3B4QA

Crystal structure of a conserved protein domain (unknown function) from corynebacterium diphtheriae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
LNSAPTPRDVVANAPAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRLAGGIPPQIEAFYQANRTNFNGFYMANRGAIDFIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title The structure of a conserved protein domain (unknown function) from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae nctc 13129
molecule tags Structural genomics, unknown function
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.100 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A conserved protein domain from corynebacterium diphtheriae 3b4qA00
3B4QA
chains in the Genus database with same CATH superfamily
2N6YA 1YI2P 3H47A 1VQNP 2AF8A 2KW2A 1GXGA 1KLPA 2PY8A 5KP8B 2VSQA 1EIAA 2PNGA 4COPA 2FADA 3WBHA 2PEJA 2DNWA 2XXMA 3Q20A 1Q82Q 1AUMA 2LPKA 2MD9A 1OR5A 1GPJA 2MY5A 1YHQP 1HQBA 1L0HA 2EIAA 2CNRA 3NY7B 3G0VA 2JU2A 2EHTA 2FQ1A 2KGDA 2AFEA 2XT1A 3CMEP 2QNWA 2VLQA 3CCEP 2K5XA 2L4BA 1DNYA 2QEXP 2LOLA 3RG6C 3CPWO 2NO8A 1N8RQ 1NJIQ 2XZ0D 2CWOA 2JQ4A 2KOOA 4DG9A 2VLPA 3G6EP 4BPGA 1NQ4A 2JYGA 3NTEA 1A8OA 3CCQP 5KP6B 2K92A 3G29A 4UHPB 3CCUP 1X3OA 4U0BA 1E0HA 3EJEA 1ACPA 2GDWA 3OW2O 1YJ9P 1QVGO 2Z46A 2BUOA 3GJNA 3CC7P 2LTEA 2Z45A 2OTLP 2CQ8A 5HGLA 1KC8Q 3DS3A 3G4SP 1BXIA 2MR8A 1QVFO 4GR2A 2AFDA 1K73Q 2L6EA 1VQ4P 2L22A 5CZDB 4GR6A 3G21A 3GKLC 2N98A 2MF4A 3U43A 4NEOA 1VQOP 3VRLC 2CG5B 2QA4P 1L0IA 5EJDA 3CCLP 2LMLA 2XZ1C 1JJ2O 1EOQA 2FAEA 3G26A 1IMPA 1VQKP 5KP7B 1Q7YQ 1M6NA 5HGOA 1K8AQ 1T8KA 1IMQA 2E1MA 2BHVA 1ZMBA 1Q86Q 2JB0A 4BPHA 2JO0A 2JBGA 2GYKA 3M1MA 1RO2A 2EHSA 5HGMA 1KD1Q 3E2DA 4F37A 3DPHA 2K2QA 1VQMP 2JAZA 4U0AA 4XFXA 1S72P 1M1KQ 1VQLP 2GZGA 2FVFA 2N6ZA 4CA3A 5EW5E 1Q81Q 3CC2P 3EJDA 1VQ6P 2AVAA 3H0DA 2ONTA 4IZ6A 4QNBA 1VQ5P 3G1GA 2FHSC 3CD6P 3CCSP 4H2YC 2PEOA 1VQ7P 2X2BA 3G1IA 2ROQA 2GZIA 2KGAA 1QRJA 5JPAA 2ERHA 2K94A 2MVVA 3DS2A 2KGCA 1K9MQ 2KODA 1VQ8P 7CEIA 1EMVA 2N5HA 2PEQA 1VHNA 4BPFA 2DGYA 2M5RA 2VLOA 1E6JP 2N50A 2PEMA 4H2XC 3GZLA 2CGQA 3HYBA 2JU1A 4XFYA 1M90Q 3DTJA 3G28A 3DS4A 3HZQA 2FVAA 1IUQA 3I55P 2LKIA 2LL8A 1FR2A 3B5IA 2KG9A 4PXHB 3CC4P 1M74A 2EG5A 3P05A 4XRQA 5F2KA 2L0QA 2KOQA 3G71P 2KOPA 3CCVP 2KG8A 1K30A 2VLNA 2M8NA 1Z6MA 1AF8A 5BS2A 3LMOA 2JGPA 3H4EA 2GDXA 2OTJP 1CEIA 2KORA 2KGEA 4HKGA 1MZ8A 3MGEA 2KOSA 1RO0A 4H2WC 1A43A 3CCJP 4XFZA 3I56P 5F2OA 2K0XA 1VQPP 3EJBA 1ZNVA 4WYMA 3DS1A 4QKOA 2FVEA 1GXHA 5F2NA 2K0DX 5HV8A 1VQ9P 1BAJA 3DS0A 1YJWP 3CXCO 4PWVB 1DV5A 1YJNP 2Z44A 2M8LA 2KWLA 2KR5A 4IPYA 2PEIA 2K0YA 1RNIA 2MVUA 4XROA 4MRTC 1UJZA 2LIWA 3LRYA 2WPTA 2P9XA 5HGNA 2K93A 2MR7A 1YITP 2OARA 3CMAP 4U0DA 4R0MA 2PEKA 3CCRP 3RG2A 1HY8A 1W2BO 2FQ2A 2XV6A 4M0IA 1M6EX 2PENA 1AYIA 4U0EA 4U0FA 2GDYA 2M8PA 5HVCA 1YIJP 4COCA 2KG6A 2LIUA 4PH1A 3CCMP 2GZJA 5I4TG 2GZEA 5BS1A 4PH0A 1KQSO 4U0CA 3B4QA 2LF4A 2L9FA 1UNKA 2FQ0A 5DCKA 3CE7A 2GZFA 2JYLA 2FACA 1VKUA 3GZMA 2EFJA 2N5IA 3DS5A 1D1DA 1F80D
chains in the Genus database with same CATH topology
3B4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4Q A; 
#chains in the Genus database with same CATH topology
 2N6Y A;  1YI2 P;  3H47 A;  1VQN P;  2AF8 A;  2KW2 A;  1GXG A;  1KLP A;  2PY8 A;  5KP8 B;  2VSQ A;  1EIA A;  2PNG A;  4COP A;  2FAD A;  3WBH A;  2PEJ A;  2DNW A;  2XXM A;  3Q20 A;  1Q82 Q;  1AUM A;  2LPK A;  2MD9 A;  1OR5 A;  1GPJ A;  2MY5 A;  1YHQ P;  1HQB A;  1L0H A;  2EIA A;  2CNR A;  3NY7 B;  3G0V A;  2JU2 A;  2EHT A;  2FQ1 A;  2KGD A;  2AFE A;  2XT1 A;  3CME P;  2QNW A;  2VLQ A;  3CCE P;  2K5X A;  2L4B A;  1DNY A;  2QEX P;  2LOL A;  3RG6 C;  3CPW O;  2NO8 A;  1N8R Q;  1NJI Q;  2XZ0 D;  2CWO A;  2JQ4 A;  2KOO A;  4DG9 A;  2VLP A;  3G6E P;  4BPG A;  1NQ4 A;  2JYG A;  3NTE A;  1A8O A;  3CCQ P;  5KP6 B;  2K92 A;  3G29 A;  4UHP B;  3CCU P;  1X3O A;  4U0B A;  1E0H A;  3EJE A;  1ACP A;  2GDW A;  3OW2 O;  1YJ9 P;  1QVG O;  2Z46 A;  2BUO A;  3GJN A;  3CC7 P;  2LTE A;  2Z45 A;  2OTL P;  2CQ8 A;  5HGL A;  1KC8 Q;  3DS3 A;  3G4S P;  1BXI A;  2MR8 A;  1QVF O;  4GR2 A;  2AFD A;  1K73 Q;  2L6E A;  1VQ4 P;  2L22 A;  5CZD B;  4GR6 A;  3G21 A;  3GKL C;  2N98 A;  2MF4 A;  3U43 A;  4NEO A;  1VQO P;  3VRL C;  2CG5 B;  2QA4 P;  1L0I A;  5EJD A;  3CCL P;  2LML A;  2XZ1 C;  1JJ2 O;  1EOQ A;  2FAE A;  3G26 A;  1IMP A;  1VQK P;  5KP7 B;  1Q7Y Q;  1M6N A;  5HGO A;  1K8A Q;  1T8K A;  1IMQ A;  2E1M A;  2BHV A;  1ZMB A;  1Q86 Q;  2JB0 A;  4BPH A;  2JO0 A;  2JBG A;  2GYK A;  3M1M A;  1RO2 A;  2EHS A;  5HGM A;  1KD1 Q;  3E2D A;  4F37 A;  3DPH A;  2K2Q A;  1VQM P;  2JAZ A;  4U0A A;  4XFX A;  1S72 P;  1M1K Q;  1VQL P;  2GZG A;  2FVF A;  2N6Z A;  4CA3 A;  5EW5 E;  1Q81 Q;  3CC2 P;  3EJD A;  1VQ6 P;  2AVA A;  3H0D A;  2ONT A;  4IZ6 A;  4QNB A;  1VQ5 P;  3G1G A;  2FHS C;  3CD6 P;  3CCS P;  4H2Y C;  2PEO A;  1VQ7 P;  2X2B A;  3G1I A;  2ROQ A;  2GZI A;  2KGA A;  1QRJ A;  5JPA A;  2ERH A;  2K94 A;  2MVV A;  3DS2 A;  2KGC A;  1K9M Q;  2KOD A;  1VQ8 P;  7CEI A;  1EMV A;  2N5H A;  2PEQ A;  1VHN A;  4BPF A;  2DGY A;  2M5R A;  2VLO A;  1E6J P;  2N50 A;  2PEM A;  4H2X C;  3GZL A;  2CGQ A;  3HYB A;  2JU1 A;  4XFY A;  1M90 Q;  3DTJ A;  3G28 A;  3DS4 A;  3HZQ A;  2FVA A;  1IUQ A;  3I55 P;  2LKI A;  2LL8 A;  1FR2 A;  3B5I A;  2KG9 A;  4PXH B;  3CC4 P;  1M74 A;  2EG5 A;  3P05 A;  4XRQ A;  5F2K A;  2L0Q A;  2KOQ A;  3G71 P;  2KOP A;  3CCV P;  2KG8 A;  1K30 A;  2VLN A;  2M8N A;  1Z6M A;  1AF8 A;  5BS2 A;  3LMO A;  2JGP A;  3H4E A;  2GDX A;  2OTJ P;  1CEI A;  2KOR A;  2KGE A;  4HKG A;  1MZ8 A;  3MGE A;  2KOS A;  1RO0 A;  4H2W C;  1A43 A;  3CCJ P;  4XFZ A;  3I56 P;  5F2O A;  2K0X A;  1VQP P;  3EJB A;  1ZNV A;  4WYM A;  3DS1 A;  4QKO A;  2FVE A;  1GXH A;  5F2N A;  2K0D X;  5HV8 A;  1VQ9 P;  1BAJ A;  3DS0 A;  1YJW P;  3CXC O;  4PWV B;  1DV5 A;  1YJN P;  2Z44 A;  2M8L A;  2KWL A;  2KR5 A;  4IPY A;  2PEI A;  2K0Y A;  1RNI A;  2MVU A;  4XRO A;  4MRT C;  1UJZ A;  2LIW A;  3LRY A;  2WPT A;  2P9X A;  5HGN A;  2K93 A;  2MR7 A;  1YIT P;  2OAR A;  3CMA P;  4U0D A;  4R0M A;  2PEK A;  3CCR P;  3RG2 A;  1HY8 A;  1W2B O;  2FQ2 A;  2XV6 A;  4M0I A;  1M6E X;  2PEN A;  1AYI A;  4U0E A;  4U0F A;  2GDY A;  2M8P A;  5HVC A;  1YIJ P;  4COC A;  2KG6 A;  2LIU A;  4PH1 A;  3CCM P;  2GZJ A;  5I4T G;  2GZE A;  5BS1 A;  4PH0 A;  1KQS O;  4U0C A;  3B4Q A;  2LF4 A;  2L9F A;  1UNK A;  2FQ0 A;  5DCK A;  3CE7 A;  2GZF A;  2JYL A;  2FAC A;  1VKU A;  3GZM A;  2EFJ A;  2N5I A;  3DS5 A;  1D1D A;  1F80 D; 
#chains in the Genus database with same CATH homology
 3B4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...