3B4QA

Crystal structure of a conserved protein domain (unknown function) from corynebacterium diphtheriae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
LNSAPTPRDVVANAPAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRLAGGIPPQIEAFYQANRTNFNGFYMANRGAIDFIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of a conserved protein domain (unknown function) from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae nctc 13129
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.100 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A conserved protein domain from corynebacterium diphtheriae 3b4qA00
3B4QA
chains in the Genus database with same CATH superfamily
4MRTC 7CEIA 2Z44A 2KWLA 2PEOA 1VHNA 2L22A 2KOSA 2K2QA 4PXHB 2AF8A 2LKIA 1BXIA 1RNIA 1Q81Q 2KORA 1YI2P 3CE7A 1AF8A 3CMEP 2EFJA 1GXHA 2PEKA 2FVFA 2GDYA 5F2KA 4BPHA 2PEMA 2KGDA 2JYLA 2N6YA 5HVCA 2N98A 2L0QA 2KW2A 2OARA 4H2WC 3MGEA 1RO2A 2K94A 1KLPA 2FADA 3CCSP 3GJNA 3H47A 2QEXP 1YJWP 2K5XA 4COPA 2MR8A 5EW5E 1Q86Q 3G26A 3G21A 2JU2A 3CXCO 4CA3A 4COCA 2JGPA 2KGCA 1DV5A 1YITP 4U0FA 5DCKA 3CCLP 2PEIA 2MD9A 5I4TG 3LMOA 2VLOA 1KC8Q 1VQ9P 2GZJA 1F80D 3EJBA 5BS1A 2GDXA 2PENA 2PEQA 1A43A 3E2DA 2ERHA 4H2XC 2JYGA 1K73Q 2AFDA 2VLNA 3Q20A 4DG9A 2JU1A 1VQ6P 3CCMP 4PH0A 4QNBA 2KOOA 4NEOA 3CCRP 4GR2A 2BHVA 4U0AA 3RG2A 4M0IA 1QRJA 3GKLC 2CNRA 2FACA 2K0DX 3CCUP 1VKUA 2QNWA 1DNYA 1JJ2O 1AYIA 2MVVA 1YJ9P 5KP8B 4PWVB 2Z45A 2VLQA 2X2BA 2M5RA 4R0MA 3DPHA 3I55P 1M6EX 2M8PA 5JPAA 3CD6P 5EJDA 3CCEP 4XRQA 4XROA 2LIUA 1IMPA 3EJEA 3CC7P 2KG6A 4HKGA 5HGMA 4BPFA 2DGYA 3CC2P 1ACPA 1EOQA 3B4QA 2K93A 4GR6A 2KOPA 3I56P 1EMVA 3G71P 1UNKA 2CGQA 1K30A 4U0BA 2JBGA 5HGNA 2EHSA 2PNGA 3CC4P 2K0XA 5F2OA 2GZIA 1Z6MA 2KGEA 1HQBA 4F37A 2ROQA 2OTLP 1Q82Q 5CZDB 2MY5A 4WYMA 1E6JP 2FQ1A 4XFZA 5KP7B 2XV6A 2MR7A 1L0HA 2FQ0A 5KP6B 3NTEA 4QKOA 2N50A 2FVEA 2KG9A 2AVAA 2LOLA 1QVGO 5BS2A 3CMAP 1EIAA 3CCJP 3P05A 3GZLA 3HZQA 1VQ7P 1VQKP 1VQNP 3DS2A 2KGAA 2WPTA 3DS5A 1YIJP 3H0DA 1E0HA 1CEIA 3DS1A 1T8KA 2N5HA 3DS4A 2AFEA 4BPGA 4XFYA 1VQMP 1S72P 1IUQA 1D1DA 3LRYA 3EJDA 1YJNP 2JQ4A 3HYBA 2KODA 2GZGA 2K92A 2MVUA 1KQSO 2BUOA 1BAJA 4XFXA 2GYKA 1VQOP 5HGLA 1GXGA 2CWOA 3RG6C 2L9FA 2FQ2A 1K8AQ 2GDWA 2LIWA 2XXMA 2M8LA 2JO0A 4H2YC 2N6ZA 5F2NA 3OW2O 2VLPA 2L4BA 1OR5A 2VSQA 3G6EP 2CQ8A 2JB0A 1NJIQ 2GZEA 2KOQA 4IPYA 2LF4A 1M6NA 3G1IA 1QVFO 2Z46A 1ZNVA 1GPJA 1K9MQ 3VRLC 2GZFA 1UJZA 1M90Q 3DS3A 5HGOA 3G4SP 1X3OA 2XT1A 3M1MA 1HY8A 1Q7YQ 2FAEA 1RO0A 1VQLP 2DNWA 2FVAA 1N8RQ 2P9XA 3G0VA 2LTEA 4IZ6A 3DTJA 3WBHA 2CG5B 3NY7B 2E1MA 3G1GA 4U0CA 4UHPB 1NQ4A 1FR2A 1ZMBA 1VQ5P 2LL8A 2OTJP 4PH1A 3B5IA 1VQ8P 2XZ0D 3U43A 5HV8A 1M1KQ 2JAZA 1MZ8A 2KG8A 2K0YA 3H4EA 4U0DA 2KR5A 3G29A 2QA4P 3DS0A 2LMLA 2EIAA 2EHTA 1VQ4P 2L6EA 3GZMA 2XZ1C 1VQPP 3CPWO 3CCVP 1W2BO 2M8NA 2MF4A 3G28A 2LPKA 1YHQP 2ONTA 3CCQP 1AUMA 2N5IA 2FHSC 2EG5A 1KD1Q 1IMQA 2PY8A 2PEJA 1M74A 1A8OA 1L0IA 2NO8A 4U0EA
chains in the Genus database with same CATH topology
3B4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4Q A; 
#chains in the Genus database with same CATH topology
 4MRT C;  7CEI A;  2Z44 A;  2KWL A;  2PEO A;  1VHN A;  2L22 A;  2KOS A;  2K2Q A;  4PXH B;  2AF8 A;  2LKI A;  1BXI A;  1RNI A;  1Q81 Q;  2KOR A;  1YI2 P;  3CE7 A;  1AF8 A;  3CME P;  2EFJ A;  1GXH A;  2PEK A;  2FVF A;  2GDY A;  5F2K A;  4BPH A;  2PEM A;  2KGD A;  2JYL A;  2N6Y A;  5HVC A;  2N98 A;  2L0Q A;  2KW2 A;  2OAR A;  4H2W C;  3MGE A;  1RO2 A;  2K94 A;  1KLP A;  2FAD A;  3CCS P;  3GJN A;  3H47 A;  2QEX P;  1YJW P;  2K5X A;  4COP A;  2MR8 A;  5EW5 E;  1Q86 Q;  3G26 A;  3G21 A;  2JU2 A;  3CXC O;  4CA3 A;  4COC A;  2JGP A;  2KGC A;  1DV5 A;  1YIT P;  4U0F A;  5DCK A;  3CCL P;  2PEI A;  2MD9 A;  5I4T G;  3LMO A;  2VLO A;  1KC8 Q;  1VQ9 P;  2GZJ A;  1F80 D;  3EJB A;  5BS1 A;  2GDX A;  2PEN A;  2PEQ A;  1A43 A;  3E2D A;  2ERH A;  4H2X C;  2JYG A;  1K73 Q;  2AFD A;  2VLN A;  3Q20 A;  4DG9 A;  2JU1 A;  1VQ6 P;  3CCM P;  4PH0 A;  4QNB A;  2KOO A;  4NEO A;  3CCR P;  4GR2 A;  2BHV A;  4U0A A;  3RG2 A;  4M0I A;  1QRJ A;  3GKL C;  2CNR A;  2FAC A;  2K0D X;  3CCU P;  1VKU A;  2QNW A;  1DNY A;  1JJ2 O;  1AYI A;  2MVV A;  1YJ9 P;  5KP8 B;  4PWV B;  2Z45 A;  2VLQ A;  2X2B A;  2M5R A;  4R0M A;  3DPH A;  3I55 P;  1M6E X;  2M8P A;  5JPA A;  3CD6 P;  5EJD A;  3CCE P;  4XRQ A;  4XRO A;  2LIU A;  1IMP A;  3EJE A;  3CC7 P;  2KG6 A;  4HKG A;  5HGM A;  4BPF A;  2DGY A;  3CC2 P;  1ACP A;  1EOQ A;  3B4Q A;  2K93 A;  4GR6 A;  2KOP A;  3I56 P;  1EMV A;  3G71 P;  1UNK A;  2CGQ A;  1K30 A;  4U0B A;  2JBG A;  5HGN A;  2EHS A;  2PNG A;  3CC4 P;  2K0X A;  5F2O A;  2GZI A;  1Z6M A;  2KGE A;  1HQB A;  4F37 A;  2ROQ A;  2OTL P;  1Q82 Q;  5CZD B;  2MY5 A;  4WYM A;  1E6J P;  2FQ1 A;  4XFZ A;  5KP7 B;  2XV6 A;  2MR7 A;  1L0H A;  2FQ0 A;  5KP6 B;  3NTE A;  4QKO A;  2N50 A;  2FVE A;  2KG9 A;  2AVA A;  2LOL A;  1QVG O;  5BS2 A;  3CMA P;  1EIA A;  3CCJ P;  3P05 A;  3GZL A;  3HZQ A;  1VQ7 P;  1VQK P;  1VQN P;  3DS2 A;  2KGA A;  2WPT A;  3DS5 A;  1YIJ P;  3H0D A;  1E0H A;  1CEI A;  3DS1 A;  1T8K A;  2N5H A;  3DS4 A;  2AFE A;  4BPG A;  4XFY A;  1VQM P;  1S72 P;  1IUQ A;  1D1D A;  3LRY A;  3EJD A;  1YJN P;  2JQ4 A;  3HYB A;  2KOD A;  2GZG A;  2K92 A;  2MVU A;  1KQS O;  2BUO A;  1BAJ A;  4XFX A;  2GYK A;  1VQO P;  5HGL A;  1GXG A;  2CWO A;  3RG6 C;  2L9F A;  2FQ2 A;  1K8A Q;  2GDW A;  2LIW A;  2XXM A;  2M8L A;  2JO0 A;  4H2Y C;  2N6Z A;  5F2N A;  3OW2 O;  2VLP A;  2L4B A;  1OR5 A;  2VSQ A;  3G6E P;  2CQ8 A;  2JB0 A;  1NJI Q;  2GZE A;  2KOQ A;  4IPY A;  2LF4 A;  1M6N A;  3G1I A;  1QVF O;  2Z46 A;  1ZNV A;  1GPJ A;  1K9M Q;  3VRL C;  2GZF A;  1UJZ A;  1M90 Q;  3DS3 A;  5HGO A;  3G4S P;  1X3O A;  2XT1 A;  3M1M A;  1HY8 A;  1Q7Y Q;  2FAE A;  1RO0 A;  1VQL P;  2DNW A;  2FVA A;  1N8R Q;  2P9X A;  3G0V A;  2LTE A;  4IZ6 A;  3DTJ A;  3WBH A;  2CG5 B;  3NY7 B;  2E1M A;  3G1G A;  4U0C A;  4UHP B;  1NQ4 A;  1FR2 A;  1ZMB A;  1VQ5 P;  2LL8 A;  2OTJ P;  4PH1 A;  3B5I A;  1VQ8 P;  2XZ0 D;  3U43 A;  5HV8 A;  1M1K Q;  2JAZ A;  1MZ8 A;  2KG8 A;  2K0Y A;  3H4E A;  4U0D A;  2KR5 A;  3G29 A;  2QA4 P;  3DS0 A;  2LML A;  2EIA A;  2EHT A;  1VQ4 P;  2L6E A;  3GZM A;  2XZ1 C;  1VQP P;  3CPW O;  3CCV P;  1W2B O;  2M8N A;  2MF4 A;  3G28 A;  2LPK A;  1YHQ P;  2ONT A;  3CCQ P;  1AUM A;  2N5I A;  2FHS C;  2EG5 A;  1KD1 Q;  1IMQ A;  2PY8 A;  2PEJ A;  1M74 A;  1A8O A;  1L0I A;  2NO8 A;  4U0E A; 
#chains in the Genus database with same CATH homology
 3B4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...