCLP 1VQNP 4U0CA 3CCRP 2JB0A 1VQ4P 4U0EA 5HV8A 1AYIA 2X2BA 4PXHB 3I56P 4BPFA 1RNIA 4UHPB 5HGMA 1N8RQ 1Z6MA 1YIJP 3G29A 4MRTC 2EIAA 3G4SP 2KR5A 2KGDA 1VQOP 1VQ9P 2PEJA 2Z46A 2ONTA 2L9FA 3G21A 1D1DA 1S72P 3CCSP 1QRJA 2XV6A 2LPKA 3GZLA 3CE7A 2KG9A 1VQMP 2AFEA 1KLPA 5JPAA 1M90Q 3HYBA 2AVAA 2AFDA 1VQ7P 3EJDA 2XZ1C 2VLNA 1HQBA 4NEOA 2FHSC 3B4QA 4GR6A 2CG5B 2MR7A 1ACPA 4HKGA 3DPHA 5HGLA 2PNGA 2KOSA 2K0YA 1A43A 2L22A 1NQ4A 1VQPP 2MR8A 2OTLP 2XZ0D 2GZIA 2N6ZA 3G6EP 1BAJA 3G1GA 2EG5A 2P9XA 1L0HA 2KOPA 2KG8A 1FR2A 2E1MA 3H0DA 3G1IA 4R0MA 2GDYA 4H2WC 3M1MA 3CMEP 2QNWA 2FQ1A 2QEXP 3U43A 2GYKA 4U0FA 4BPHA 3G0VA 2EHTA 1VQLP 4PWVB 3DS0A 3G71P 1DNYA 5BS2A 3DS2A 3NTEA 1VQ8P 3H4EA
chains in the Genus database with same CATH topology
1Q81Q 1S72P 3CCSP 1QRJA 2PY8A 2XV6A 3DS3A 3DTJA 3E2DA 2M8LA 3RG6C 3I55P 3VRLC 3Q20A 2PEIA 1RO2A 2M8PA 3DS4A 3G28A 1M74A 4XFXA 1Q7YQ 3G26A 1VQKP 2JYGA 1YHQP 1VQMP 3MGEA 3CC7P 2PEOA 2PEKA 5JPAA 1M90Q 3HYBA 4U0DA 3LRYA 5F2KA 2EFJA 5F2OA 3CC2P 1RO0A 1VQ7P 5HGOA 2OARA 3CCUP 1K30A 1K73Q 3CPWO 2CWOA 1QVFO 3WBHA 4U0BA 3CXCO 1E6JP 2BUOA 2LF4A 3P05A 3CCEP 1K8AQ 4U0AA 3CCMP 4GR6A 3H47A 3DS5A 1EOQA 1YJNP 2XT1A 1ZMBA 4IPYA 5DCKA 1QVGO 2DGYA 2PEMA 5HGNA 3DPHA 5HGLA 3HZQA 1NJIQ 1A43A 2KODA 3B5IA 3CCJP 1VQPP 4WYMA 4XFYA 4XFZA 2OTLP 1KD1Q 3CC4P 1VQ6P 5BS1A 1AUMA 5I4TG 3G6EP 1JJ2O 3DS1A 4XRQA 1W2BO 1BAJA 3G1GA 3OW2O 2EG5A 4PH1A 1YI2P 2OTJP 2P9XA 2PENA 3CCQP 3CCVP 1M6EX 3CD6P 2M8NA 1A8OA 4M0IA 1Q86Q 2E1MA 1VQ5P 1K9MQ 1M6NA 4XROA 4COPA 3H0DA 4COCA 1KC8Q 3G1IA 3CCLP 1VQNP 1YJWP 4U0CA 3CCRP 5F2NA 1VQ4P 3M1MA 3CMEP 4U0EA 1YITP 3I56P 2Z44A 4QNBA 1RNIA 2QEXP 1YJ9P 4GR2A 5HGMA 1N8RQ 1EIAA 3CMAP 1YIJP 3G29A 2L6EA 2EIAA 1Q82Q 4U0FA 1IUQA 3G4SP 1KQSO 2BHVA 3G0VA 2PEQA 1VQOP 1VQ9P 3DS0A 1VQLP 2PEJA 2XXMA 3G71P 2JYLA 2ONTA 2Z46A 5BS2A 3G21A 2QA4P 2Z45A 4PH0A 3DS2A 3NTEA 1VQ8P 1M1KQ 1D1DA 2JO0A 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q20 A;  2PEI A;  4GR2 A;  2PEO A;  2PEK A;  5BS2 A;  2PY8 A;  4GR6 A;  2PEQ A;  3HYB A;  2PEM A;  2Z45 A;  5BS1 A;  2Z44 A;  2PEJ A;  3RG6 C;  2PEN A;  2Z46 A; 
#chains in the Genus database with same CATH topology
 2ROQ A;  2WPT A;  2LL8 A;  3RG6 C;  3Q20 A;  2M8P A;  4XFX A;  3G26 A;  5HVC A;  2JYG A;  2FAE A;  5EJD A;  2PEO A;  2CQ8 A;  5F2K A;  1VHN A;  2LIU A;  2MY5 A;  1RO0 A;  3EJB A;  1UJZ A;  2OAR A;  2MVU A;  3CPW O;  2JQ4 A;  5KP7 B;  1QVF O;  3WBH A;  2AF8 A;  4U0B A;  1BXI A;  1VKU A;  1GXG A;  3GJN A;  1EOQ A;  1YJN P;  2XT1 A;  4IZ6 A;  2GZF A;  2VLO A;  2DGY A;  5HGN A;  2FAC A;  2JU1 A;  1NJI Q;  2KOD A;  3CCJ P;  2KGC A;  2LML A;  3CC4 P;  1VQ6 P;  5BS1 A;  2LOL A;  1AUM A;  1AF8 A;  2FVE A;  2CNR A;  2OTJ P;  2FQ2 A;  2MF4 A;  1Q86 Q;  1M6N A;  4COP A;  4COC A;  2KW2 A;  2K0D X;  7CEI A;  1YIT P;  4H2Y C;  2DNW A;  2Z44 A;  4QNB A;  3GKL C;  4GR2 A;  2LIW A;  3CMA P;  2L6E A;  1Q82 Q;  2XXM A;  5KP8 B;  2JAZ A;  2Z45 A;  4PH0 A;  1M1K Q;  1GXH A;  2JO0 A;  2NO8 A;  2PY8 A;  3DTJ A;  3E2D A;  1X3O A;  3VRL C;  2PEI A;  2K92 A;  2MVV A;  1VQK P;  3MGE A;  1EMV A;  2N6Y A;  3NY7 B;  4U0D A;  2EFJ A;  4DG9 A;  1T8K A;  4BPG A;  5HGO A;  3CCU P;  1K73 Q;  2JGP A;  3CXC O;  2K93 A;  2BUO A;  2LF4 A;  3P05 A;  2K5X A;  3CCE P;  1K8A Q;  4U0A A;  3CCM P;  2GDW A;  2KOO A;  1HY8 A;  2KGE A;  3H47 A;  3DS5 A;  2JBG A;  2N5H A;  4IPY A;  5DCK A;  1QVG O;  2PEM A;  2KOR A;  3HZQ A;  2GDX A;  1ZNV A;  1CEI A;  1L0I A;  4WYM A;  4XFY A;  3EJE A;  1KD1 Q;  2KGA A;  1UNK A;  5I4T G;  1JJ2 O;  3DS1 A;  4XRQ A;  4PH1 A;  1YI2 P;  2L4B A;  5KP6 B;  3CCQ P;  5CZD B;  3CCV P;  2M5R A;  3CD6 P;  2EHS A;  2M8N A;  1IMP A;  1A8O A;  1VQ5 P;  1K9M Q;  1YJW P;  4H2X C;  5F2N A;  2FQ0 A;  2FVF A;  2MD9 A;  1YJ9 P;  1EIA A;  4QKO A;  2FAD A;  1MZ8 A;  2VSQ A;  1IUQ A;  1KQS O;  2BHV A;  2PEQ A;  2GZG A;  2JYL A;  2CGQ A;  2QA4 P;  2N98 A;  2ERH A;  4XRO A;  2LTE A;  1Q81 Q;  3DS3 A;  2KOQ A;  2M8L A;  3I55 P;  2GZE A;  1RO2 A;  3DS4 A;  3G28 A;  1M74 A;  1Q7Y Q;  5EW5 E;  1YHQ P;  2N50 A;  3CC7 P;  2PEK A;  3LRY A;  5F2O A;  3GZM A;  3CC2 P;  3LMO A;  2LKI A;  1K30 A;  2CWO A;  2L0Q A;  2K0X A;  1E6J P;  2VLQ A;  1DV5 A;  2K2Q A;  1ZMB A;  2GZJ A;  2K94 A;  1IMQ A;  1OR5 A;  2KG6 A;  3B5I A;  4XFZ A;  2KWL A;  2JU2 A;  3RG2 A;  2VLP A;  4F37 A;  2N5I A;  1W2B O;  1E0H A;  3OW2 O;  2PEN A;  2FVA A;  4CA3 A;  1M6E X;  1F80 D;  4M0I A;  1GPJ A;  1KC8 Q;  3CCL P;  1VQN P;  4U0C A;  3CCR P;  2JB0 A;  1VQ4 P;  4U0E A;  5HV8 A;  1AYI A;  2X2B A;  4PXH B;  3I56 P;  4BPF A;  1RNI A;  4UHP B;  5HGM A;  1N8R Q;  1Z6M A;  1YIJ P;  3G29 A;  4MRT C;  2EIA A;  3G4S P;  2KR5 A;  2KGD A;  1VQO P;  1VQ9 P;  2PEJ A;  2Z46 A;  2ONT A;  2L9F A;  3G21 A;  1D1D A;  1S72 P;  3CCS P;  1QRJ A;  2XV6 A;  2LPK A;  3GZL A;  3CE7 A;  2KG9 A;  1VQM P;  2AFE A;  1KLP A;  5JPA A;  1M90 Q;  3HYB A;  2AVA A;  2AFD A;  1VQ7 P;  3EJD A;  2XZ1 C;  2VLN A;  1HQB A;  4NEO A;  2FHS C;  3B4Q A;  4GR6 A;  2CG5 B;  2MR7 A;  1ACP A;  4HKG A;  3DPH A;  5HGL A;  2PNG A;  2KOS A;  2K0Y A;  1A43 A;  2L22 A;  1NQ4 A;  1VQP P;  2MR8 A;  2OTL P;  2XZ0 D;  2GZI A;  2N6Z A;  3G6E P;  1BAJ A;  3G1G A;  2EG5 A;  2P9X A;  1L0H A;  2KOP A;  2KG8 A;  1FR2 A;  2E1M A;  3H0D A;  3G1I A;  4R0M A;  2GDY A;  4H2W C;  3M1M A;  3CME P;  2QNW A;  2FQ1 A;  2QEX P;  3U43 A;  2GYK A;  4U0F A;  4BPH A;  3G0V A;  2EHT A;  1VQL P;  4PWV B;  3DS0 A;  3G71 P;  1DNY A;  5BS2 A;  3DS2 A;  3NTE A;  1VQ8 P;  3H4E A; 
#chains in the Genus database with same CATH homology
 1Q81 Q;  1S72 P;  3CCS P;  1QRJ A;  2PY8 A;  2XV6 A;  3DS3 A;  3DTJ A;  3E2D A;  2M8L A;  3RG6 C;  3I55 P;  3VRL C;  3Q20 A;  2PEI A;  1RO2 A;  2M8P A;  3DS4 A;  3G28 A;  1M74 A;  4XFX A;  1Q7Y Q;  3G26 A;  1VQK P;  2JYG A;  1YHQ P;  1VQM P;  3MGE A;  3CC7 P;  2PEO A;  2PEK A;  5JPA A;  1M90 Q;  3HYB A;  4U0D A;  3LRY A;  5F2K A;  2EFJ A;  5F2O A;  3CC2 P;  1RO0 A;  1VQ7 P;  5HGO A;  2OAR A;  3CCU P;  1K30 A;  1K73 Q;  3CPW O;  2CWO A;  1QVF O;  3WBH A;  4U0B A;  3CXC O;  1E6J P;  2BUO A;  2LF4 A;  3P05 A;  3CCE P;  1K8A Q;  4U0A A;  3CCM P;  4GR6 A;  3H47 A;  3DS5 A;  1EOQ A;  1YJN P;  2XT1 A;  1ZMB A;  4IPY A;  5DCK A;  1QVG O;  2DGY A;  2PEM A;  5HGN A;  3DPH A;  5HGL A;  3HZQ A;  1NJI Q;  1A43 A;  2KOD A;  3B5I A;  3CCJ P;  1VQP P;  4WYM A;  4XFY A;  4XFZ A;  2OTL P;  1KD1 Q;  3CC4 P;  1VQ6 P;  5BS1 A;  1AUM A;  5I4T G;  3G6E P;  1JJ2 O;  3DS1 A;  4XRQ A;  1W2B O;  1BAJ A;  3G1G A;  3OW2 O;  2EG5 A;  4PH1 A;  1YI2 P;  2OTJ P;  2P9X A;  2PEN A;  3CCQ P;  3CCV P;  1M6E X;  3CD6 P;  2M8N A;  1A8O A;  4M0I A;  1Q86 Q;  2E1M A;  1VQ5 P;  1K9M Q;  1M6N A;  4XRO A;  4COP A;  3H0D A;  4COC A;  1KC8 Q;  3G1I A;  3CCL P;  1VQN P;  1YJW P;  4U0C A;  3CCR P;  5F2N A;  1VQ4 P;  3M1M A;  3CME P;  4U0E A;  1YIT P;  3I56 P;  2Z44 A;  4QNB A;  1RNI A;  2QEX P;  1YJ9 P;  4GR2 A;  5HGM A;  1N8R Q;  1EIA A;  3CMA P;  1YIJ P;  3G29 A;  2L6E A;  2EIA A;  1Q82 Q;  4U0F A;  1IUQ A;  3G4S P;  1KQS O;  2BHV A;  3G0V A;  2PEQ A;  1VQO P;  1VQ9 P;  3DS0 A;  1VQL P;  2PEJ A;  2XXM A;  3G71 P;  2JYL A;  2ONT A;  2Z46 A;  5BS2 A;  3G21 A;  2QA4 P;  2Z45 A;  4PH0 A;  3DS2 A;  3NTE A;  1VQ8 P;  1M1K Q;  1D1D A;  2JO0 A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...