3B4QA

Crystal structure of a conserved protein domain (unknown function) from corynebacterium diphtheriae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
LNSAPTPRDVVANAPAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRLAGGIPPQIEAFYQANRTNFNGFYMANRGAIDFIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The structure of a conserved protein domain (unknown function) from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae nctc 13129
molecule tags Structural genomics, unknown function
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.100 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A conserved protein domain from corynebacterium diphtheriae 3b4qA00
3B4QA
chains in the Genus database with same CATH superfamily
2BUOA 3RG6C 2LIWA 1KLPA 2XXMA 3Q20A 3EJEA 3HZQA 2VLQA 2ROQA 4XFZA 2PNGA 4UHPB 1YIJP 4IPYA 2JBGA 5HGLA 2FVAA 3NY7B 5HGOA 3DS0A 1EOQA 2N6YA 4GR6A 1M90Q 2CWOA 3MGEA 1DV5A 3G71P 1K30A 1JJ2O 1M74A 1VQ4P 2CNRA 2KWLA 1OR5A 2MF4A 3LRYA 5HV8A 2GDXA 1VQNP 2N50A 2AFEA 1YHQP 2PENA 1Q86Q 2QNWA 4H2XC 1QVGO 1IUQA 2WPTA 5F2OA 2K0YA 1YJWP 2KG9A 2K92A 4NEOA 1IMQA 3DTJA 2GZGA 2KORA 1VQ5P 1M6NA 4F37A 2AVAA 2KGCA 4U0CA 3H0DA 4XFYA 1UJZA 3U43A 5EJDA 3G4SP 1A43A 1Q82Q 2KOPA 3P05A 3I55P 2N98A 1X3OA 2ERHA 2MVUA 2MVVA 2LTEA 2MY5A 2GDWA 2LF4A 2KOSA 2N5IA 1GXGA 2QA4P 1DNYA 4U0FA 1VQKP 3HYBA 4PWVB 2JYGA 2FVEA 2ONTA 2VLOA 5KP8B 1RNIA 2XZ1C 1L0IA 1K8AQ 2FQ0A 2FACA 1VQ9P 5KP6B 2CQ8A 3G28A 2K93A 4U0BA 5KP7B 3H47A 1GPJA 1VQPP 2N5HA 1E6JP 1S72P 2L0QA 5BS1A 5EW5E 2FAEA 2KOOA 3G1GA 1VQ8P 3NTEA 5F2KA 2LOLA 2VLNA 2OARA 5JPAA 2JGPA 2EIAA 3G1IA 3G29A 2EHSA 1K73Q 3CC2P 4BPHA 4MRTC 1VQ6P 3G6EP 7CEIA 1BAJA 1YITP 2XT1A 4XROA 2MD9A 2KGEA 2JQ4A 2X2BA 2KW2A 5HGNA 4H2YC 1HQBA 1EMVA 2NO8A 2JO0A 1ACPA 1W2BO 3CCSP 3CPWO 4BPFA 2K0DX 4HKGA 2FHSC 1F80D 3G21A 2P9XA 1HY8A 3CCLP 2AF8A 2EFJA 1MZ8A 1YI2P 3CCQP 2Z44A 3CD6P 2MR7A 2OTLP 2K2QA 2PEMA 2KGDA 1AYIA 3CC7P 4XRQA 3CCVP 2JU1A 2KGAA 2JAZA 3CXCO 3EJDA 1VQ7P 4M0IA 1KD1Q 2L6EA 1K9MQ 2FVFA 3CCJP 2AFDA 2XZ0D 3LMOA 3DS2A 4R0MA 3B5IA 4GR2A 2PEJA 2JU2A 2LKIA 1CEIA 2CG5B 3CCEP 2FADA 1NJIQ 3VRLC 2PEOA 2KR5A 1GXHA 4CA3A 2EHTA 5HGMA 4QKOA 3DS3A 3G0VA 3GZLA 4XFXA 2PEQA 2L22A 2GZEA 4PH1A 1M6EX 1KC8Q 2KG6A 1VQOP 5CZDB 3G26A 1AF8A 4U0AA 1KQSO 1VQLP 3E2DA 2PEIA 1NQ4A 1VHNA 2L9FA 5BS2A 1E0HA 1M1KQ 1VKUA 2FQ1A 4U0EA 4PH0A 2VLPA 3EJBA 2M8PA 1A8OA 2LIUA 1VQMP 2BHVA 3CC4P 3CE7A 1RO2A 2QEXP 3H4EA 2K5XA 3I56P 2KG8A 1YJ9P 4WYMA 2M8LA 1EIAA 1YJNP 1Q7YQ 2GDYA 3RG2A 1L0HA 2GYKA 3M1MA 2E1MA 2N6ZA 3DPHA 3B4QA 2K0XA 4PXHB 2XV6A 2M5RA 3DS1A 1AUMA 2EG5A 2K94A 3CMEP 4H2WC 3CCUP 1UNKA 2DGYA 5HVCA 2JB0A 2LPKA 1N8RQ 2KODA 3GJNA 2KOQA 2LL8A 2JYLA 2L4BA 1QRJA 1FR2A 2GZJA 2VSQA 3CCRP 3DS5A 1D1DA 4QNBA 3GKLC 2MR8A 2LMLA 5F2NA 4DG9A 1ZMBA 2Z45A 3OW2O 2Z46A 2OTJP 2GZFA 2PY8A 4IZ6A 5DCKA 4COPA 4COCA 5I4TG 1T8KA 1IMPA 2M8NA 2PEKA 3CCMP 1BXIA 4BPGA 2FQ2A 1RO0A 3CMAP 1Z6MA 2DNWA 3WBHA 3DS4A 1ZNVA 2GZIA 4U0DA 3GZMA 1Q81Q 2CGQA 1QVFO
chains in the Genus database with same CATH topology
3B4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4Q A; 
#chains in the Genus database with same CATH topology
 2BUO A;  3RG6 C;  2LIW A;  1KLP A;  2XXM A;  3Q20 A;  3EJE A;  3HZQ A;  2VLQ A;  2ROQ A;  4XFZ A;  2PNG A;  4UHP B;  1YIJ P;  4IPY A;  2JBG A;  5HGL A;  2FVA A;  3NY7 B;  5HGO A;  3DS0 A;  1EOQ A;  2N6Y A;  4GR6 A;  1M90 Q;  2CWO A;  3MGE A;  1DV5 A;  3G71 P;  1K30 A;  1JJ2 O;  1M74 A;  1VQ4 P;  2CNR A;  2KWL A;  1OR5 A;  2MF4 A;  3LRY A;  5HV8 A;  2GDX A;  1VQN P;  2N50 A;  2AFE A;  1YHQ P;  2PEN A;  1Q86 Q;  2QNW A;  4H2X C;  1QVG O;  1IUQ A;  2WPT A;  5F2O A;  2K0Y A;  1YJW P;  2KG9 A;  2K92 A;  4NEO A;  1IMQ A;  3DTJ A;  2GZG A;  2KOR A;  1VQ5 P;  1M6N A;  4F37 A;  2AVA A;  2KGC A;  4U0C A;  3H0D A;  4XFY A;  1UJZ A;  3U43 A;  5EJD A;  3G4S P;  1A43 A;  1Q82 Q;  2KOP A;  3P05 A;  3I55 P;  2N98 A;  1X3O A;  2ERH A;  2MVU A;  2MVV A;  2LTE A;  2MY5 A;  2GDW A;  2LF4 A;  2KOS A;  2N5I A;  1GXG A;  2QA4 P;  1DNY A;  4U0F A;  1VQK P;  3HYB A;  4PWV B;  2JYG A;  2FVE A;  2ONT A;  2VLO A;  5KP8 B;  1RNI A;  2XZ1 C;  1L0I A;  1K8A Q;  2FQ0 A;  2FAC A;  1VQ9 P;  5KP6 B;  2CQ8 A;  3G28 A;  2K93 A;  4U0B A;  5KP7 B;  3H47 A;  1GPJ A;  1VQP P;  2N5H A;  1E6J P;  1S72 P;  2L0Q A;  5BS1 A;  5EW5 E;  2FAE A;  2KOO A;  3G1G A;  1VQ8 P;  3NTE A;  5F2K A;  2LOL A;  2VLN A;  2OAR A;  5JPA A;  2JGP A;  2EIA A;  3G1I A;  3G29 A;  2EHS A;  1K73 Q;  3CC2 P;  4BPH A;  4MRT C;  1VQ6 P;  3G6E P;  7CEI A;  1BAJ A;  1YIT P;  2XT1 A;  4XRO A;  2MD9 A;  2KGE A;  2JQ4 A;  2X2B A;  2KW2 A;  5HGN A;  4H2Y C;  1HQB A;  1EMV A;  2NO8 A;  2JO0 A;  1ACP A;  1W2B O;  3CCS P;  3CPW O;  4BPF A;  2K0D X;  4HKG A;  2FHS C;  1F80 D;  3G21 A;  2P9X A;  1HY8 A;  3CCL P;  2AF8 A;  2EFJ A;  1MZ8 A;  1YI2 P;  3CCQ P;  2Z44 A;  3CD6 P;  2MR7 A;  2OTL P;  2K2Q A;  2PEM A;  2KGD A;  1AYI A;  3CC7 P;  4XRQ A;  3CCV P;  2JU1 A;  2KGA A;  2JAZ A;  3CXC O;  3EJD A;  1VQ7 P;  4M0I A;  1KD1 Q;  2L6E A;  1K9M Q;  2FVF A;  3CCJ P;  2AFD A;  2XZ0 D;  3LMO A;  3DS2 A;  4R0M A;  3B5I A;  4GR2 A;  2PEJ A;  2JU2 A;  2LKI A;  1CEI A;  2CG5 B;  3CCE P;  2FAD A;  1NJI Q;  3VRL C;  2PEO A;  2KR5 A;  1GXH A;  4CA3 A;  2EHT A;  5HGM A;  4QKO A;  3DS3 A;  3G0V A;  3GZL A;  4XFX A;  2PEQ A;  2L22 A;  2GZE A;  4PH1 A;  1M6E X;  1KC8 Q;  2KG6 A;  1VQO P;  5CZD B;  3G26 A;  1AF8 A;  4U0A A;  1KQS O;  1VQL P;  3E2D A;  2PEI A;  1NQ4 A;  1VHN A;  2L9F A;  5BS2 A;  1E0H A;  1M1K Q;  1VKU A;  2FQ1 A;  4U0E A;  4PH0 A;  2VLP A;  3EJB A;  2M8P A;  1A8O A;  2LIU A;  1VQM P;  2BHV A;  3CC4 P;  3CE7 A;  1RO2 A;  2QEX P;  3H4E A;  2K5X A;  3I56 P;  2KG8 A;  1YJ9 P;  4WYM A;  2M8L A;  1EIA A;  1YJN P;  1Q7Y Q;  2GDY A;  3RG2 A;  1L0H A;  2GYK A;  3M1M A;  2E1M A;  2N6Z A;  3DPH A;  3B4Q A;  2K0X A;  4PXH B;  2XV6 A;  2M5R A;  3DS1 A;  1AUM A;  2EG5 A;  2K94 A;  3CME P;  4H2W C;  3CCU P;  1UNK A;  2DGY A;  5HVC A;  2JB0 A;  2LPK A;  1N8R Q;  2KOD A;  3GJN A;  2KOQ A;  2LL8 A;  2JYL A;  2L4B A;  1QRJ A;  1FR2 A;  2GZJ A;  2VSQ A;  3CCR P;  3DS5 A;  1D1D A;  4QNB A;  3GKL C;  2MR8 A;  2LML A;  5F2N A;  4DG9 A;  1ZMB A;  2Z45 A;  3OW2 O;  2Z46 A;  2OTJ P;  2GZF A;  2PY8 A;  4IZ6 A;  5DCK A;  4COP A;  4COC A;  5I4T G;  1T8K A;  1IMP A;  2M8N A;  2PEK A;  3CCM P;  1BXI A;  4BPG A;  2FQ2 A;  1RO0 A;  3CMA P;  1Z6M A;  2DNW A;  3WBH A;  3DS4 A;  1ZNV A;  2GZI A;  4U0D A;  3GZM A;  1Q81 Q;  2CGQ A;  1QVF O; 
#chains in the Genus database with same CATH homology
 3B4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...