4PWVB

Structure of p450sky (cyp163b3), a cytochrome p450 from skyllamycin biosynthesis in complex with a peptidyl carrier protein domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
75
structure length
75
Chain Sequence
REPRNETESRLRRIFEEVLHSEDVDVEANFFELGGHSLQATKLVSRIRSEFDAELPLRDFFEHPNVAGLAVLIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P450 monooxygenase
publication title The structure of a transient complex of a nonribosomal Peptide synthetase and a cytochrome p450 monooxygenase.
pubmed doi rcsb
source organism Streptomyces sp. acta 2897
molecule tags Oxidoreductase/protein binding
total genus 22
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4pwvB00
2KORA 2JQ4A 4BPGA 4H2YC 2MR8A 2LPKA 2FVEA 2VSQA 2FQ2A 2MY5A 2L4BA 3RG2A 3EJEA 2KGEA 2KGCA 2EHTA 2L0QA 4H2XC 2L22A 2KOPA 2LL8A 3EJBA 2AFDA 2KGDA 2DNWA 1DV5A 2KOSA 2XZ1C 4H2WC 2N6YA 3GZMA 2MR7A 2CGQA 2LIUA 2AF8A 2N5HA 4DG9A 5HV8A 2JGPA 4MRTC 2AVAA 2XZ0D 2JU1A 1X3OA 1VKUA 2N50A 3NY7B 2GDYA 2K92A 4HKGA 2K93A 2FQ1A 2KG6A 1HY8A 1AF8A 1DNYA 2KG9A 1HQBA 2LIWA 2LKIA 2KW2A 2M5RA 1F80D 2CNRA 5HVCA 2N98A 2AFEA 4IZ6A 2K0YA 2N6ZA 4BPFA 2LTEA 2K94A 4NEOA 4BPHA 2L9FA 1KLPA 2FVAA 2KGAA 2EHSA 2FACA 2CG5B 2FQ0A 4CA3A 3LMOA 2KR5A 2K0XA 1NQ4A 2CQ8A 4PWVB 2MD9A 1L0IA 2MVUA 1OR5A 5EJDA 2LMLA 2K2QA 1L0HA 1ACPA 2GDXA 3CE7A 2FADA 2FAEA 4R0MA 2N5IA 5CZDB 2QNWA 2FVFA 3EJDA 1T8KA 2KOOA 2KWLA 2MVVA 2GDWA 4PXHB 2FHSC 2KG8A 2KOQA 5KP8B 2JU2A 5KP6B 3GZLA 2LOLA 2ROQA 2PNGA 5KP7B 2MF4A 2X2BA
chains in the Genus database with same CATH superfamily
1VQ4P 2JQ4A 4BPGA 1VQ5P 3DS3A 1UJZA 2VLOA 4U0FA 2PEQA 3CMEP 3EJEA 2KGCA 5DCKA 1M90Q 2KGDA 3DS4A 1VQ8P 2KOSA 1EOQA 1GPJA 2PEOA 3DTJA 4U0DA 3B5IA 2K5XA 2JBGA 2AVAA 1X3OA 2Z45A 1AUMA 2N50A 3NY7B 1FR2A 2JB0A 4HKGA 3CCEP 2KG6A 1GXHA 1HY8A 4PH0A 2LKIA 1K9MQ 2KW2A 1F80D 3P05A 2CNRA 1YHQP 4QNBA 3G6EP 1D1DA 2JYLA 3CCJP 2Z44A 4BPFA 2LTEA 1E0HA 2K94A 4NEOA 2L9FA 2PEMA 2EHSA 2FACA 1BAJA 3G26A 3CC2P 4UHPB 3WBHA 5BS2A 2MD9A 1OR5A 5EJDA 1ACPA 1E6JP 2DGYA 3DS2A 5CZDB 3GJNA 1KQSO 3EJDA 1VQMP 5HGLA 2MVVA 2GDWA 3CCMP 5KP6B 4XFYA 1VQPP 2X2BA 2MR8A 2K0DX 2FVEA 2P9XA 1ZMBA 2VSQA 2MY5A 2PEKA 2L4BA 5HGNA 2BHVA 1VQNP 1QVGO 2BUOA 2EHTA 4H2XC 2L22A 1RO2A 2KOPA 2LL8A 3CD6P 1UNKA 2AFDA 1A43A 2N6YA 2XT1A 3E2DA 4M0IA 2VLQA 3GZMA 3G0VA 1JJ2O 1IMPA 1ZNVA 3CCUP 2LIUA 3DS0A 2AF8A 5I4TG 3CCSP 1K30A 2GDYA 2KODA 3G21A 1YI2P 1CEIA 1MZ8A 2XXMA 1AF8A 1VHNA 1DNYA 2KG9A 4PH1A 2LIWA 2NO8A 2M5RA 1NJIQ 3DPHA 2N98A 4U0AA 2K0YA 2XV6A 3CCVP 4BPHA 2FVAA 3RG6C 2FQ0A 4CA3A 2K0XA 2CQ8A 4PWVB 2OTLP 1RO0A 1N8RQ 1L0HA 3I55P 3DS1A 4IPYA 4XFXA 2FADA 2FAEA 4R0MA 3H4EA 3HZQA 4U0CA 1S72P 2QNWA 2FVFA 1YJ9P 5EW5E 1YJWP 5F2OA 3CC4P 1IMQA 2PEIA 5KP8B 1VQ9P 2JU2A 2ROQA 4XRQA 4H2YC 2LPKA 3LRYA 3U43A 1Z6MA 1GXGA 2EFJA 3H47A 1M74A 1YIJP 2CWOA 3EJBA 2DNWA 1DV5A 2XZ1C 4H2WC 4COPA 1W2BO 1YJNP 2N5HA 4QKOA 2XZ0D 2JU1A 1M6NA 2K93A 2FQ1A 3CCLP 2VLPA 1A8OA 1VQ7P 2PY8A 3CCQP 3CC7P 1VQKP 3I56P 1VQOP 1BXIA 1HQBA 1IUQA 3VRLC 4F37A 5HVCA 5HGMA 1KLPA 1EMVA 3G29A 2GYKA 1VQLP 3GKLC 1K73Q 2EIAA 3B4QA 3NTEA 3LMOA 2GZGA 3G1GA 1K8AQ 3DS5A 2MVUA 3G71P 2LMLA 1EIAA 2QA4P 2GDXA 3CE7A 3CPWO 2EG5A 2OTJP 1VQ6P 2PENA 2KWLA 3G4SP 2FHSC 2KG8A 1M6EX 2VLNA 5KP7B 2JO0A 2MF4A 1QRJA 2KORA 2GZIA 5F2KA 3CMAP 2E1MA 3CXCO 7CEIA 4WYMA 2FQ2A 5BS1A 3RG2A 2KGEA 2L0QA 4COCA 2ERHA 3G28A 2PEJA 1QVFO 2JYGA 2QEXP 3M1MA 3OW2O 2MR7A 2CGQA 5HV8A 2JGPA 4MRTC 3MGEA 1VKUA 5HGOA 1M1KQ 1YITP 2L6EA 2K92A 1Q86Q 3G1IA 2GZEA 2GZJA 1Q81Q 3CCRP 4U0EA 2M8PA 4XFZA 2AFEA 4U0BA 4IZ6A 2JAZA 2N6ZA 3HYBA 2Z46A 1Q82Q 3H0DA 2KGAA 1KC8Q 4XROA 2CG5B 2KR5A 2WPTA 1NQ4A 2LF4A 1L0IA 2ONTA 2M8NA 2K2QA 2GZFA 2N5IA 1Q7YQ 1KD1Q 4GR6A 1T8KA 2KOOA 3Q20A 4GR2A 5JPAA 2M8LA 4PXHB 2KOQA 3GZLA 2LOLA 2PNGA 1RNIA 5F2NA 1AYIA 4DG9A 2OARA
chains in the Genus database with same CATH topology
2KORA 2JQ4A 4BPGA 4H2YC 2MR8A 2LPKA 2FVEA 2VSQA 2FQ2A 2MY5A 2L4BA 3RG2A 3EJEA 2KGEA 2KGCA 2EHTA 2L0QA 4H2XC 2L22A 2KOPA 2LL8A 3EJBA 2AFDA 2KGDA 2DNWA 1DV5A 2KOSA 2XZ1C 4H2WC 2N6YA 3GZMA 2MR7A 2CGQA 2LIUA 2AF8A 2N5HA 4DG9A 5HV8A 2JGPA 4MRTC 2AVAA 2XZ0D 2JU1A 1X3OA 1VKUA 2N50A 3NY7B 2GDYA 2K92A 4HKGA 2K93A 2FQ1A 2KG6A 1HY8A 1AF8A 1DNYA 2KG9A 1HQBA 2LIWA 2LKIA 2KW2A 2M5RA 1F80D 2CNRA 5HVCA 2N98A 2AFEA 4IZ6A 2K0YA 2N6ZA 4BPFA 2LTEA 2K94A 4NEOA 4BPHA 2L9FA 1KLPA 2FVAA 2KGAA 2EHSA 2FACA 2CG5B 2FQ0A 4CA3A 3LMOA 2KR5A 2K0XA 1NQ4A 2CQ8A 4PWVB 2MD9A 1L0IA 2MVUA 1OR5A 5EJDA 2LMLA 2K2QA 1L0HA 1ACPA 2GDXA 3CE7A 2FADA 2FAEA 4R0MA 2N5IA 5CZDB 2QNWA 2FVFA 3EJDA 1T8KA 2KOOA 2KWLA 2MVVA 2GDWA 4PXHB 2FHSC 2KG8A 2KOQA 5KP8B 2JU2A 5KP6B 3GZLA 2LOLA 2ROQA 2PNGA 5KP7B 2MF4A 2X2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  2JQ4 A;  4BPG A;  4H2Y C;  2MR8 A;  2LPK A;  2FVE A;  2VSQ A;  2FQ2 A;  2MY5 A;  2L4B A;  3RG2 A;  3EJE A;  2KGE A;  2KGC A;  2EHT A;  2L0Q A;  4H2X C;  2L22 A;  2KOP A;  2LL8 A;  3EJB A;  2AFD A;  2KGD A;  2DNW A;  1DV5 A;  2KOS A;  2XZ1 C;  4H2W C;  2N6Y A;  3GZM A;  2MR7 A;  2CGQ A;  2LIU A;  2AF8 A;  2N5H A;  4DG9 A;  5HV8 A;  2JGP A;  4MRT C;  2AVA A;  2XZ0 D;  2JU1 A;  1X3O A;  1VKU A;  2N50 A;  3NY7 B;  2GDY A;  2K92 A;  4HKG A;  2K93 A;  2FQ1 A;  2KG6 A;  1HY8 A;  1AF8 A;  1DNY A;  2KG9 A;  1HQB A;  2LIW A;  2LKI A;  2KW2 A;  2M5R A;  1F80 D;  2CNR A;  5HVC A;  2N98 A;  2AFE A;  4IZ6 A;  2K0Y A;  2N6Z A;  4BPF A;  2LTE A;  2K94 A;  4NEO A;  4BPH A;  2L9F A;  1KLP A;  2FVA A;  2KGA A;  2EHS A;  2FAC A;  2CG5 B;  2FQ0 A;  4CA3 A;  3LMO A;  2KR5 A;  2K0X A;  1NQ4 A;  2CQ8 A;  4PWV B;  2MD9 A;  1L0I A;  2MVU A;  1OR5 A;  5EJD A;  2LML A;  2K2Q A;  1L0H A;  1ACP A;  2GDX A;  3CE7 A;  2FAD A;  2FAE A;  4R0M A;  2N5I A;  5CZD B;  2QNW A;  2FVF A;  3EJD A;  1T8K A;  2KOO A;  2KWL A;  2MVV A;  2GDW A;  4PXH B;  2FHS C;  2KG8 A;  2KOQ A;  5KP8 B;  2JU2 A;  5KP6 B;  3GZL A;  2LOL A;  2ROQ A;  2PNG A;  5KP7 B;  2MF4 A;  2X2B A; 
#chains in the Genus database with same CATH topology
 1VQ4 P;  2JQ4 A;  4BPG A;  1VQ5 P;  3DS3 A;  1UJZ A;  2VLO A;  4U0F A;  2PEQ A;  3CME P;  3EJE A;  2KGC A;  5DCK A;  1M90 Q;  2KGD A;  3DS4 A;  1VQ8 P;  2KOS A;  1EOQ A;  1GPJ A;  2PEO A;  3DTJ A;  4U0D A;  3B5I A;  2K5X A;  2JBG A;  2AVA A;  1X3O A;  2Z45 A;  1AUM A;  2N50 A;  3NY7 B;  1FR2 A;  2JB0 A;  4HKG A;  3CCE P;  2KG6 A;  1GXH A;  1HY8 A;  4PH0 A;  2LKI A;  1K9M Q;  2KW2 A;  1F80 D;  3P05 A;  2CNR A;  1YHQ P;  4QNB A;  3G6E P;  1D1D A;  2JYL A;  3CCJ P;  2Z44 A;  4BPF A;  2LTE A;  1E0H A;  2K94 A;  4NEO A;  2L9F A;  2PEM A;  2EHS A;  2FAC A;  1BAJ A;  3G26 A;  3CC2 P;  4UHP B;  3WBH A;  5BS2 A;  2MD9 A;  1OR5 A;  5EJD A;  1ACP A;  1E6J P;  2DGY A;  3DS2 A;  5CZD B;  3GJN A;  1KQS O;  3EJD A;  1VQM P;  5HGL A;  2MVV A;  2GDW A;  3CCM P;  5KP6 B;  4XFY A;  1VQP P;  2X2B A;  2MR8 A;  2K0D X;  2FVE A;  2P9X A;  1ZMB A;  2VSQ A;  2MY5 A;  2PEK A;  2L4B A;  5HGN A;  2BHV A;  1VQN P;  1QVG O;  2BUO A;  2EHT A;  4H2X C;  2L22 A;  1RO2 A;  2KOP A;  2LL8 A;  3CD6 P;  1UNK A;  2AFD A;  1A43 A;  2N6Y A;  2XT1 A;  3E2D A;  4M0I A;  2VLQ A;  3GZM A;  3G0V A;  1JJ2 O;  1IMP A;  1ZNV A;  3CCU P;  2LIU A;  3DS0 A;  2AF8 A;  5I4T G;  3CCS P;  1K30 A;  2GDY A;  2KOD A;  3G21 A;  1YI2 P;  1CEI A;  1MZ8 A;  2XXM A;  1AF8 A;  1VHN A;  1DNY A;  2KG9 A;  4PH1 A;  2LIW A;  2NO8 A;  2M5R A;  1NJI Q;  3DPH A;  2N98 A;  4U0A A;  2K0Y A;  2XV6 A;  3CCV P;  4BPH A;  2FVA A;  3RG6 C;  2FQ0 A;  4CA3 A;  2K0X A;  2CQ8 A;  4PWV B;  2OTL P;  1RO0 A;  1N8R Q;  1L0H A;  3I55 P;  3DS1 A;  4IPY A;  4XFX A;  2FAD A;  2FAE A;  4R0M A;  3H4E A;  3HZQ A;  4U0C A;  1S72 P;  2QNW A;  2FVF A;  1YJ9 P;  5EW5 E;  1YJW P;  5F2O A;  3CC4 P;  1IMQ A;  2PEI A;  5KP8 B;  1VQ9 P;  2JU2 A;  2ROQ A;  4XRQ A;  4H2Y C;  2LPK A;  3LRY A;  3U43 A;  1Z6M A;  1GXG A;  2EFJ A;  3H47 A;  1M74 A;  1YIJ P;  2CWO A;  3EJB A;  2DNW A;  1DV5 A;  2XZ1 C;  4H2W C;  4COP A;  1W2B O;  1YJN P;  2N5H A;  4QKO A;  2XZ0 D;  2JU1 A;  1M6N A;  2K93 A;  2FQ1 A;  3CCL P;  2VLP A;  1A8O A;  1VQ7 P;  2PY8 A;  3CCQ P;  3CC7 P;  1VQK P;  3I56 P;  1VQO P;  1BXI A;  1HQB A;  1IUQ A;  3VRL C;  4F37 A;  5HVC A;  5HGM A;  1KLP A;  1EMV A;  3G29 A;  2GYK A;  1VQL P;  3GKL C;  1K73 Q;  2EIA A;  3B4Q A;  3NTE A;  3LMO A;  2GZG A;  3G1G A;  1K8A Q;  3DS5 A;  2MVU A;  3G71 P;  2LML A;  1EIA A;  2QA4 P;  2GDX A;  3CE7 A;  3CPW O;  2EG5 A;  2OTJ P;  1VQ6 P;  2PEN A;  2KWL A;  3G4S P;  2FHS C;  2KG8 A;  1M6E X;  2VLN A;  5KP7 B;  2JO0 A;  2MF4 A;  1QRJ A;  2KOR A;  2GZI A;  5F2K A;  3CMA P;  2E1M A;  3CXC O;  7CEI A;  4WYM A;  2FQ2 A;  5BS1 A;  3RG2 A;  2KGE A;  2L0Q A;  4COC A;  2ERH A;  3G28 A;  2PEJ A;  1QVF O;  2JYG A;  2QEX P;  3M1M A;  3OW2 O;  2MR7 A;  2CGQ A;  5HV8 A;  2JGP A;  4MRT C;  3MGE A;  1VKU A;  5HGO A;  1M1K Q;  1YIT P;  2L6E A;  2K92 A;  1Q86 Q;  3G1I A;  2GZE A;  2GZJ A;  1Q81 Q;  3CCR P;  4U0E A;  2M8P A;  4XFZ A;  2AFE A;  4U0B A;  4IZ6 A;  2JAZ A;  2N6Z A;  3HYB A;  2Z46 A;  1Q82 Q;  3H0D A;  2KGA A;  1KC8 Q;  4XRO A;  2CG5 B;  2KR5 A;  2WPT A;  1NQ4 A;  2LF4 A;  1L0I A;  2ONT A;  2M8N A;  2K2Q A;  2GZF A;  2N5I A;  1Q7Y Q;  1KD1 Q;  4GR6 A;  1T8K A;  2KOO A;  3Q20 A;  4GR2 A;  5JPA A;  2M8L A;  4PXH B;  2KOQ A;  3GZL A;  2LOL A;  2PNG A;  1RNI A;  5F2N A;  1AYI A;  4DG9 A;  2OAR A; 
#chains in the Genus database with same CATH homology
 2KOR A;  2JQ4 A;  4BPG A;  4H2Y C;  2MR8 A;  2LPK A;  2FVE A;  2VSQ A;  2FQ2 A;  2MY5 A;  2L4B A;  3RG2 A;  3EJE A;  2KGE A;  2KGC A;  2EHT A;  2L0Q A;  4H2X C;  2L22 A;  2KOP A;  2LL8 A;  3EJB A;  2AFD A;  2KGD A;  2DNW A;  1DV5 A;  2KOS A;  2XZ1 C;  4H2W C;  2N6Y A;  3GZM A;  2MR7 A;  2CGQ A;  2LIU A;  2AF8 A;  2N5H A;  4DG9 A;  5HV8 A;  2JGP A;  4MRT C;  2AVA A;  2XZ0 D;  2JU1 A;  1X3O A;  1VKU A;  2N50 A;  3NY7 B;  2GDY A;  2K92 A;  4HKG A;  2K93 A;  2FQ1 A;  2KG6 A;  1HY8 A;  1AF8 A;  1DNY A;  2KG9 A;  1HQB A;  2LIW A;  2LKI A;  2KW2 A;  2M5R A;  1F80 D;  2CNR A;  5HVC A;  2N98 A;  2AFE A;  4IZ6 A;  2K0Y A;  2N6Z A;  4BPF A;  2LTE A;  2K94 A;  4NEO A;  4BPH A;  2L9F A;  1KLP A;  2FVA A;  2KGA A;  2EHS A;  2FAC A;  2CG5 B;  2FQ0 A;  4CA3 A;  3LMO A;  2KR5 A;  2K0X A;  1NQ4 A;  2CQ8 A;  4PWV B;  2MD9 A;  1L0I A;  2MVU A;  1OR5 A;  5EJD A;  2LML A;  2K2Q A;  1L0H A;  1ACP A;  2GDX A;  3CE7 A;  2FAD A;  2FAE A;  4R0M A;  2N5I A;  5CZD B;  2QNW A;  2FVF A;  3EJD A;  1T8K A;  2KOO A;  2KWL A;  2MVV A;  2GDW A;  4PXH B;  2FHS C;  2KG8 A;  2KOQ A;  5KP8 B;  2JU2 A;  5KP6 B;  3GZL A;  2LOL A;  2ROQ A;  2PNG A;  5KP7 B;  2MF4 A;  2X2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...