4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
molecule keywords P450 monooxygenase
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
2KR5A 2KGEA 2AFDA 3GZMA 2N5IA 1X3OA 3EJBA 4BPGA 2AVAA 2FQ1A 2MD9A 2GDYA 2K94A 1NQ4A 3CE7A 2VSQA 2L0QA 2KGDA 1KLPA 2K93A 2M5RA 2KOQA 2N98A 2JU1A 1HQBA 1VKUA 2KW2A 3EJDA 1T8KA 2AFEA 2EHSA 4BPHA 2CGQA 1DNYA 2QNWA 2K92A 1F80D 4PWVB 2K0XA 2FACA 2MR7A 2KG8A 2FVFA 2FQ0A 2L22A 4NEOA 1AF8A 2KG6A 2LIUA 4H2XC 1ACPA 2LMLA 2FVEA 2JGPA 2KGAA 2KOOA 3LMOA 2PNGA 4IZ6A 2JU2A 2GDWA 2FQ2A 2XZ0D 2CNRA 2K0YA 2MF4A 4MRTC 2KOSA 1L0IA 2L9FA 4BPFA 2CQ8A 5KP6B 5KP8B 2FADA 2JQ4A 2K2QA 2KOPA 2CG5B 2FVAA 2LIWA 2KGCA 2KWLA 2N50A 4R0MA 2LL8A 2FHSC 2X2BA 4H2WC 1L0HA 2N5HA 2L4BA 2ROQA 5KP7B 2LPKA 5HV8A 5CZDB 2KORA 2MVVA 3RG2A 2N6YA 2AF8A 2MR8A 2FAEA 2GDXA 2XZ1C 2LTEA 2KG9A 4CA3A 2MY5A 4H2YC 5HVCA 4DG9A 3EJEA 1OR5A 2LOLA 5EJDA 3GZLA 2DNWA 1HY8A 3NY7B 2MVUA 1DV5A 2EHTA 2LKIA 2N6ZA 4HKGA 4PXHB
chains in the Genus database with same CATH superfamily
5JPAA 1M6EX 3G6EP 4M0IA 1M90Q 3U43A 1VQ7P 2N5IA 1VQ9P 1X3OA 3DS2A 4BPGA 4QNBA 2OARA 2EIAA 2VSQA 1MZ8A 2KGDA 1FR2A 2JYLA 1Q7YQ 3B4QA 2KW2A 3CCLP 1ZMBA 2K92A 2GZEA 2FACA 2MR7A 2QEXP 3CCUP 2FQ0A 2KG6A 2LIUA 1YI2P 1KQSO 1JJ2O 3CC4P 2JGPA 4U0BA 3CMAP 1Z6MA 2FQ2A 2KOSA 3DS4A 3MGEA 4BPFA 2CQ8A 2ERHA 5KP6B 1EOQA 4PH1A 2KOPA 2CG5B 2FVAA 2KGCA 1YITP 2VLPA 1K30A 4R0MA 2Z44A 2X2BA 2PEIA 2BUOA 2N5HA 2M8LA 2WPTA 3VRLC 3HYBA 1EIAA 5HV8A 5CZDB 2MVVA 2JYGA 4U0DA 1AUMA 2MR8A 1QRJA 2GYKA 4DG9A 1NJIQ 4COCA 1UJZA 2DNWA 3G0VA 2BHVA 2LKIA 1EMVA 4PXHB 1RNIA 4U0FA 2AFDA 2L6EA 1M6NA 3CC7P 4GR6A 1Q81Q 1VQOP 1VQ6P 1NQ4A 3CE7A 1HQBA 1QVGO 1VKUA 1K73Q 3CCJP 2AFEA 4BPHA 5HGOA 2QNWA 1RO0A 5F2OA 1BAJA 5BS2A 3G28A 1BXIA 1YHQP 2L22A 3P05A 4XRQA 4H2XC 2LMLA 2VLQA 2FVEA 2GZIA 3GJNA 4U0EA 2KGAA 2XT1A 2PNGA 2PEOA 2GZJA 4GR2A 4IZ6A 2CNRA 2MF4A 1L0IA 3GKLC 2M8PA 1Q82Q 5F2NA 3DTJA 5KP8B 2K2QA 2XXMA 3CMEP 1VQNP 2Z46A 5F2KA 2N50A 1D1DA 2LL8A 1YJNP 1L0HA 4WYMA 2L4BA 2ROQA 2VLOA 2GZGA 5KP7B 5BS1A 4UHPB 2N6YA 2VLNA 3RG6C 2GDXA 2LTEA 2CWOA 2MY5A 3EJEA 5EJDA 3GZLA 3CCEP 1HY8A 2PEQA 2K0DX 2MVUA 3B5IA 3DS0A 5HGMA 2EHTA 4HKGA 1RO2A 2KR5A 2PEJA 2JB0A 3DS3A 2OTLP 3EJBA 3I55P 3DS5A 2AVAA 1YIJP 2FQ1A 1K9MQ 2GDYA 2K94A 2DGYA 5DCKA 2L0QA 2K93A 1GPJA 2KOQA 2XV6A 1T8KA 3G4SP 1DNYA 2CGQA 2JAZA 4IPYA 1F80D 4PWVB 2K0XA 1VQKP 2JBGA 2KG8A 2FVFA 4NEOA 1VQMP 1ACPA 2Z45A 3WBHA 3NTEA 1GXHA 1YJWP 2KODA 3CPWO 3G71P 3M1MA 2K5XA 4U0CA 1KD1Q 2K0YA 2NO8A 4XFXA 2JO0A 4COPA 1CEIA 3DPHA 2PY8A 1IUQA 1A43A 2M8NA 2FADA 3H0DA 2E1MA 3I56P 2KWLA 1M74A 2PEKA 4H2WC 3H47A 1A8OA 4U0AA 2KORA 3H4EA 4QKOA 2AF8A 1VQ4P 2FAEA 1IMPA 3CCSP 2EFJA 1QVFO 1K8AQ 4CA3A 4H2YC 2EG5A 3CC2P 1OR5A 3Q20A 3NY7B 1DV5A 3GZMA 1VQPP 2KGEA 1E6JP 3G1GA 2MD9A 1KLPA 2M5RA 2N98A 2JU1A 3EJDA 2EHSA 3DS1A 4F37A 1M1KQ 3G21A 3CCQP 2GZFA 5EW5E 2LF4A 3G26A 1AYIA 1AF8A 3OW2O 1KC8Q 1N8RQ 2KOOA 3LMOA 7CEIA 3CD6P 4XFZA 1W2BO 2JU2A 1VQ8P 2GDWA 2XZ0D 4MRTC 4PH0A 2L9FA 3CCRP 1YJ9P 1E0HA 2OTJP 3CCVP 5I4TG 1S72P 3CXCO 2JQ4A 3LRYA 2LIWA 1VQLP 1GXGA 2P9XA 2QA4P 2PENA 1ZNVA 4XROA 2FHSC 5HGNA 2ONTA 4XFYA 2PEMA 1IMQA 3E2DA 2LPKA 5HGLA 1Q86Q 3HZQA 3RG2A 2XZ1C 3G1IA 2KG9A 1VHNA 5HVCA 2LOLA 3G29A 3CCMP 1VQ5P 1UNKA 2N6ZA
chains in the Genus database with same CATH topology
2KR5A 2KGEA 2AFDA 3GZMA 2N5IA 1X3OA 3EJBA 4BPGA 2AVAA 2FQ1A 2MD9A 2GDYA 2K94A 1NQ4A 3CE7A 2VSQA 2L0QA 2KGDA 1KLPA 2K93A 2M5RA 2KOQA 2N98A 2JU1A 1HQBA 1VKUA 2KW2A 3EJDA 1T8KA 2AFEA 2EHSA 4BPHA 2CGQA 1DNYA 2QNWA 2K92A 1F80D 4PWVB 2K0XA 2FACA 2MR7A 2KG8A 2FVFA 2FQ0A 2L22A 4NEOA 1AF8A 2KG6A 2LIUA 4H2XC 1ACPA 2LMLA 2FVEA 2JGPA 2KGAA 2KOOA 3LMOA 2PNGA 4IZ6A 2JU2A 2GDWA 2FQ2A 2XZ0D 2CNRA 2K0YA 2MF4A 4MRTC 2KOSA 1L0IA 2L9FA 4BPFA 2CQ8A 5KP6B 5KP8B 2FADA 2JQ4A 2K2QA 2KOPA 2CG5B 2FVAA 2LIWA 2KGCA 2KWLA 2N50A 4R0MA 2LL8A 2FHSC 2X2BA 4H2WC 1L0HA 2N5HA 2L4BA 2ROQA 5KP7B 2LPKA 5HV8A 5CZDB 2KORA 2MVVA 3RG2A 2N6YA 2AF8A 2MR8A 2FAEA 2GDXA 2XZ1C 2LTEA 2KG9A 4CA3A 2MY5A 4H2YC 5HVCA 4DG9A 3EJEA 1OR5A 2LOLA 5EJDA 3GZLA 2DNWA 1HY8A 3NY7B 2MVUA 1DV5A 2EHTA 2LKIA 2N6ZA 4HKGA 4PXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR5 A;  2KGE A;  2AFD A;  3GZM A;  2N5I A;  1X3O A;  3EJB A;  4BPG A;  2AVA A;  2FQ1 A;  2MD9 A;  2GDY A;  2K94 A;  1NQ4 A;  3CE7 A;  2VSQ A;  2L0Q A;  2KGD A;  1KLP A;  2K93 A;  2M5R A;  2KOQ A;  2N98 A;  2JU1 A;  1HQB A;  1VKU A;  2KW2 A;  3EJD A;  1T8K A;  2AFE A;  2EHS A;  4BPH A;  2CGQ A;  1DNY A;  2QNW A;  2K92 A;  1F80 D;  4PWV B;  2K0X A;  2FAC A;  2MR7 A;  2KG8 A;  2FVF A;  2FQ0 A;  2L22 A;  4NEO A;  1AF8 A;  2KG6 A;  2LIU A;  4H2X C;  1ACP A;  2LML A;  2FVE A;  2JGP A;  2KGA A;  2KOO A;  3LMO A;  2PNG A;  4IZ6 A;  2JU2 A;  2GDW A;  2FQ2 A;  2XZ0 D;  2CNR A;  2K0Y A;  2MF4 A;  4MRT C;  2KOS A;  1L0I A;  2L9F A;  4BPF A;  2CQ8 A;  5KP6 B;  5KP8 B;  2FAD A;  2JQ4 A;  2K2Q A;  2KOP A;  2CG5 B;  2FVA A;  2LIW A;  2KGC A;  2KWL A;  2N50 A;  4R0M A;  2LL8 A;  2FHS C;  2X2B A;  4H2W C;  1L0H A;  2N5H A;  2L4B A;  2ROQ A;  5KP7 B;  2LPK A;  5HV8 A;  5CZD B;  2KOR A;  2MVV A;  3RG2 A;  2N6Y A;  2AF8 A;  2MR8 A;  2FAE A;  2GDX A;  2XZ1 C;  2LTE A;  2KG9 A;  4CA3 A;  2MY5 A;  4H2Y C;  5HVC A;  4DG9 A;  3EJE A;  1OR5 A;  2LOL A;  5EJD A;  3GZL A;  2DNW A;  1HY8 A;  3NY7 B;  2MVU A;  1DV5 A;  2EHT A;  2LKI A;  2N6Z A;  4HKG A;  4PXH B; 
#chains in the Genus database with same CATH topology
 5JPA A;  1M6E X;  3G6E P;  4M0I A;  1M90 Q;  3U43 A;  1VQ7 P;  2N5I A;  1VQ9 P;  1X3O A;  3DS2 A;  4BPG A;  4QNB A;  2OAR A;  2EIA A;  2VSQ A;  1MZ8 A;  2KGD A;  1FR2 A;  2JYL A;  1Q7Y Q;  3B4Q A;  2KW2 A;  3CCL P;  1ZMB A;  2K92 A;  2GZE A;  2FAC A;  2MR7 A;  2QEX P;  3CCU P;  2FQ0 A;  2KG6 A;  2LIU A;  1YI2 P;  1KQS O;  1JJ2 O;  3CC4 P;  2JGP A;  4U0B A;  3CMA P;  1Z6M A;  2FQ2 A;  2KOS A;  3DS4 A;  3MGE A;  4BPF A;  2CQ8 A;  2ERH A;  5KP6 B;  1EOQ A;  4PH1 A;  2KOP A;  2CG5 B;  2FVA A;  2KGC A;  1YIT P;  2VLP A;  1K30 A;  4R0M A;  2Z44 A;  2X2B A;  2PEI A;  2BUO A;  2N5H A;  2M8L A;  2WPT A;  3VRL C;  3HYB A;  1EIA A;  5HV8 A;  5CZD B;  2MVV A;  2JYG A;  4U0D A;  1AUM A;  2MR8 A;  1QRJ A;  2GYK A;  4DG9 A;  1NJI Q;  4COC A;  1UJZ A;  2DNW A;  3G0V A;  2BHV A;  2LKI A;  1EMV A;  4PXH B;  1RNI A;  4U0F A;  2AFD A;  2L6E A;  1M6N A;  3CC7 P;  4GR6 A;  1Q81 Q;  1VQO P;  1VQ6 P;  1NQ4 A;  3CE7 A;  1HQB A;  1QVG O;  1VKU A;  1K73 Q;  3CCJ P;  2AFE A;  4BPH A;  5HGO A;  2QNW A;  1RO0 A;  5F2O A;  1BAJ A;  5BS2 A;  3G28 A;  1BXI A;  1YHQ P;  2L22 A;  3P05 A;  4XRQ A;  4H2X C;  2LML A;  2VLQ A;  2FVE A;  2GZI A;  3GJN A;  4U0E A;  2KGA A;  2XT1 A;  2PNG A;  2PEO A;  2GZJ A;  4GR2 A;  4IZ6 A;  2CNR A;  2MF4 A;  1L0I A;  3GKL C;  2M8P A;  1Q82 Q;  5F2N A;  3DTJ A;  5KP8 B;  2K2Q A;  2XXM A;  3CME P;  1VQN P;  2Z46 A;  5F2K A;  2N50 A;  1D1D A;  2LL8 A;  1YJN P;  1L0H A;  4WYM A;  2L4B A;  2ROQ A;  2VLO A;  2GZG A;  5KP7 B;  5BS1 A;  4UHP B;  2N6Y A;  2VLN A;  3RG6 C;  2GDX A;  2LTE A;  2CWO A;  2MY5 A;  3EJE A;  5EJD A;  3GZL A;  3CCE P;  1HY8 A;  2PEQ A;  2K0D X;  2MVU A;  3B5I A;  3DS0 A;  5HGM A;  2EHT A;  4HKG A;  1RO2 A;  2KR5 A;  2PEJ A;  2JB0 A;  3DS3 A;  2OTL P;  3EJB A;  3I55 P;  3DS5 A;  2AVA A;  1YIJ P;  2FQ1 A;  1K9M Q;  2GDY A;  2K94 A;  2DGY A;  5DCK A;  2L0Q A;  2K93 A;  1GPJ A;  2KOQ A;  2XV6 A;  1T8K A;  3G4S P;  1DNY A;  2CGQ A;  2JAZ A;  4IPY A;  1F80 D;  4PWV B;  2K0X A;  1VQK P;  2JBG A;  2KG8 A;  2FVF A;  4NEO A;  1VQM P;  1ACP A;  2Z45 A;  3WBH A;  3NTE A;  1GXH A;  1YJW P;  2KOD A;  3CPW O;  3G71 P;  3M1M A;  2K5X A;  4U0C A;  1KD1 Q;  2K0Y A;  2NO8 A;  4XFX A;  2JO0 A;  4COP A;  1CEI A;  3DPH A;  2PY8 A;  1IUQ A;  1A43 A;  2M8N A;  2FAD A;  3H0D A;  2E1M A;  3I56 P;  2KWL A;  1M74 A;  2PEK A;  4H2W C;  3H47 A;  1A8O A;  4U0A A;  2KOR A;  3H4E A;  4QKO A;  2AF8 A;  1VQ4 P;  2FAE A;  1IMP A;  3CCS P;  2EFJ A;  1QVF O;  1K8A Q;  4CA3 A;  4H2Y C;  2EG5 A;  3CC2 P;  1OR5 A;  3Q20 A;  3NY7 B;  1DV5 A;  3GZM A;  1VQP P;  2KGE A;  1E6J P;  3G1G A;  2MD9 A;  1KLP A;  2M5R A;  2N98 A;  2JU1 A;  3EJD A;  2EHS A;  3DS1 A;  4F37 A;  1M1K Q;  3G21 A;  3CCQ P;  2GZF A;  5EW5 E;  2LF4 A;  3G26 A;  1AYI A;  1AF8 A;  3OW2 O;  1KC8 Q;  1N8R Q;  2KOO A;  3LMO A;  7CEI A;  3CD6 P;  4XFZ A;  1W2B O;  2JU2 A;  1VQ8 P;  2GDW A;  2XZ0 D;  4MRT C;  4PH0 A;  2L9F A;  3CCR P;  1YJ9 P;  1E0H A;  2OTJ P;  3CCV P;  5I4T G;  1S72 P;  3CXC O;  2JQ4 A;  3LRY A;  2LIW A;  1VQL P;  1GXG A;  2P9X A;  2QA4 P;  2PEN A;  1ZNV A;  4XRO A;  2FHS C;  5HGN A;  2ONT A;  4XFY A;  2PEM A;  1IMQ A;  3E2D A;  2LPK A;  5HGL A;  1Q86 Q;  3HZQ A;  3RG2 A;  2XZ1 C;  3G1I A;  2KG9 A;  1VHN A;  5HVC A;  2LOL A;  3G29 A;  3CCM P;  1VQ5 P;  1UNK A;  2N6Z A; 
#chains in the Genus database with same CATH homology
 2KR5 A;  2KGE A;  2AFD A;  3GZM A;  2N5I A;  1X3O A;  3EJB A;  4BPG A;  2AVA A;  2FQ1 A;  2MD9 A;  2GDY A;  2K94 A;  1NQ4 A;  3CE7 A;  2VSQ A;  2L0Q A;  2KGD A;  1KLP A;  2K93 A;  2M5R A;  2KOQ A;  2N98 A;  2JU1 A;  1HQB A;  1VKU A;  2KW2 A;  3EJD A;  1T8K A;  2AFE A;  2EHS A;  4BPH A;  2CGQ A;  1DNY A;  2QNW A;  2K92 A;  1F80 D;  4PWV B;  2K0X A;  2FAC A;  2MR7 A;  2KG8 A;  2FVF A;  2FQ0 A;  2L22 A;  4NEO A;  1AF8 A;  2KG6 A;  2LIU A;  4H2X C;  1ACP A;  2LML A;  2FVE A;  2JGP A;  2KGA A;  2KOO A;  3LMO A;  2PNG A;  4IZ6 A;  2JU2 A;  2GDW A;  2FQ2 A;  2XZ0 D;  2CNR A;  2K0Y A;  2MF4 A;  4MRT C;  2KOS A;  1L0I A;  2L9F A;  4BPF A;  2CQ8 A;  5KP6 B;  5KP8 B;  2FAD A;  2JQ4 A;  2K2Q A;  2KOP A;  2CG5 B;  2FVA A;  2LIW A;  2KGC A;  2KWL A;  2N50 A;  4R0M A;  2LL8 A;  2FHS C;  2X2B A;  4H2W C;  1L0H A;  2N5H A;  2L4B A;  2ROQ A;  5KP7 B;  2LPK A;  5HV8 A;  5CZD B;  2KOR A;  2MVV A;  3RG2 A;  2N6Y A;  2AF8 A;  2MR8 A;  2FAE A;  2GDX A;  2XZ1 C;  2LTE A;  2KG9 A;  4CA3 A;  2MY5 A;  4H2Y C;  5HVC A;  4DG9 A;  3EJE A;  1OR5 A;  2LOL A;  5EJD A;  3GZL A;  2DNW A;  1HY8 A;  3NY7 B;  2MVU A;  1DV5 A;  2EHT A;  2LKI A;  2N6Z A;  4HKG A;  4PXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...