4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/protein binding
molecule keywords P450 monooxygenase
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
3CE7A 1AF8A 2FVEA 1L0HA 2MF4A 3EJDA 1DV5A 2FAEA 2N50A 2LIWA 2AFDA 2XZ1C 5KP6B 2K2QA 2KOQA 2K94A 2KOOA 2N98A 2EHSA 1HQBA 4PXHB 5KP8B 2LKIA 4H2XC 2K93A 1T8KA 2FHSC 2K92A 4DG9A 2KGDA 2KR5A 2PNGA 2KW2A 1VKUA 2JGPA 3NY7B 2L4BA 2KGEA 2ROQA 4H2WC 4CA3A 3GZMA 1NQ4A 2FQ2A 2LTEA 3LMOA 4PWVB 2GDXA 1X3OA 2JU2A 2CGQA 2JQ4A 5EJDA 2KWLA 2CQ8A 1ACPA 2GDYA 5KP7B 2EHTA 2DNWA 2LL8A 5HVCA 2KG6A 2LMLA 4R0MA 2CNRA 5HV8A 4BPGA 4HKGA 3EJBA 4BPFA 2K0XA 2L9FA 2AF8A 2KORA 4MRTC 2LPKA 2MD9A 2FVAA 1L0IA 1F80D 2GDWA 3EJEA 2L0QA 2KGCA 1KLPA 4H2YC 2VSQA 2AFEA 2K0YA 2LOLA 2AVAA 2KG8A 5CZDB 2MVVA 2FVFA 2N6YA 2MY5A 2QNWA 2KGAA 2LIUA 2FACA 3GZLA 1OR5A 2M5RA 1HY8A 4IZ6A 2KOSA 2N5IA 2MR7A 2X2BA 2MR8A 2L22A 2CG5B 2FQ1A 2N5HA 2XZ0D 1DNYA 2KOPA 4BPHA 4NEOA 2FQ0A 2MVUA 3RG2A 2KG9A 2N6ZA 2JU1A 2FADA
chains in the Genus database with same CATH superfamily
3U43A 3DS3A 1UNKA 2FVEA 1L0HA 1Z6MA 2MF4A 3DTJA 3OW2O 1UJZA 2KOQA 2QA4P 2K94A 2GYKA 3LRYA 2VLNA 1KC8Q 1GXGA 1IMQA 2KGDA 2M8LA 3CCVP 2KGEA 4H2WC 2PEQA 3GZMA 4QKOA 3G4SP 2LTEA 4PWVB 2CGQA 3DS2A 4COPA 1VQMP 2DNWA 2LL8A 3G26A 2GZGA 3CC4P 2VLOA 3H4EA 1YITP 2KG6A 2PEOA 1KD1Q 1YJ9P 1M1KQ 1RNIA 5HGMA 2L9FA 1EIAA 2LPKA 1L0IA 1BAJA 5HGNA 2GDWA 1VQOP 2L0QA 1M90Q 2AVAA 1K30A 2Z46A 2M8PA 2XXMA 3CC7P 1BXIA 2M8NA 2ONTA 1QVGO 1QVFO 3GZLA 1VQNP 1MZ8A 1OR5A 2NO8A 3DPHA 4U0CA 4COCA 2P9XA 3CCSP 3CD6P 4XFZA 5HGLA 4U0DA 2N5HA 2PEMA 1DNYA 2Z44A 2CWOA 1Q7YQ 4M0IA 3CE7A 3DS5A 2FAEA 4PH1A 2XZ1C 2AFDA 1D1DA 2L6EA 2K0DX 2E1MA 4PXHB 5I4TG 3G1IA 2JAZA 1M74A 4H2XC 2ERHA 3G28A 4U0BA 1RO0A 1E6JP 2FHSC 3G0VA 4PH0A 3CCRP 2PNGA 2KW2A 3G29A 3H47A 3MGEA 1VKUA 2EIAA 2JGPA 2L4BA 2ROQA 2JB0A 2BUOA 3HZQA 4U0FA 2FQ2A 1N8RQ 1JJ2O 1X3OA 2GZFA 1VQ8P 5EJDA 2KWLA 2CQ8A 5KP7B 2LF4A 2CNRA 4BPFA 2K0XA 4XFXA 1F80D 1VQ7P 3CCUP 4GR2A 2Z45A 3G1GA 2LOLA 2KG8A 5CZDB 2MVVA 2FVFA 2MY5A 3GJNA 2KGAA 1VQPP 2FACA 3B4QA 2JYLA 3CPWO 3HYBA 2M5RA 4IZ6A 2N5IA 2PY8A 2MR7A 4QNBA 1YHQP 2XZ0D 1VQKP 4BPHA 2EFJA 2GZEA 2N6ZA 2GZIA 5F2NA 1VHNA 3M1MA 2N50A 2LIWA 3Q20A 5KP6B 1YIJP 3DS4A 1Q81Q 2EHSA 2WPTA 5KP8B 2OARA 2PENA 2K93A 1T8KA 4XRQA 2BHVA 2K92A 3G6EP 3NTEA 4DG9A 3G71P 1Q82Q 1IMPA 1VQ4P 2JBGA 3CMAP 1EOQA 3WBHA 1K73Q 2GZJA 3I56P 2JU2A 2JQ4A 2PEJA 1ACPA 2OTLP 1S72P 3GKLC 5HVCA 2LMLA 4BPGA 3VRLC 2QEXP 4WYMA 3E2DA 1GXHA 4GR6A 1NJIQ 3I55P 4MRTC 2MD9A 2FVAA 1AYIA 2KODA 1A43A 2K0YA 1ZNVA 2PEKA 1Q86Q 1KQSO 4U0EA 3DS1A 1RO2A 3B5IA 3G21A 2X2BA 5EW5E 2CG5B 3CCLP 2OTJP 1ZMBA 1K8AQ 1IUQA 2FQ0A 2MVUA 5F2KA 2JU1A 1QRJA 1AF8A 3CC2P 3CMEP 3EJDA 1DV5A 3DS0A 2K2QA 4U0AA 7CEIA 2KOOA 5DCKA 2N98A 1HQBA 2VLPA 5BS1A 2LKIA 4XROA 2PEIA 1FR2A 1EMVA 5JPAA 1M6NA 2JYGA 2KR5A 1YI2P 3NY7B 1YJWP 2DGYA 3P05A 4CA3A 4UHPB 1NQ4A 3LMOA 2GDXA 4IPYA 5HGOA 1K9MQ 3CCEP 2GDYA 2EHTA 1W2BO 4R0MA 2K5XA 5HV8A 2EG5A 4HKGA 3EJBA 1GPJA 1VQLP 2AF8A 2KORA 3CCMP 3EJEA 2XT1A 1VQ9P 2KGCA 1KLPA 4H2YC 2VSQA 2AFEA 1A8OA 2N6YA 4XFYA 2QNWA 2VLQA 2LIUA 2JO0A 1VQ6P 1AUMA 5BS2A 1CEIA 1YJNP 3CCQP 1HY8A 2KOSA 3H0DA 2MR8A 1E0HA 3CCJP 2L22A 1VQ5P 4F37A 2FQ1A 2XV6A 1M6EX 3RG6C 3CXCO 5F2OA 2KOPA 4NEOA 3RG2A 2KG9A 2FADA
chains in the Genus database with same CATH topology
3CE7A 1AF8A 2FVEA 1L0HA 2MF4A 3EJDA 1DV5A 2FAEA 2N50A 2LIWA 2AFDA 2XZ1C 5KP6B 2K2QA 2KOQA 2K94A 2KOOA 2N98A 2EHSA 1HQBA 4PXHB 5KP8B 2LKIA 4H2XC 2K93A 1T8KA 2FHSC 2K92A 4DG9A 2KGDA 2KR5A 2PNGA 2KW2A 1VKUA 2JGPA 3NY7B 2L4BA 2KGEA 2ROQA 4H2WC 4CA3A 3GZMA 1NQ4A 2FQ2A 2LTEA 3LMOA 4PWVB 2GDXA 1X3OA 2JU2A 2CGQA 2JQ4A 5EJDA 2KWLA 2CQ8A 1ACPA 2GDYA 5KP7B 2EHTA 2DNWA 2LL8A 5HVCA 2KG6A 2LMLA 4R0MA 2CNRA 5HV8A 4BPGA 4HKGA 3EJBA 4BPFA 2K0XA 2L9FA 2AF8A 2KORA 4MRTC 2LPKA 2MD9A 2FVAA 1L0IA 1F80D 2GDWA 3EJEA 2L0QA 2KGCA 1KLPA 4H2YC 2VSQA 2AFEA 2K0YA 2LOLA 2AVAA 2KG8A 5CZDB 2MVVA 2FVFA 2N6YA 2MY5A 2QNWA 2KGAA 2LIUA 2FACA 3GZLA 1OR5A 2M5RA 1HY8A 4IZ6A 2KOSA 2N5IA 2MR7A 2X2BA 2MR8A 2L22A 2CG5B 2FQ1A 2N5HA 2XZ0D 1DNYA 2KOPA 4BPHA 4NEOA 2FQ0A 2MVUA 3RG2A 2KG9A 2N6ZA 2JU1A 2FADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CE7 A;  1AF8 A;  2FVE A;  1L0H A;  2MF4 A;  3EJD A;  1DV5 A;  2FAE A;  2N50 A;  2LIW A;  2AFD A;  2XZ1 C;  5KP6 B;  2K2Q A;  2KOQ A;  2K94 A;  2KOO A;  2N98 A;  2EHS A;  1HQB A;  4PXH B;  5KP8 B;  2LKI A;  4H2X C;  2K93 A;  1T8K A;  2FHS C;  2K92 A;  4DG9 A;  2KGD A;  2KR5 A;  2PNG A;  2KW2 A;  1VKU A;  2JGP A;  3NY7 B;  2L4B A;  2KGE A;  2ROQ A;  4H2W C;  4CA3 A;  3GZM A;  1NQ4 A;  2FQ2 A;  2LTE A;  3LMO A;  4PWV B;  2GDX A;  1X3O A;  2JU2 A;  2CGQ A;  2JQ4 A;  5EJD A;  2KWL A;  2CQ8 A;  1ACP A;  2GDY A;  5KP7 B;  2EHT A;  2DNW A;  2LL8 A;  5HVC A;  2KG6 A;  2LML A;  4R0M A;  2CNR A;  5HV8 A;  4BPG A;  4HKG A;  3EJB A;  4BPF A;  2K0X A;  2L9F A;  2AF8 A;  2KOR A;  4MRT C;  2LPK A;  2MD9 A;  2FVA A;  1L0I A;  1F80 D;  2GDW A;  3EJE A;  2L0Q A;  2KGC A;  1KLP A;  4H2Y C;  2VSQ A;  2AFE A;  2K0Y A;  2LOL A;  2AVA A;  2KG8 A;  5CZD B;  2MVV A;  2FVF A;  2N6Y A;  2MY5 A;  2QNW A;  2KGA A;  2LIU A;  2FAC A;  3GZL A;  1OR5 A;  2M5R A;  1HY8 A;  4IZ6 A;  2KOS A;  2N5I A;  2MR7 A;  2X2B A;  2MR8 A;  2L22 A;  2CG5 B;  2FQ1 A;  2N5H A;  2XZ0 D;  1DNY A;  2KOP A;  4BPH A;  4NEO A;  2FQ0 A;  2MVU A;  3RG2 A;  2KG9 A;  2N6Z A;  2JU1 A;  2FAD A; 
#chains in the Genus database with same CATH topology
 3U43 A;  3DS3 A;  1UNK A;  2FVE A;  1L0H A;  1Z6M A;  2MF4 A;  3DTJ A;  3OW2 O;  1UJZ A;  2KOQ A;  2QA4 P;  2K94 A;  2GYK A;  3LRY A;  2VLN A;  1KC8 Q;  1GXG A;  1IMQ A;  2KGD A;  2M8L A;  3CCV P;  2KGE A;  4H2W C;  2PEQ A;  3GZM A;  4QKO A;  3G4S P;  2LTE A;  4PWV B;  2CGQ A;  3DS2 A;  4COP A;  1VQM P;  2DNW A;  2LL8 A;  3G26 A;  2GZG A;  3CC4 P;  2VLO A;  3H4E A;  1YIT P;  2KG6 A;  2PEO A;  1KD1 Q;  1YJ9 P;  1M1K Q;  1RNI A;  5HGM A;  2L9F A;  1EIA A;  2LPK A;  1L0I A;  1BAJ A;  5HGN A;  2GDW A;  1VQO P;  2L0Q A;  1M90 Q;  2AVA A;  1K30 A;  2Z46 A;  2M8P A;  2XXM A;  3CC7 P;  1BXI A;  2M8N A;  2ONT A;  1QVG O;  1QVF O;  3GZL A;  1VQN P;  1MZ8 A;  1OR5 A;  2NO8 A;  3DPH A;  4U0C A;  4COC A;  2P9X A;  3CCS P;  3CD6 P;  4XFZ A;  5HGL A;  4U0D A;  2N5H A;  2PEM A;  1DNY A;  2Z44 A;  2CWO A;  1Q7Y Q;  4M0I A;  3CE7 A;  3DS5 A;  2FAE A;  4PH1 A;  2XZ1 C;  2AFD A;  1D1D A;  2L6E A;  2K0D X;  2E1M A;  4PXH B;  5I4T G;  3G1I A;  2JAZ A;  1M74 A;  4H2X C;  2ERH A;  3G28 A;  4U0B A;  1RO0 A;  1E6J P;  2FHS C;  3G0V A;  4PH0 A;  3CCR P;  2PNG A;  2KW2 A;  3G29 A;  3H47 A;  3MGE A;  1VKU A;  2EIA A;  2JGP A;  2L4B A;  2ROQ A;  2JB0 A;  2BUO A;  3HZQ A;  4U0F A;  2FQ2 A;  1N8R Q;  1JJ2 O;  1X3O A;  2GZF A;  1VQ8 P;  5EJD A;  2KWL A;  2CQ8 A;  5KP7 B;  2LF4 A;  2CNR A;  4BPF A;  2K0X A;  4XFX A;  1F80 D;  1VQ7 P;  3CCU P;  4GR2 A;  2Z45 A;  3G1G A;  2LOL A;  2KG8 A;  5CZD B;  2MVV A;  2FVF A;  2MY5 A;  3GJN A;  2KGA A;  1VQP P;  2FAC A;  3B4Q A;  2JYL A;  3CPW O;  3HYB A;  2M5R A;  4IZ6 A;  2N5I A;  2PY8 A;  2MR7 A;  4QNB A;  1YHQ P;  2XZ0 D;  1VQK P;  4BPH A;  2EFJ A;  2GZE A;  2N6Z A;  2GZI A;  5F2N A;  1VHN A;  3M1M A;  2N50 A;  2LIW A;  3Q20 A;  5KP6 B;  1YIJ P;  3DS4 A;  1Q81 Q;  2EHS A;  2WPT A;  5KP8 B;  2OAR A;  2PEN A;  2K93 A;  1T8K A;  4XRQ A;  2BHV A;  2K92 A;  3G6E P;  3NTE A;  4DG9 A;  3G71 P;  1Q82 Q;  1IMP A;  1VQ4 P;  2JBG A;  3CMA P;  1EOQ A;  3WBH A;  1K73 Q;  2GZJ A;  3I56 P;  2JU2 A;  2JQ4 A;  2PEJ A;  1ACP A;  2OTL P;  1S72 P;  3GKL C;  5HVC A;  2LML A;  4BPG A;  3VRL C;  2QEX P;  4WYM A;  3E2D A;  1GXH A;  4GR6 A;  1NJI Q;  3I55 P;  4MRT C;  2MD9 A;  2FVA A;  1AYI A;  2KOD A;  1A43 A;  2K0Y A;  1ZNV A;  2PEK A;  1Q86 Q;  1KQS O;  4U0E A;  3DS1 A;  1RO2 A;  3B5I A;  3G21 A;  2X2B A;  5EW5 E;  2CG5 B;  3CCL P;  2OTJ P;  1ZMB A;  1K8A Q;  1IUQ A;  2FQ0 A;  2MVU A;  5F2K A;  2JU1 A;  1QRJ A;  1AF8 A;  3CC2 P;  3CME P;  3EJD A;  1DV5 A;  3DS0 A;  2K2Q A;  4U0A A;  7CEI A;  2KOO A;  5DCK A;  2N98 A;  1HQB A;  2VLP A;  5BS1 A;  2LKI A;  4XRO A;  2PEI A;  1FR2 A;  1EMV A;  5JPA A;  1M6N A;  2JYG A;  2KR5 A;  1YI2 P;  3NY7 B;  1YJW P;  2DGY A;  3P05 A;  4CA3 A;  4UHP B;  1NQ4 A;  3LMO A;  2GDX A;  4IPY A;  5HGO A;  1K9M Q;  3CCE P;  2GDY A;  2EHT A;  1W2B O;  4R0M A;  2K5X A;  5HV8 A;  2EG5 A;  4HKG A;  3EJB A;  1GPJ A;  1VQL P;  2AF8 A;  2KOR A;  3CCM P;  3EJE A;  2XT1 A;  1VQ9 P;  2KGC A;  1KLP A;  4H2Y C;  2VSQ A;  2AFE A;  1A8O A;  2N6Y A;  4XFY A;  2QNW A;  2VLQ A;  2LIU A;  2JO0 A;  1VQ6 P;  1AUM A;  5BS2 A;  1CEI A;  1YJN P;  3CCQ P;  1HY8 A;  2KOS A;  3H0D A;  2MR8 A;  1E0H A;  3CCJ P;  2L22 A;  1VQ5 P;  4F37 A;  2FQ1 A;  2XV6 A;  1M6E X;  3RG6 C;  3CXC O;  5F2O A;  2KOP A;  4NEO A;  3RG2 A;  2KG9 A;  2FAD A; 
#chains in the Genus database with same CATH homology
 3CE7 A;  1AF8 A;  2FVE A;  1L0H A;  2MF4 A;  3EJD A;  1DV5 A;  2FAE A;  2N50 A;  2LIW A;  2AFD A;  2XZ1 C;  5KP6 B;  2K2Q A;  2KOQ A;  2K94 A;  2KOO A;  2N98 A;  2EHS A;  1HQB A;  4PXH B;  5KP8 B;  2LKI A;  4H2X C;  2K93 A;  1T8K A;  2FHS C;  2K92 A;  4DG9 A;  2KGD A;  2KR5 A;  2PNG A;  2KW2 A;  1VKU A;  2JGP A;  3NY7 B;  2L4B A;  2KGE A;  2ROQ A;  4H2W C;  4CA3 A;  3GZM A;  1NQ4 A;  2FQ2 A;  2LTE A;  3LMO A;  4PWV B;  2GDX A;  1X3O A;  2JU2 A;  2CGQ A;  2JQ4 A;  5EJD A;  2KWL A;  2CQ8 A;  1ACP A;  2GDY A;  5KP7 B;  2EHT A;  2DNW A;  2LL8 A;  5HVC A;  2KG6 A;  2LML A;  4R0M A;  2CNR A;  5HV8 A;  4BPG A;  4HKG A;  3EJB A;  4BPF A;  2K0X A;  2L9F A;  2AF8 A;  2KOR A;  4MRT C;  2LPK A;  2MD9 A;  2FVA A;  1L0I A;  1F80 D;  2GDW A;  3EJE A;  2L0Q A;  2KGC A;  1KLP A;  4H2Y C;  2VSQ A;  2AFE A;  2K0Y A;  2LOL A;  2AVA A;  2KG8 A;  5CZD B;  2MVV A;  2FVF A;  2N6Y A;  2MY5 A;  2QNW A;  2KGA A;  2LIU A;  2FAC A;  3GZL A;  1OR5 A;  2M5R A;  1HY8 A;  4IZ6 A;  2KOS A;  2N5I A;  2MR7 A;  2X2B A;  2MR8 A;  2L22 A;  2CG5 B;  2FQ1 A;  2N5H A;  2XZ0 D;  1DNY A;  2KOP A;  4BPH A;  4NEO A;  2FQ0 A;  2MVU A;  3RG2 A;  2KG9 A;  2N6Z A;  2JU1 A;  2FAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...