4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
b'REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P450 monooxygenase
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
2L9FA 3RG2A 4H2YC 2MD9A 4CA3A 1KLPA 2KOOA 2K94A 2JGPA 2FQ1A 2KGDA 2K0YA 2AFEA 2GDYA 2EHTA 2AF8A 2CGQA 4HKGA 3EJDA 4H2WC 4H2XC 1HQBA 2LTEA 2FACA 1DV5A 2N5HA 3GZMA 4BPGA 2N5IA 2JQ4A 2KG6A 2LMLA 3NY7B 2FADA 2X2BA 2LPKA 4NEOA 1X3OA 2LKIA 4R0MA 2MR8A 2CG5B 5KP8B 2N50A 3EJEA 2KOPA 1L0HA 2KW2A 2LOLA 2ROQA 4PXHB 2VSQA 2AVAA 5KP7B 2FAEA 2JU2A 1AF8A 2FQ2A 2K93A 2FVAA 4IZ6A 2EHSA 2KGAA 2K0XA 1NQ4A 2LIUA 4BPHA 2N98A 2QNWA 2LL8A 2LIWA 2XZ0D 3LMOA 2DNWA 2KG8A 3GZLA 1T8KA 2MVUA 2K92A 5HV8A 2JU1A 2KR5A 4MRTC 2FQ0A 2L22A 5KP6B 2CNRA 1DNYA 1HY8A 2KG9A 2MF4A 2AFDA 2MVVA 2PNGA 3CE7A 2FVFA 2MR7A 2L4BA 2N6ZA 2FHSC 5EJDA 4PWVB 5HVCA 2KOQA 2M5RA 2KWLA 3EJBA 2GDXA 1F80D 1VKUA 4BPFA 1L0IA 2L0QA 2KGCA 4DG9A 2XZ1C 2KORA 1ACPA 2FVEA 2K2QA 2KOSA 2CQ8A 5CZDB 1OR5A 2GDWA 2N6YA 2MY5A 2KGEA
chains in the Genus database with same CATH superfamily
1BAJA 3DS3A 2GZEA 4H2YC 2MD9A 4CA3A 2KOOA 3VRLC 2Z45A 3WBHA 2AF8A 3DS4A 3G28A 1M74A 3M1MA 1AYIA 2OARA 3E2DA 3G26A 2N5IA 1YHQP 3NY7B 2FADA 3DTJA 3RG6C 5JPAA 1GXGA 1M6EX 1ZMBA 2PEIA 2CG5B 1YIJP 2KW2A 3DPHA 3CCRP 5KP7B 2FQ2A 4IZ6A 2EHSA 2XXMA 3CXCO 3Q20A 4GR2A 2OTLP 1K9MQ 2EG5A 1VQ4P 3CCMP 4WYMA 3GZLA 1T8KA 2MVUA 2JU1A 4MRTC 1Q7YQ 3CCLP 1GXHA 3I56P 3CCJP 5F2OA 3CE7A 2FVFA 5EJDA 1VQMP 2QA4P 2JB0A 2KWLA 1F80D 2BUOA 4XFYA 2L0QA 2PEKA 2KGCA 1ACPA 2K2QA 5CZDB 3G1IA 1CEIA 2GDWA 1AUMA 2M8LA 3RG2A 1MZ8A 5HGNA 2Z46A 2K94A 4PH0A 2AFEA 2GDYA 1A8OA 1VHNA 2CGQA 2CWOA 4HKGA 3EJDA 4H2WC 2VLQA 1QVFO 1VQ7P 3CCVP 5HGMA 2LTEA 1DV5A 1ZNVA 2K5XA 1E0HA 2N5HA 1IMPA 1KC8Q 3GKLC 4BPGA 5DCKA 2JQ4A 4F37A 2LMLA 2LPKA 3DS0A 3HYBA 5KP8B 4GR6A 1VQLP 4PH1A 2GZGA 3CC2P 1AF8A 2DGYA 5EW5E 2LIUA 4QNBA 3DS5A 4BPHA 2VLOA 1A43A 2JBGA 3G71P 2VLNA 1BXIA 2XZ0D 3G0VA 2KG8A 4UHPB 1GPJA 3CCUP 3OW2O 4COCA 3H0DA 3CD6P 1VQ6P 2CNRA 1DNYA 3G1GA 2PNGA 2FHSC 4PWVB 5HVCA 2KOQA 2KODA 2GDXA 1IMQA 4U0FA 1FR2A 2XT1A 4BPFA 1L0IA 1Q82Q 1YJWP 2XZ1C 2KORA 2OTJP 2KOSA 3CCSP 2EFJA 1OR5A 2N6YA 1M6NA 1M1KQ 1VQKP 2GYKA 1EOQA 2JYLA 4XFXA 5HGLA 3CCEP 2FQ1A 2KGDA 2K0YA 1KQSO 2PEMA 1K8AQ 2QEXP 2PEJA 1QRJA 2GZJA 2GZIA 1Q81Q 4XROA 4NEOA 1S72P 3CC7P 2LKIA 2LOLA 2ROQA 2VLPA 2WPTA 3GJNA 4QKOA 3G4SP 2VSQA 2AVAA 1NJIQ 2FAEA 4U0DA 4U0CA 5BS2A 3HZQA 2KGAA 2K0XA 1NQ4A 5I4TG 3B5IA 3U43A 2JAZA 1E6JP 2QNWA 2LIWA 2ONTA 4U0BA 2M8PA 2K92A 2PEOA 2FQ0A 3NTEA 2GZFA 2L22A 2NO8A 3DS2A 1N8RQ 2MF4A 2AFDA 1IUQA 2MVVA 3B4QA 2MR7A 2E1MA 2M8NA 2M5RA 3EJBA 1EMVA 1UJZA 1QVGO 1UNKA 4U0EA 2FVEA 4COPA 2BHVA 1YJNP 1Z6MA 2MY5A 2L9FA 3CMEP 3DS1A 1YITP 3MGEA 4M0IA 1KLPA 3CMAP 2JGPA 1M90Q 1W2BO 1D1DA 2EHTA 4H2XC 1HQBA 2FACA 3CC4P 3H4EA 2PENA 4IPYA 3GZMA 2KG6A 3G6EP 2X2BA 1EIAA 2L6EA 1X3OA 2ERHA 4R0MA 2MR8A 2N50A 3EJEA 2KOPA 1L0HA 4PXHB 1VQ5P 1VQ8P 3P05A 2JU2A 1RNIA 2PY8A 2K93A 2FVAA 2JO0A 5F2KA 3CPWO 1VQ9P 7CEIA 2N98A 2K0DX 1RO0A 2LL8A 3LMOA 2DNWA 2JYGA 5HV8A 2KR5A 1K73Q 5KP6B 2LF4A 1VQNP 1HY8A 2KG9A 1YI2P 1YJ9P 4XFZA 2PEQA 3I55P 1VQOP 1RO2A 4U0AA 2EIAA 2L4BA 2N6ZA 5HGOA 3G21A 4XRQA 1VQPP 2P9XA 1K30A 3G29A 1Q86Q 1VKUA 3CCQP 3H47A 5BS1A 5F2NA 4DG9A 3LRYA 2CQ8A 2Z44A 2XV6A 1KD1Q 1JJ2O 2KGEA
chains in the Genus database with same CATH topology
2L9FA 3RG2A 4H2YC 2MD9A 4CA3A 1KLPA 2KOOA 2K94A 2JGPA 2FQ1A 2KGDA 2K0YA 2AFEA 2GDYA 2EHTA 2AF8A 2CGQA 4HKGA 3EJDA 4H2WC 4H2XC 1HQBA 2LTEA 2FACA 1DV5A 2N5HA 3GZMA 4BPGA 2N5IA 2JQ4A 2KG6A 2LMLA 3NY7B 2FADA 2X2BA 2LPKA 4NEOA 1X3OA 2LKIA 4R0MA 2MR8A 2CG5B 5KP8B 2N50A 3EJEA 2KOPA 1L0HA 2KW2A 2LOLA 2ROQA 4PXHB 2VSQA 2AVAA 5KP7B 2FAEA 2JU2A 1AF8A 2FQ2A 2K93A 2FVAA 4IZ6A 2EHSA 2KGAA 2K0XA 1NQ4A 2LIUA 4BPHA 2N98A 2QNWA 2LL8A 2LIWA 2XZ0D 3LMOA 2DNWA 2KG8A 3GZLA 1T8KA 2MVUA 2K92A 5HV8A 2JU1A 2KR5A 4MRTC 2FQ0A 2L22A 5KP6B 2CNRA 1DNYA 1HY8A 2KG9A 2MF4A 2AFDA 2MVVA 2PNGA 3CE7A 2FVFA 2MR7A 2L4BA 2N6ZA 2FHSC 5EJDA 4PWVB 5HVCA 2KOQA 2M5RA 2KWLA 3EJBA 2GDXA 1F80D 1VKUA 4BPFA 1L0IA 2L0QA 2KGCA 4DG9A 2XZ1C 2KORA 1ACPA 2FVEA 2K2QA 2KOSA 2CQ8A 5CZDB 1OR5A 2GDWA 2N6YA 2MY5A 2KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9F A;  3RG2 A;  4H2Y C;  2MD9 A;  4CA3 A;  1KLP A;  2KOO A;  2K94 A;  2JGP A;  2FQ1 A;  2KGD A;  2K0Y A;  2AFE A;  2GDY A;  2EHT A;  2AF8 A;  2CGQ A;  4HKG A;  3EJD A;  4H2W C;  4H2X C;  1HQB A;  2LTE A;  2FAC A;  1DV5 A;  2N5H A;  3GZM A;  4BPG A;  2N5I A;  2JQ4 A;  2KG6 A;  2LML A;  3NY7 B;  2FAD A;  2X2B A;  2LPK A;  4NEO A;  1X3O A;  2LKI A;  4R0M A;  2MR8 A;  2CG5 B;  5KP8 B;  2N50 A;  3EJE A;  2KOP A;  1L0H A;  2KW2 A;  2LOL A;  2ROQ A;  4PXH B;  2VSQ A;  2AVA A;  5KP7 B;  2FAE A;  2JU2 A;  1AF8 A;  2FQ2 A;  2K93 A;  2FVA A;  4IZ6 A;  2EHS A;  2KGA A;  2K0X A;  1NQ4 A;  2LIU A;  4BPH A;  2N98 A;  2QNW A;  2LL8 A;  2LIW A;  2XZ0 D;  3LMO A;  2DNW A;  2KG8 A;  3GZL A;  1T8K A;  2MVU A;  2K92 A;  5HV8 A;  2JU1 A;  2KR5 A;  4MRT C;  2FQ0 A;  2L22 A;  5KP6 B;  2CNR A;  1DNY A;  1HY8 A;  2KG9 A;  2MF4 A;  2AFD A;  2MVV A;  2PNG A;  3CE7 A;  2FVF A;  2MR7 A;  2L4B A;  2N6Z A;  2FHS C;  5EJD A;  4PWV B;  5HVC A;  2KOQ A;  2M5R A;  2KWL A;  3EJB A;  2GDX A;  1F80 D;  1VKU A;  4BPF A;  1L0I A;  2L0Q A;  2KGC A;  4DG9 A;  2XZ1 C;  2KOR A;  1ACP A;  2FVE A;  2K2Q A;  2KOS A;  2CQ8 A;  5CZD B;  1OR5 A;  2GDW A;  2N6Y A;  2MY5 A;  2KGE A; 
#chains in the Genus database with same CATH topology
 1BAJ A;  3DS3 A;  2GZE A;  4H2Y C;  2MD9 A;  4CA3 A;  2KOO A;  3VRL C;  2Z45 A;  3WBH A;  2AF8 A;  3DS4 A;  3G28 A;  1M74 A;  3M1M A;  1AYI A;  2OAR A;  3E2D A;  3G26 A;  2N5I A;  1YHQ P;  3NY7 B;  2FAD A;  3DTJ A;  3RG6 C;  5JPA A;  1GXG A;  1M6E X;  1ZMB A;  2PEI A;  2CG5 B;  1YIJ P;  2KW2 A;  3DPH A;  3CCR P;  5KP7 B;  2FQ2 A;  4IZ6 A;  2EHS A;  2XXM A;  3CXC O;  3Q20 A;  4GR2 A;  2OTL P;  1K9M Q;  2EG5 A;  1VQ4 P;  3CCM P;  4WYM A;  3GZL A;  1T8K A;  2MVU A;  2JU1 A;  4MRT C;  1Q7Y Q;  3CCL P;  1GXH A;  3I56 P;  3CCJ P;  5F2O A;  3CE7 A;  2FVF A;  5EJD A;  1VQM P;  2QA4 P;  2JB0 A;  2KWL A;  1F80 D;  2BUO A;  4XFY A;  2L0Q A;  2PEK A;  2KGC A;  1ACP A;  2K2Q A;  5CZD B;  3G1I A;  1CEI A;  2GDW A;  1AUM A;  2M8L A;  3RG2 A;  1MZ8 A;  5HGN A;  2Z46 A;  2K94 A;  4PH0 A;  2AFE A;  2GDY A;  1A8O A;  1VHN A;  2CGQ A;  2CWO A;  4HKG A;  3EJD A;  4H2W C;  2VLQ A;  1QVF O;  1VQ7 P;  3CCV P;  5HGM A;  2LTE A;  1DV5 A;  1ZNV A;  2K5X A;  1E0H A;  2N5H A;  1IMP A;  1KC8 Q;  3GKL C;  4BPG A;  5DCK A;  2JQ4 A;  4F37 A;  2LML A;  2LPK A;  3DS0 A;  3HYB A;  5KP8 B;  4GR6 A;  1VQL P;  4PH1 A;  2GZG A;  3CC2 P;  1AF8 A;  2DGY A;  5EW5 E;  2LIU A;  4QNB A;  3DS5 A;  4BPH A;  2VLO A;  1A43 A;  2JBG A;  3G71 P;  2VLN A;  1BXI A;  2XZ0 D;  3G0V A;  2KG8 A;  4UHP B;  1GPJ A;  3CCU P;  3OW2 O;  4COC A;  3H0D A;  3CD6 P;  1VQ6 P;  2CNR A;  1DNY A;  3G1G A;  2PNG A;  2FHS C;  4PWV B;  5HVC A;  2KOQ A;  2KOD A;  2GDX A;  1IMQ A;  4U0F A;  1FR2 A;  2XT1 A;  4BPF A;  1L0I A;  1Q82 Q;  1YJW P;  2XZ1 C;  2KOR A;  2OTJ P;  2KOS A;  3CCS P;  2EFJ A;  1OR5 A;  2N6Y A;  1M6N A;  1M1K Q;  1VQK P;  2GYK A;  1EOQ A;  2JYL A;  4XFX A;  5HGL A;  3CCE P;  2FQ1 A;  2KGD A;  2K0Y A;  1KQS O;  2PEM A;  1K8A Q;  2QEX P;  2PEJ A;  1QRJ A;  2GZJ A;  2GZI A;  1Q81 Q;  4XRO A;  4NEO A;  1S72 P;  3CC7 P;  2LKI A;  2LOL A;  2ROQ A;  2VLP A;  2WPT A;  3GJN A;  4QKO A;  3G4S P;  2VSQ A;  2AVA A;  1NJI Q;  2FAE A;  4U0D A;  4U0C A;  5BS2 A;  3HZQ A;  2KGA A;  2K0X A;  1NQ4 A;  5I4T G;  3B5I A;  3U43 A;  2JAZ A;  1E6J P;  2QNW A;  2LIW A;  2ONT A;  4U0B A;  2M8P A;  2K92 A;  2PEO A;  2FQ0 A;  3NTE A;  2GZF A;  2L22 A;  2NO8 A;  3DS2 A;  1N8R Q;  2MF4 A;  2AFD A;  1IUQ A;  2MVV A;  3B4Q A;  2MR7 A;  2E1M A;  2M8N A;  2M5R A;  3EJB A;  1EMV A;  1UJZ A;  1QVG O;  1UNK A;  4U0E A;  2FVE A;  4COP A;  2BHV A;  1YJN P;  1Z6M A;  2MY5 A;  2L9F A;  3CME P;  3DS1 A;  1YIT P;  3MGE A;  4M0I A;  1KLP A;  3CMA P;  2JGP A;  1M90 Q;  1W2B O;  1D1D A;  2EHT A;  4H2X C;  1HQB A;  2FAC A;  3CC4 P;  3H4E A;  2PEN A;  4IPY A;  3GZM A;  2KG6 A;  3G6E P;  2X2B A;  1EIA A;  2L6E A;  1X3O A;  2ERH A;  4R0M A;  2MR8 A;  2N50 A;  3EJE A;  2KOP A;  1L0H A;  4PXH B;  1VQ5 P;  1VQ8 P;  3P05 A;  2JU2 A;  1RNI A;  2PY8 A;  2K93 A;  2FVA A;  2JO0 A;  5F2K A;  3CPW O;  1VQ9 P;  7CEI A;  2N98 A;  2K0D X;  1RO0 A;  2LL8 A;  3LMO A;  2DNW A;  2JYG A;  5HV8 A;  2KR5 A;  1K73 Q;  5KP6 B;  2LF4 A;  1VQN P;  1HY8 A;  2KG9 A;  1YI2 P;  1YJ9 P;  4XFZ A;  2PEQ A;  3I55 P;  1VQO P;  1RO2 A;  4U0A A;  2EIA A;  2L4B A;  2N6Z A;  5HGO A;  3G21 A;  4XRQ A;  1VQP P;  2P9X A;  1K30 A;  3G29 A;  1Q86 Q;  1VKU A;  3CCQ P;  3H47 A;  5BS1 A;  5F2N A;  4DG9 A;  3LRY A;  2CQ8 A;  2Z44 A;  2XV6 A;  1KD1 Q;  1JJ2 O;  2KGE A; 
#chains in the Genus database with same CATH homology
 2L9F A;  3RG2 A;  4H2Y C;  2MD9 A;  4CA3 A;  1KLP A;  2KOO A;  2K94 A;  2JGP A;  2FQ1 A;  2KGD A;  2K0Y A;  2AFE A;  2GDY A;  2EHT A;  2AF8 A;  2CGQ A;  4HKG A;  3EJD A;  4H2W C;  4H2X C;  1HQB A;  2LTE A;  2FAC A;  1DV5 A;  2N5H A;  3GZM A;  4BPG A;  2N5I A;  2JQ4 A;  2KG6 A;  2LML A;  3NY7 B;  2FAD A;  2X2B A;  2LPK A;  4NEO A;  1X3O A;  2LKI A;  4R0M A;  2MR8 A;  2CG5 B;  5KP8 B;  2N50 A;  3EJE A;  2KOP A;  1L0H A;  2KW2 A;  2LOL A;  2ROQ A;  4PXH B;  2VSQ A;  2AVA A;  5KP7 B;  2FAE A;  2JU2 A;  1AF8 A;  2FQ2 A;  2K93 A;  2FVA A;  4IZ6 A;  2EHS A;  2KGA A;  2K0X A;  1NQ4 A;  2LIU A;  4BPH A;  2N98 A;  2QNW A;  2LL8 A;  2LIW A;  2XZ0 D;  3LMO A;  2DNW A;  2KG8 A;  3GZL A;  1T8K A;  2MVU A;  2K92 A;  5HV8 A;  2JU1 A;  2KR5 A;  4MRT C;  2FQ0 A;  2L22 A;  5KP6 B;  2CNR A;  1DNY A;  1HY8 A;  2KG9 A;  2MF4 A;  2AFD A;  2MVV A;  2PNG A;  3CE7 A;  2FVF A;  2MR7 A;  2L4B A;  2N6Z A;  2FHS C;  5EJD A;  4PWV B;  5HVC A;  2KOQ A;  2M5R A;  2KWL A;  3EJB A;  2GDX A;  1F80 D;  1VKU A;  4BPF A;  1L0I A;  2L0Q A;  2KGC A;  4DG9 A;  2XZ1 C;  2KOR A;  1ACP A;  2FVE A;  2K2Q A;  2KOS A;  2CQ8 A;  5CZD B;  1OR5 A;  2GDW A;  2N6Y A;  2MY5 A;  2KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...