4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
molecule keywords P450 monooxygenase
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
4R0MA 2LIUA 2FAEA 2JGPA 2JU2A 2KG6A 2EHTA 2LL8A 2ROQA 1HY8A 2FQ0A 1OR5A 2FACA 4MRTC 3EJDA 2KW2A 2LTEA 2XZ0D 3CE7A 2KORA 5EJDA 2KGCA 2N98A 2KOQA 2KG9A 2AFDA 2KGDA 3RG2A 1AF8A 2MF4A 2CG5B 2KOOA 2N5IA 4PWVB 2L9FA 2JU1A 3EJBA 2K92A 2DNWA 5KP8B 2LIWA 1DV5A 2GDWA 1L0HA 2XZ1C 2L4BA 2MR8A 2LMLA 2KR5A 3GZLA 4H2WC 2MY5A 2N50A 5HVCA 2CQ8A 1NQ4A 2N6YA 4BPGA 2L0QA 3LMOA 2CNRA 2L22A 2KG8A 1DNYA 2KOSA 4IZ6A 2FQ1A 2JQ4A 2KGEA 5HV8A 3NY7B 2AFEA 2K2QA 4PXHB 2LKIA 4H2XC 2VSQA 3GZMA 4BPHA 2QNWA 1VKUA 2FHSC 2LOLA 5KP6B 2LPKA 2EHSA 2AF8A 2K0YA 2FQ2A 2MVUA 5CZDB 1T8KA 4CA3A 5KP7B 2M5RA 2GDYA 4HKGA 1ACPA 2FVEA 2PNGA 2FVFA 2N5HA 1HQBA 2MR7A 1L0IA 2X2BA 2N6ZA 4BPFA 1F80D 2KOPA 2FADA 3EJEA 4DG9A 2MVVA 2K94A 2KWLA 4NEOA 2FVAA 2MD9A 2GDXA 4H2YC 1X3OA 2AVAA 2K93A 1KLPA 2K0XA 2CGQA 2KGAA
chains in the Genus database with same CATH superfamily
2FAEA 2EFJA 3VRLC 1HY8A 1QVFO 3CC7P 4UHPB 1Q81Q 1UJZA 1VQ7P 1AYIA 2KORA 1M6EX 2QEXP 2MF4A 2PEOA 1K30A 1D1DA 2DNWA 4XFYA 5KP8B 3B4QA 1YIJP 1M74A 2MY5A 2N50A 3P05A 1NQ4A 2M8NA 2L0QA 1DNYA 5HGNA 2JQ4A 2KGEA 3NY7B 3HZQA 4H2XC 1Q82Q 2MVUA 4CA3A 3G1GA 1A43A 1K8AQ 2FVFA 2N5HA 4QNBA 2MR7A 4U0FA 2GZIA 3DS4A 1GXGA 2MD9A 2OTLP 1S72P 1X3OA 2Z45A 1IMQA 3M1MA 4U0BA 2KGAA 2VLPA 2LIUA 2JGPA 3H4EA 2KG6A 2EHTA 3GKLC 3CCMP 1MZ8A 4PH1A 1RNIA 2OARA 2FACA 3EJDA 2LTEA 2OTJP 1VQKP 2JB0A 3CE7A 2KOQA 1Q7YQ 2AFDA 2GYKA 3CCJP 1NJIQ 2KGDA 3WBHA 3I56P 4GR2A 5F2NA 2K0DX 2L9FA 1KQSO 2BHVA 3EJBA 2LF4A 3CCSP 1VQPP 2VLOA 2XV6A 2XZ1C 4U0EA 1Z6MA 1YJWP 1VQLP 4BPGA 2PEIA 2M8LA 1EIAA 3CCLP 2Z46A 2KOSA 4IZ6A 3DS5A 2FQ1A 3G0VA 1YJ9P 2QA4P 3DS1A 1KD1Q 2K2QA 3CCRP 2VSQA 1QRJA 2AF8A 3DS2A 5KP7B 1VQ8P 2GDYA 3RG6C 1ACPA 2GZEA 2PNGA 1M90Q 7CEIA 2PEKA 1ZMBA 1M6NA 2PEJA 1JJ2O 1KC8Q 3CC4P 3G26A 1VQ9P 4U0AA 3EJEA 2K94A 4NEOA 2GZGA 2GZFA 2FVAA 2GDXA 2EG5A 4QKOA 1YHQP 2CGQA 4XFZA 3CC2P 1VHNA 2JU2A 2PEQA 2Z44A 1RO2A 1VQOP 2KW2A 2XZ0D 1GPJA 2KGCA 2E1MA 5HGMA 5BS2A 2N5IA 5F2KA 3CMAP 2JBGA 5I4TG 3E2DA 3DPHA 1E0HA 1CEIA 2LIWA 1L0HA 2MR8A 2BUOA 3G1IA 2KR5A 4H2WC 5HVCA 3CMEP 2DGYA 3LRYA 3H47A 1VQ6P 2L22A 1AUMA 3OW2O 2PY8A 3CCQP 1M1KQ 2ONTA 3GJNA 4PXHB 3GZMA 4XROA 3G28A 1VKUA 5HGOA 4M0IA 2LOLA 2LPKA 3G21A 2EHSA 2K0YA 1RO0A 1VQ5P 2PEMA 2M5RA 4HKGA 2JAZA 2FVEA 4XRQA 2WPTA 3HYBA 2XT1A 1BAJA 4U0CA 3DTJA 3B5IA 2EIAA 2FADA 1VQNP 2MVVA 3DS0A 4F37A 4H2YC 4GR6A 5BS1A 1EMVA 4PH0A 4R0MA 1YI2P 3CD6P 2LL8A 2M8PA 1Q86Q 2ROQA 4U0DA 2FQ0A 1OR5A 4MRTC 3Q20A 2NO8A 2VLQA 2PENA 4COPA 3U43A 1BXIA 2K5XA 2N98A 5EJDA 1K9MQ 2KG9A 1N8RQ 2VLNA 3CPWO 3RG2A 1AF8A 2CG5B 2KOOA 4PWVB 1EOQA 2JU1A 3CCEP 1UNKA 2K92A 1QVGO 5F2OA 4COCA 1DV5A 1E6JP 2GDWA 2L4BA 5JPAA 2LMLA 3CCUP 3GZLA 2XXMA 2CQ8A 5DCKA 2JYLA 2N6YA 3LMOA 3DS3A 2L6EA 2CNRA 2KODA 3MGEA 1FR2A 2KG8A 2CWOA 3G29A 4IPYA 4WYMA 5HV8A 3G6EP 1W2BO 2AFEA 1IUQA 2LKIA 4BPHA 1ZNVA 2JYGA 2JO0A 2QNWA 3NTEA 2FHSC 2P9XA 5KP6B 1YJNP 3CXCO 3I55P 2FQ2A 5CZDB 1T8KA 2GZJA 1K73Q 3CCVP 1VQMP 1HQBA 3G4SP 1L0IA 5HGLA 2X2BA 2N6ZA 4BPFA 1F80D 2KOPA 1YITP 1VQ4P 1A8OA 5EW5E 2ERHA 4DG9A 3G71P 2KWLA 3H0DA 1IMPA 1GXHA 4XFXA 2AVAA 2K93A 1KLPA 2K0XA
chains in the Genus database with same CATH topology
4R0MA 2LIUA 2FAEA 2JGPA 2JU2A 2KG6A 2EHTA 2LL8A 2ROQA 1HY8A 2FQ0A 1OR5A 2FACA 4MRTC 3EJDA 2KW2A 2LTEA 2XZ0D 3CE7A 2KORA 5EJDA 2KGCA 2N98A 2KOQA 2KG9A 2AFDA 2KGDA 3RG2A 1AF8A 2MF4A 2CG5B 2KOOA 2N5IA 4PWVB 2L9FA 2JU1A 3EJBA 2K92A 2DNWA 5KP8B 2LIWA 1DV5A 2GDWA 1L0HA 2XZ1C 2L4BA 2MR8A 2LMLA 2KR5A 3GZLA 4H2WC 2MY5A 2N50A 5HVCA 2CQ8A 1NQ4A 2N6YA 4BPGA 2L0QA 3LMOA 2CNRA 2L22A 2KG8A 1DNYA 2KOSA 4IZ6A 2FQ1A 2JQ4A 2KGEA 5HV8A 3NY7B 2AFEA 2K2QA 4PXHB 2LKIA 4H2XC 2VSQA 3GZMA 4BPHA 2QNWA 1VKUA 2FHSC 2LOLA 5KP6B 2LPKA 2EHSA 2AF8A 2K0YA 2FQ2A 2MVUA 5CZDB 1T8KA 4CA3A 5KP7B 2M5RA 2GDYA 4HKGA 1ACPA 2FVEA 2PNGA 2FVFA 2N5HA 1HQBA 2MR7A 1L0IA 2X2BA 2N6ZA 4BPFA 1F80D 2KOPA 2FADA 3EJEA 4DG9A 2MVVA 2K94A 2KWLA 4NEOA 2FVAA 2MD9A 2GDXA 4H2YC 1X3OA 2AVAA 2K93A 1KLPA 2K0XA 2CGQA 2KGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0M A;  2LIU A;  2FAE A;  2JGP A;  2JU2 A;  2KG6 A;  2EHT A;  2LL8 A;  2ROQ A;  1HY8 A;  2FQ0 A;  1OR5 A;  2FAC A;  4MRT C;  3EJD A;  2KW2 A;  2LTE A;  2XZ0 D;  3CE7 A;  2KOR A;  5EJD A;  2KGC A;  2N98 A;  2KOQ A;  2KG9 A;  2AFD A;  2KGD A;  3RG2 A;  1AF8 A;  2MF4 A;  2CG5 B;  2KOO A;  2N5I A;  4PWV B;  2L9F A;  2JU1 A;  3EJB A;  2K92 A;  2DNW A;  5KP8 B;  2LIW A;  1DV5 A;  2GDW A;  1L0H A;  2XZ1 C;  2L4B A;  2MR8 A;  2LML A;  2KR5 A;  3GZL A;  4H2W C;  2MY5 A;  2N50 A;  5HVC A;  2CQ8 A;  1NQ4 A;  2N6Y A;  4BPG A;  2L0Q A;  3LMO A;  2CNR A;  2L22 A;  2KG8 A;  1DNY A;  2KOS A;  4IZ6 A;  2FQ1 A;  2JQ4 A;  2KGE A;  5HV8 A;  3NY7 B;  2AFE A;  2K2Q A;  4PXH B;  2LKI A;  4H2X C;  2VSQ A;  3GZM A;  4BPH A;  2QNW A;  1VKU A;  2FHS C;  2LOL A;  5KP6 B;  2LPK A;  2EHS A;  2AF8 A;  2K0Y A;  2FQ2 A;  2MVU A;  5CZD B;  1T8K A;  4CA3 A;  5KP7 B;  2M5R A;  2GDY A;  4HKG A;  1ACP A;  2FVE A;  2PNG A;  2FVF A;  2N5H A;  1HQB A;  2MR7 A;  1L0I A;  2X2B A;  2N6Z A;  4BPF A;  1F80 D;  2KOP A;  2FAD A;  3EJE A;  4DG9 A;  2MVV A;  2K94 A;  2KWL A;  4NEO A;  2FVA A;  2MD9 A;  2GDX A;  4H2Y C;  1X3O A;  2AVA A;  2K93 A;  1KLP A;  2K0X A;  2CGQ A;  2KGA A; 
#chains in the Genus database with same CATH topology
 2FAE A;  2EFJ A;  3VRL C;  1HY8 A;  1QVF O;  3CC7 P;  4UHP B;  1Q81 Q;  1UJZ A;  1VQ7 P;  1AYI A;  2KOR A;  1M6E X;  2QEX P;  2MF4 A;  2PEO A;  1K30 A;  1D1D A;  2DNW A;  4XFY A;  5KP8 B;  3B4Q A;  1YIJ P;  1M74 A;  2MY5 A;  2N50 A;  3P05 A;  1NQ4 A;  2M8N A;  2L0Q A;  1DNY A;  5HGN A;  2JQ4 A;  2KGE A;  3NY7 B;  3HZQ A;  4H2X C;  1Q82 Q;  2MVU A;  4CA3 A;  3G1G A;  1A43 A;  1K8A Q;  2FVF A;  2N5H A;  4QNB A;  2MR7 A;  4U0F A;  2GZI A;  3DS4 A;  1GXG A;  2MD9 A;  2OTL P;  1S72 P;  1X3O A;  2Z45 A;  1IMQ A;  3M1M A;  4U0B A;  2KGA A;  2VLP A;  2LIU A;  2JGP A;  3H4E A;  2KG6 A;  2EHT A;  3GKL C;  3CCM P;  1MZ8 A;  4PH1 A;  1RNI A;  2OAR A;  2FAC A;  3EJD A;  2LTE A;  2OTJ P;  1VQK P;  2JB0 A;  3CE7 A;  2KOQ A;  1Q7Y Q;  2AFD A;  2GYK A;  3CCJ P;  1NJI Q;  2KGD A;  3WBH A;  3I56 P;  4GR2 A;  5F2N A;  2K0D X;  2L9F A;  1KQS O;  2BHV A;  3EJB A;  2LF4 A;  3CCS P;  1VQP P;  2VLO A;  2XV6 A;  2XZ1 C;  4U0E A;  1Z6M A;  1YJW P;  1VQL P;  4BPG A;  2PEI A;  2M8L A;  1EIA A;  3CCL P;  2Z46 A;  2KOS A;  4IZ6 A;  3DS5 A;  2FQ1 A;  3G0V A;  1YJ9 P;  2QA4 P;  3DS1 A;  1KD1 Q;  2K2Q A;  3CCR P;  2VSQ A;  1QRJ A;  2AF8 A;  3DS2 A;  5KP7 B;  1VQ8 P;  2GDY A;  3RG6 C;  1ACP A;  2GZE A;  2PNG A;  1M90 Q;  7CEI A;  2PEK A;  1ZMB A;  1M6N A;  2PEJ A;  1JJ2 O;  1KC8 Q;  3CC4 P;  3G26 A;  1VQ9 P;  4U0A A;  3EJE A;  2K94 A;  4NEO A;  2GZG A;  2GZF A;  2FVA A;  2GDX A;  2EG5 A;  4QKO A;  1YHQ P;  2CGQ A;  4XFZ A;  3CC2 P;  1VHN A;  2JU2 A;  2PEQ A;  2Z44 A;  1RO2 A;  1VQO P;  2KW2 A;  2XZ0 D;  1GPJ A;  2KGC A;  2E1M A;  5HGM A;  5BS2 A;  2N5I A;  5F2K A;  3CMA P;  2JBG A;  5I4T G;  3E2D A;  3DPH A;  1E0H A;  1CEI A;  2LIW A;  1L0H A;  2MR8 A;  2BUO A;  3G1I A;  2KR5 A;  4H2W C;  5HVC A;  3CME P;  2DGY A;  3LRY A;  3H47 A;  1VQ6 P;  2L22 A;  1AUM A;  3OW2 O;  2PY8 A;  3CCQ P;  1M1K Q;  2ONT A;  3GJN A;  4PXH B;  3GZM A;  4XRO A;  3G28 A;  1VKU A;  5HGO A;  4M0I A;  2LOL A;  2LPK A;  3G21 A;  2EHS A;  2K0Y A;  1RO0 A;  1VQ5 P;  2PEM A;  2M5R A;  4HKG A;  2JAZ A;  2FVE A;  4XRQ A;  2WPT A;  3HYB A;  2XT1 A;  1BAJ A;  4U0C A;  3DTJ A;  3B5I A;  2EIA A;  2FAD A;  1VQN P;  2MVV A;  3DS0 A;  4F37 A;  4H2Y C;  4GR6 A;  5BS1 A;  1EMV A;  4PH0 A;  4R0M A;  1YI2 P;  3CD6 P;  2LL8 A;  2M8P A;  1Q86 Q;  2ROQ A;  4U0D A;  2FQ0 A;  1OR5 A;  4MRT C;  3Q20 A;  2NO8 A;  2VLQ A;  2PEN A;  4COP A;  3U43 A;  1BXI A;  2K5X A;  2N98 A;  5EJD A;  1K9M Q;  2KG9 A;  1N8R Q;  2VLN A;  3CPW O;  3RG2 A;  1AF8 A;  2CG5 B;  2KOO A;  4PWV B;  1EOQ A;  2JU1 A;  3CCE P;  1UNK A;  2K92 A;  1QVG O;  5F2O A;  4COC A;  1DV5 A;  1E6J P;  2GDW A;  2L4B A;  5JPA A;  2LML A;  3CCU P;  3GZL A;  2XXM A;  2CQ8 A;  5DCK A;  2JYL A;  2N6Y A;  3LMO A;  3DS3 A;  2L6E A;  2CNR A;  2KOD A;  3MGE A;  1FR2 A;  2KG8 A;  2CWO A;  3G29 A;  4IPY A;  4WYM A;  5HV8 A;  3G6E P;  1W2B O;  2AFE A;  1IUQ A;  2LKI A;  4BPH A;  1ZNV A;  2JYG A;  2JO0 A;  2QNW A;  3NTE A;  2FHS C;  2P9X A;  5KP6 B;  1YJN P;  3CXC O;  3I55 P;  2FQ2 A;  5CZD B;  1T8K A;  2GZJ A;  1K73 Q;  3CCV P;  1VQM P;  1HQB A;  3G4S P;  1L0I A;  5HGL A;  2X2B A;  2N6Z A;  4BPF A;  1F80 D;  2KOP A;  1YIT P;  1VQ4 P;  1A8O A;  5EW5 E;  2ERH A;  4DG9 A;  3G71 P;  2KWL A;  3H0D A;  1IMP A;  1GXH A;  4XFX A;  2AVA A;  2K93 A;  1KLP A;  2K0X A; 
#chains in the Genus database with same CATH homology
 4R0M A;  2LIU A;  2FAE A;  2JGP A;  2JU2 A;  2KG6 A;  2EHT A;  2LL8 A;  2ROQ A;  1HY8 A;  2FQ0 A;  1OR5 A;  2FAC A;  4MRT C;  3EJD A;  2KW2 A;  2LTE A;  2XZ0 D;  3CE7 A;  2KOR A;  5EJD A;  2KGC A;  2N98 A;  2KOQ A;  2KG9 A;  2AFD A;  2KGD A;  3RG2 A;  1AF8 A;  2MF4 A;  2CG5 B;  2KOO A;  2N5I A;  4PWV B;  2L9F A;  2JU1 A;  3EJB A;  2K92 A;  2DNW A;  5KP8 B;  2LIW A;  1DV5 A;  2GDW A;  1L0H A;  2XZ1 C;  2L4B A;  2MR8 A;  2LML A;  2KR5 A;  3GZL A;  4H2W C;  2MY5 A;  2N50 A;  5HVC A;  2CQ8 A;  1NQ4 A;  2N6Y A;  4BPG A;  2L0Q A;  3LMO A;  2CNR A;  2L22 A;  2KG8 A;  1DNY A;  2KOS A;  4IZ6 A;  2FQ1 A;  2JQ4 A;  2KGE A;  5HV8 A;  3NY7 B;  2AFE A;  2K2Q A;  4PXH B;  2LKI A;  4H2X C;  2VSQ A;  3GZM A;  4BPH A;  2QNW A;  1VKU A;  2FHS C;  2LOL A;  5KP6 B;  2LPK A;  2EHS A;  2AF8 A;  2K0Y A;  2FQ2 A;  2MVU A;  5CZD B;  1T8K A;  4CA3 A;  5KP7 B;  2M5R A;  2GDY A;  4HKG A;  1ACP A;  2FVE A;  2PNG A;  2FVF A;  2N5H A;  1HQB A;  2MR7 A;  1L0I A;  2X2B A;  2N6Z A;  4BPF A;  1F80 D;  2KOP A;  2FAD A;  3EJE A;  4DG9 A;  2MVV A;  2K94 A;  2KWL A;  4NEO A;  2FVA A;  2MD9 A;  2GDX A;  4H2Y C;  1X3O A;  2AVA A;  2K93 A;  1KLP A;  2K0X A;  2CGQ A;  2KGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...