4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P450 monooxygenase
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
4BPFA 2N6ZA 2CQ8A 2K92A 2L9FA 2JU2A 2FQ0A 2CNRA 2FAEA 2FQ1A 3EJEA 1HQBA 2KG6A 2AVAA 2XZ0D 2KGEA 2M5RA 3GZMA 1L0IA 2N50A 2KG8A 4BPHA 2K94A 1VKUA 2FACA 2KGCA 5KP8B 4IZ6A 2LIUA 3LMOA 3EJBA 3RG2A 4NEOA 2KGAA 2MR8A 2KR5A 2K93A 4BPGA 2AFEA 2CG5B 2CGQA 4HKGA 2FHSC 2MF4A 2ROQA 2QNWA 2MVUA 2FVEA 1KLPA 2KORA 1X3OA 4CA3A 2JU1A 2JQ4A 4PWVB 2FVAA 5HV8A 1F80D 2MVVA 2MR7A 1L0HA 5KP7B 2N6YA 2KOQA 2GDXA 2EHTA 3NY7B 2LKIA 2KOSA 5KP6B 4DG9A 2MY5A 4R0MA 2VSQA 1DV5A 2JGPA 2MD9A 2PNGA 2KOOA 2LOLA 2K0YA 2FQ2A 2KOPA 2GDWA 3EJDA 5EJDA 2KGDA 3CE7A 2XZ1C 2N98A 1T8KA 5CZDB 2LPKA 2N5IA 4PXHB 2N5HA 4H2XC 1ACPA 2EHSA 1DNYA 2KG9A 4H2YC 2LMLA 4MRTC 1OR5A 2K0XA 2GDYA 2AFDA 2DNWA 2K2QA 2FVFA 2KW2A 2LL8A 3GZLA 2LTEA 2AF8A 2L22A 2FADA 2L0QA 1NQ4A 5HVCA 2L4BA 1AF8A 2LIWA 4H2WC 2KWLA 1HY8A 2X2BA
chains in the Genus database with same CATH superfamily
1K30A 2GYKA 2N6ZA 1FR2A 1IMPA 3H0DA 4GR2A 4COPA 1YHQP 2KG6A 1YI2P 2XZ0D 2EIAA 2OTLP 2KG8A 3G26A 2KGCA 5KP8B 2EG5A 3CPWO 2QEXP 3EJBA 1GXHA 2VLPA 2VLQA 2Z44A 4F37A 4PH0A 2MR8A 2KR5A 3G0VA 4BPGA 3U43A 2QA4P 2PEOA 1KLPA 2OTJP 2JQ4A 3H4EA 5HV8A 2P9XA 1VQ7P 2DGYA 2N6YA 2KOQA 2EHTA 1Z6MA 2KOSA 4R0MA 1YJNP 1E0HA 2MD9A 3P05A 1W2BO 1VQ8P 2FQ2A 2KOPA 1A8OA 3EJDA 5EJDA 3CE7A 3WBHA 5F2KA 2PY8A 1E6JP 2WPTA 2M8LA 2JB0A 1M90Q 1VQLP 4PXHB 4H2XC 2KODA 3E2DA 2LMLA 3CC2P 4MRTC 1NJIQ 3CCEP 2GDYA 4UHPB 2DNWA 2FVFA 1VQMP 3MGEA 2LTEA 3CC7P 4IPYA 5HGLA 5HVCA 1EMVA 1Q86Q 3H47A 4BPFA 2CQ8A 1IUQA 2FQ1A 3EJEA 3G29A 1Q82Q 3DPHA 2L6EA 1L0IA 2N50A 2XXMA 2GZFA 1YITP 1VQPP 3G21A 4IZ6A 2LIUA 2KGAA 4QKOA 3I56P 2AFEA 1MZ8A 2NO8A 2CG5B 2ROQA 5EW5E 2MVUA 2ONTA 1X3OA 4COCA 3G28A 4CA3A 2JU1A 1M74A 4PWVB 1KD1Q 3CD6P 1VQ4P 4XRQA 1F80D 2MVVA 3VRLC 3CCJP 5F2OA 2LKIA 4DG9A 2PEQA 2JGPA 2LOLA 2PENA 2BUOA 4U0EA 2CWOA 2VLNA 3DS5A 2XZ1C 2XV6A 1ZNVA 2N98A 2PEMA 3CC4P 2N5IA 5HGOA 2OARA 1VQOP 1GPJA 2JAZA 4WYMA 2JBGA 1GXGA 2Z45A 2K0XA 1RO0A 2AFDA 3I55P 1IMQA 3CCRP 3HZQA 2PEKA 1VQ5P 3OW2O 2KW2A 3G4SP 3GZLA 2L22A 2FADA 2L0QA 2JYLA 4U0AA 2K5XA 2ERHA 1EIAA 7CEIA 2L4BA 1M1KQ 2GZJA 2X2BA 3DS3A 3GKLC 2K92A 1HQBA 2AVAA 2M5RA 3GZMA 2JYGA 2GZIA 1YJWP 2K94A 1VKUA 5JPAA 3CCVP 2PEIA 3CCMP 3LMOA 3GJNA 1VQ9P 1KQSO 2K93A 2CGQA 4HKGA 3CMEP 2MF4A 2QNWA 4XFYA 5I4TG 2K0DX 4PH1A 5HGNA 3B4QA 4GR6A 4XROA 2M8NA 4XFXA 1M6NA 3Q20A 1L0HA 3DS0A 3G1GA 2GDXA 3DS2A 2MY5A 1D1DA 2VSQA 2PEJA 2PNGA 2XT1A 2KOOA 2K0YA 1Q81Q 1QVGO 2GZEA 3DS1A 1BXIA 1VQ6P 4H2YC 1BAJA 1UJZA 3G71P 5BS1A 5DCKA 4U0DA 2EFJA 1S72P 2AF8A 3CCSP 2VLOA 1NQ4A 2LIWA 3G6EP 2LF4A 2KWLA 3B5IA 1CEIA 3RG6C 1AYIA 1KC8Q 5HGMA 2L9FA 2JU2A 2FQ0A 3M1MA 2CNRA 2FAEA 4XFZA 1K8AQ 2KGEA 4BPHA 1YJ9P 2FACA 3G1IA 2Z46A 1EOQA 2M8PA 1VHNA 3RG2A 1JJ2O 3DS4A 4U0CA 4NEOA 3CCQP 1VQKP 1AUMA 1VQNP 1M6EX 4U0FA 2FHSC 2FVEA 2KORA 3CXCO 3LRYA 3NTEA 2FVAA 2MR7A 5KP7B 3NY7B 1ZMBA 1RNIA 5KP6B 1DV5A 3CCLP 3HYBA 4QNBA 2GDWA 1QVFO 2KGDA 2E1MA 1RO2A 1T8KA 5CZDB 2LPKA 4M0IA 5BS2A 2N5HA 2JO0A 1K73Q 1ACPA 2EHSA 1DNYA 2KG9A 3CCUP 1Q7YQ 3DTJA 1OR5A 2BHVA 1UNKA 1YIJP 3CMAP 1K9MQ 2K2QA 2LL8A 1N8RQ 4U0BA 1A43A 1QRJA 2GZGA 1AF8A 4H2WC 5F2NA 1HY8A
chains in the Genus database with same CATH topology
4BPFA 2N6ZA 2CQ8A 2K92A 2L9FA 2JU2A 2FQ0A 2CNRA 2FAEA 2FQ1A 3EJEA 1HQBA 2KG6A 2AVAA 2XZ0D 2KGEA 2M5RA 3GZMA 1L0IA 2N50A 2KG8A 4BPHA 2K94A 1VKUA 2FACA 2KGCA 5KP8B 4IZ6A 2LIUA 3LMOA 3EJBA 3RG2A 4NEOA 2KGAA 2MR8A 2KR5A 2K93A 4BPGA 2AFEA 2CG5B 2CGQA 4HKGA 2FHSC 2MF4A 2ROQA 2QNWA 2MVUA 2FVEA 1KLPA 2KORA 1X3OA 4CA3A 2JU1A 2JQ4A 4PWVB 2FVAA 5HV8A 1F80D 2MVVA 2MR7A 1L0HA 5KP7B 2N6YA 2KOQA 2GDXA 2EHTA 3NY7B 2LKIA 2KOSA 5KP6B 4DG9A 2MY5A 4R0MA 2VSQA 1DV5A 2JGPA 2MD9A 2PNGA 2KOOA 2LOLA 2K0YA 2FQ2A 2KOPA 2GDWA 3EJDA 5EJDA 2KGDA 3CE7A 2XZ1C 2N98A 1T8KA 5CZDB 2LPKA 2N5IA 4PXHB 2N5HA 4H2XC 1ACPA 2EHSA 1DNYA 2KG9A 4H2YC 2LMLA 4MRTC 1OR5A 2K0XA 2GDYA 2AFDA 2DNWA 2K2QA 2FVFA 2KW2A 2LL8A 3GZLA 2LTEA 2AF8A 2L22A 2FADA 2L0QA 1NQ4A 5HVCA 2L4BA 1AF8A 2LIWA 4H2WC 2KWLA 1HY8A 2X2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPF A;  2N6Z A;  2CQ8 A;  2K92 A;  2L9F A;  2JU2 A;  2FQ0 A;  2CNR A;  2FAE A;  2FQ1 A;  3EJE A;  1HQB A;  2KG6 A;  2AVA A;  2XZ0 D;  2KGE A;  2M5R A;  3GZM A;  1L0I A;  2N50 A;  2KG8 A;  4BPH A;  2K94 A;  1VKU A;  2FAC A;  2KGC A;  5KP8 B;  4IZ6 A;  2LIU A;  3LMO A;  3EJB A;  3RG2 A;  4NEO A;  2KGA A;  2MR8 A;  2KR5 A;  2K93 A;  4BPG A;  2AFE A;  2CG5 B;  2CGQ A;  4HKG A;  2FHS C;  2MF4 A;  2ROQ A;  2QNW A;  2MVU A;  2FVE A;  1KLP A;  2KOR A;  1X3O A;  4CA3 A;  2JU1 A;  2JQ4 A;  4PWV B;  2FVA A;  5HV8 A;  1F80 D;  2MVV A;  2MR7 A;  1L0H A;  5KP7 B;  2N6Y A;  2KOQ A;  2GDX A;  2EHT A;  3NY7 B;  2LKI A;  2KOS A;  5KP6 B;  4DG9 A;  2MY5 A;  4R0M A;  2VSQ A;  1DV5 A;  2JGP A;  2MD9 A;  2PNG A;  2KOO A;  2LOL A;  2K0Y A;  2FQ2 A;  2KOP A;  2GDW A;  3EJD A;  5EJD A;  2KGD A;  3CE7 A;  2XZ1 C;  2N98 A;  1T8K A;  5CZD B;  2LPK A;  2N5I A;  4PXH B;  2N5H A;  4H2X C;  1ACP A;  2EHS A;  1DNY A;  2KG9 A;  4H2Y C;  2LML A;  4MRT C;  1OR5 A;  2K0X A;  2GDY A;  2AFD A;  2DNW A;  2K2Q A;  2FVF A;  2KW2 A;  2LL8 A;  3GZL A;  2LTE A;  2AF8 A;  2L22 A;  2FAD A;  2L0Q A;  1NQ4 A;  5HVC A;  2L4B A;  1AF8 A;  2LIW A;  4H2W C;  2KWL A;  1HY8 A;  2X2B A; 
#chains in the Genus database with same CATH topology
 1K30 A;  2GYK A;  2N6Z A;  1FR2 A;  1IMP A;  3H0D A;  4GR2 A;  4COP A;  1YHQ P;  2KG6 A;  1YI2 P;  2XZ0 D;  2EIA A;  2OTL P;  2KG8 A;  3G26 A;  2KGC A;  5KP8 B;  2EG5 A;  3CPW O;  2QEX P;  3EJB A;  1GXH A;  2VLP A;  2VLQ A;  2Z44 A;  4F37 A;  4PH0 A;  2MR8 A;  2KR5 A;  3G0V A;  4BPG A;  3U43 A;  2QA4 P;  2PEO A;  1KLP A;  2OTJ P;  2JQ4 A;  3H4E A;  5HV8 A;  2P9X A;  1VQ7 P;  2DGY A;  2N6Y A;  2KOQ A;  2EHT A;  1Z6M A;  2KOS A;  4R0M A;  1YJN P;  1E0H A;  2MD9 A;  3P05 A;  1W2B O;  1VQ8 P;  2FQ2 A;  2KOP A;  1A8O A;  3EJD A;  5EJD A;  3CE7 A;  3WBH A;  5F2K A;  2PY8 A;  1E6J P;  2WPT A;  2M8L A;  2JB0 A;  1M90 Q;  1VQL P;  4PXH B;  4H2X C;  2KOD A;  3E2D A;  2LML A;  3CC2 P;  4MRT C;  1NJI Q;  3CCE P;  2GDY A;  4UHP B;  2DNW A;  2FVF A;  1VQM P;  3MGE A;  2LTE A;  3CC7 P;  4IPY A;  5HGL A;  5HVC A;  1EMV A;  1Q86 Q;  3H47 A;  4BPF A;  2CQ8 A;  1IUQ A;  2FQ1 A;  3EJE A;  3G29 A;  1Q82 Q;  3DPH A;  2L6E A;  1L0I A;  2N50 A;  2XXM A;  2GZF A;  1YIT P;  1VQP P;  3G21 A;  4IZ6 A;  2LIU A;  2KGA A;  4QKO A;  3I56 P;  2AFE A;  1MZ8 A;  2NO8 A;  2CG5 B;  2ROQ A;  5EW5 E;  2MVU A;  2ONT A;  1X3O A;  4COC A;  3G28 A;  4CA3 A;  2JU1 A;  1M74 A;  4PWV B;  1KD1 Q;  3CD6 P;  1VQ4 P;  4XRQ A;  1F80 D;  2MVV A;  3VRL C;  3CCJ P;  5F2O A;  2LKI A;  4DG9 A;  2PEQ A;  2JGP A;  2LOL A;  2PEN A;  2BUO A;  4U0E A;  2CWO A;  2VLN A;  3DS5 A;  2XZ1 C;  2XV6 A;  1ZNV A;  2N98 A;  2PEM A;  3CC4 P;  2N5I A;  5HGO A;  2OAR A;  1VQO P;  1GPJ A;  2JAZ A;  4WYM A;  2JBG A;  1GXG A;  2Z45 A;  2K0X A;  1RO0 A;  2AFD A;  3I55 P;  1IMQ A;  3CCR P;  3HZQ A;  2PEK A;  1VQ5 P;  3OW2 O;  2KW2 A;  3G4S P;  3GZL A;  2L22 A;  2FAD A;  2L0Q A;  2JYL A;  4U0A A;  2K5X A;  2ERH A;  1EIA A;  7CEI A;  2L4B A;  1M1K Q;  2GZJ A;  2X2B A;  3DS3 A;  3GKL C;  2K92 A;  1HQB A;  2AVA A;  2M5R A;  3GZM A;  2JYG A;  2GZI A;  1YJW P;  2K94 A;  1VKU A;  5JPA A;  3CCV P;  2PEI A;  3CCM P;  3LMO A;  3GJN A;  1VQ9 P;  1KQS O;  2K93 A;  2CGQ A;  4HKG A;  3CME P;  2MF4 A;  2QNW A;  4XFY A;  5I4T G;  2K0D X;  4PH1 A;  5HGN A;  3B4Q A;  4GR6 A;  4XRO A;  2M8N A;  4XFX A;  1M6N A;  3Q20 A;  1L0H A;  3DS0 A;  3G1G A;  2GDX A;  3DS2 A;  2MY5 A;  1D1D A;  2VSQ A;  2PEJ A;  2PNG A;  2XT1 A;  2KOO A;  2K0Y A;  1Q81 Q;  1QVG O;  2GZE A;  3DS1 A;  1BXI A;  1VQ6 P;  4H2Y C;  1BAJ A;  1UJZ A;  3G71 P;  5BS1 A;  5DCK A;  4U0D A;  2EFJ A;  1S72 P;  2AF8 A;  3CCS P;  2VLO A;  1NQ4 A;  2LIW A;  3G6E P;  2LF4 A;  2KWL A;  3B5I A;  1CEI A;  3RG6 C;  1AYI A;  1KC8 Q;  5HGM A;  2L9F A;  2JU2 A;  2FQ0 A;  3M1M A;  2CNR A;  2FAE A;  4XFZ A;  1K8A Q;  2KGE A;  4BPH A;  1YJ9 P;  2FAC A;  3G1I A;  2Z46 A;  1EOQ A;  2M8P A;  1VHN A;  3RG2 A;  1JJ2 O;  3DS4 A;  4U0C A;  4NEO A;  3CCQ P;  1VQK P;  1AUM A;  1VQN P;  1M6E X;  4U0F A;  2FHS C;  2FVE A;  2KOR A;  3CXC O;  3LRY A;  3NTE A;  2FVA A;  2MR7 A;  5KP7 B;  3NY7 B;  1ZMB A;  1RNI A;  5KP6 B;  1DV5 A;  3CCL P;  3HYB A;  4QNB A;  2GDW A;  1QVF O;  2KGD A;  2E1M A;  1RO2 A;  1T8K A;  5CZD B;  2LPK A;  4M0I A;  5BS2 A;  2N5H A;  2JO0 A;  1K73 Q;  1ACP A;  2EHS A;  1DNY A;  2KG9 A;  3CCU P;  1Q7Y Q;  3DTJ A;  1OR5 A;  2BHV A;  1UNK A;  1YIJ P;  3CMA P;  1K9M Q;  2K2Q A;  2LL8 A;  1N8R Q;  4U0B A;  1A43 A;  1QRJ A;  2GZG A;  1AF8 A;  4H2W C;  5F2N A;  1HY8 A; 
#chains in the Genus database with same CATH homology
 4BPF A;  2N6Z A;  2CQ8 A;  2K92 A;  2L9F A;  2JU2 A;  2FQ0 A;  2CNR A;  2FAE A;  2FQ1 A;  3EJE A;  1HQB A;  2KG6 A;  2AVA A;  2XZ0 D;  2KGE A;  2M5R A;  3GZM A;  1L0I A;  2N50 A;  2KG8 A;  4BPH A;  2K94 A;  1VKU A;  2FAC A;  2KGC A;  5KP8 B;  4IZ6 A;  2LIU A;  3LMO A;  3EJB A;  3RG2 A;  4NEO A;  2KGA A;  2MR8 A;  2KR5 A;  2K93 A;  4BPG A;  2AFE A;  2CG5 B;  2CGQ A;  4HKG A;  2FHS C;  2MF4 A;  2ROQ A;  2QNW A;  2MVU A;  2FVE A;  1KLP A;  2KOR A;  1X3O A;  4CA3 A;  2JU1 A;  2JQ4 A;  4PWV B;  2FVA A;  5HV8 A;  1F80 D;  2MVV A;  2MR7 A;  1L0H A;  5KP7 B;  2N6Y A;  2KOQ A;  2GDX A;  2EHT A;  3NY7 B;  2LKI A;  2KOS A;  5KP6 B;  4DG9 A;  2MY5 A;  4R0M A;  2VSQ A;  1DV5 A;  2JGP A;  2MD9 A;  2PNG A;  2KOO A;  2LOL A;  2K0Y A;  2FQ2 A;  2KOP A;  2GDW A;  3EJD A;  5EJD A;  2KGD A;  3CE7 A;  2XZ1 C;  2N98 A;  1T8K A;  5CZD B;  2LPK A;  2N5I A;  4PXH B;  2N5H A;  4H2X C;  1ACP A;  2EHS A;  1DNY A;  2KG9 A;  4H2Y C;  2LML A;  4MRT C;  1OR5 A;  2K0X A;  2GDY A;  2AFD A;  2DNW A;  2K2Q A;  2FVF A;  2KW2 A;  2LL8 A;  3GZL A;  2LTE A;  2AF8 A;  2L22 A;  2FAD A;  2L0Q A;  1NQ4 A;  5HVC A;  2L4B A;  1AF8 A;  2LIW A;  4H2W C;  2KWL A;  1HY8 A;  2X2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...