3B4QA

Crystal structure of a conserved protein domain (unknown function) from corynebacterium diphtheriae
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
87
Chain Sequence
LNSAPTPRDVVANAPAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRLAGGIPPQIEAFYQANRTNFNGFYMANRGAIDFIFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title The structure of a conserved protein domain (unknown function) from Corynebacterium diphtheriae.
rcsb
source organism Corynebacterium diphtheriae nctc 13129
total genus 29
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.100 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A conserved protein domain from corynebacterium diphtheriae 3b4qA00
3B4QA
chains in the Genus database with same CATH superfamily
3RG6C 2EHTA 5HVCA 1M6EX 4CA3A 2ERHA 2XT1A 1AUMA 3GKLC 3G71P 2N50A 1E0HA 4U0DA 2MR7A 2PEJA 1K73Q 2VSQA 2N6YA 3CCQP 1ZMBA 2JYLA 2GZGA 2XZ0D 3CMAP 4F37A 4PWVB 2K0YA 2L9FA 1IUQA 1L0HA 2GDWA 2PEOA 2LL8A 3DS1A 1NJIQ 1KQSO 4IPYA 2N6ZA 2AFDA 2JAZA 2L4BA 2KGAA 2VLPA 3GJNA 1VHNA 2KODA 3G21A 3MGEA 2DNWA 1K8AQ 2KOSA 1HY8A 3HYBA 4XFZA 3B4QA 1M74A 1UJZA 2KG6A 3G28A 1NQ4A 2KWLA 3G4SP 2FQ0A 3CMEP 2K5XA 4BPGA 4GR6A 3M1MA 3DS2A 4COPA 2K94A 2PY8A 3CC4P 2LF4A 2KORA 2L22A 4IZ6A 2GDXA 1DNYA 1QRJA 2PNGA 5BS2A 3Q20A 4PH0A 5EJDA 1M6NA 3GZLA 5KP6B 4XFXA 1YJNP 1UNKA 1K9MQ 2FQ1A 1GXGA 2M8NA 1OR5A 3VRLC 2MF4A 2MY5A 2CGQA 3CCEP 1AF8A 3CD6P 3G1IA 1ACPA 2VLOA 1BXIA 2K93A 2JB0A 2CQ8A 2JU1A 5JPAA 2JGPA 1RNIA 1VQPP 1M90Q 3CC7P 3DTJA 2E1MA 4M0IA 3HZQA 2NO8A 2JYGA 2FVAA 1RO2A 5CZDB 3LRYA 3DS4A 5HV8A 2GZEA 4XFYA 2KOQA 1YJ9P 4U0CA 5KP7B 2DGYA 1VQ7P 2L6EA 2Z46A 4UHPB 1S72P 2CG5B 2N5IA 3RG2A 1VQLP 5EW5E 2XV6A 4NEOA 2LPKA 2KOPA 3EJDA 3DS3A 4U0BA 1YHQP 2GZJA 1EIAA 1W2BO 1F80D 3CCVP 2FVEA 3DS0A 3EJEA 2KG8A 5HGNA 2PEKA 2QA4P 2LTEA 3B5IA 3P05A 2GZIA 3CE7A 4QNBA 3WBHA 1N8RQ 2M5RA 5HGLA 2AFEA 2KR5A 2JU2A 2ONTA 1KLPA 2QEXP 2M8PA 4WYMA 1HQBA 4HKGA 2LIUA 4H2XC 2AF8A 2Z45A 1Q7YQ 1VQMP 1MZ8A 1Q86Q 1VQ8P 2PEQA 4BPHA 2PEIA 2XXMA 3G0VA 1YIJP 3DS5A 2CWOA 2K0DX 3CCSP 1T8KA 2EHSA 1GPJA 1X3OA 3CCLP 1VQ6P 2ROQA 3DPHA 2EFJA 3CCMP 4U0FA 2KGCA 3GZMA 2CNRA 3CCRP 4R0MA 3G6EP 5F2NA 2QNWA 1A8OA 5KP8B 1Q81Q 5F2KA 2FADA 2MR8A 2KOOA 1VQ9P 3CC2P 1GXHA 1M1KQ 1AYIA 3NY7B 2MVUA 1VQNP 2KG9A 1KD1Q 5F2OA 1FR2A 1YI2P 4GR2A 2K2QA 2AVAA 3I56P 3NTEA 1E6JP 2FVFA 1DV5A 2Z44A 5I4TG 2GYKA 2LIWA 3H47A 2KGEA 2JQ4A 3CCJP 2MVVA 1EOQA 1EMVA 2K92A 1YITP 2GDYA 2XZ1C 3H0DA 2EG5A 7CEIA 2P9XA 2X2BA 2KW2A 4DG9A 4XROA 4XRQA 4MRTC 2JBGA 3CPWO 2BUOA 1JJ2O 2VLQA 4BPFA 2PEMA 2PENA 4U0AA 2FHSC 3G26A 2LMLA 4COCA 2VLNA 1VQ4P 1Q82Q 1QVGO 1VQKP 4U0EA 4PXHB 1VKUA 5HGOA 1QVFO 2LKIA 4PH1A 2N5HA 3EJBA 1KC8Q 1K30A 5BS1A 2OARA 4H2YC 1YJWP 2OTJP 5HGMA 3LMOA 1L0IA 4H2WC 2FQ2A 1ZNVA 1Z6MA 3OW2O 1A43A 1IMPA 2M8LA 3G29A 1VQ5P 1VQOP 2LOLA 2FACA 2GZFA 3E2DA 1BAJA 2BHVA 5DCKA 3CCUP 3U43A 2K0XA 2WPTA 1CEIA 2L0QA 2KGDA 2OTLP 3H4EA 2JO0A 2MD9A 1IMQA 1D1DA 4QKOA 2EIAA 3I55P 3CXCO 1RO0A 2FAEA 2N98A 3G1GA
chains in the Genus database with same CATH topology
3B4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4Q A; 
#chains in the Genus database with same CATH topology
 3RG6 C;  2EHT A;  5HVC A;  1M6E X;  4CA3 A;  2ERH A;  2XT1 A;  1AUM A;  3GKL C;  3G71 P;  2N50 A;  1E0H A;  4U0D A;  2MR7 A;  2PEJ A;  1K73 Q;  2VSQ A;  2N6Y A;  3CCQ P;  1ZMB A;  2JYL A;  2GZG A;  2XZ0 D;  3CMA P;  4F37 A;  4PWV B;  2K0Y A;  2L9F A;  1IUQ A;  1L0H A;  2GDW A;  2PEO A;  2LL8 A;  3DS1 A;  1NJI Q;  1KQS O;  4IPY A;  2N6Z A;  2AFD A;  2JAZ A;  2L4B A;  2KGA A;  2VLP A;  3GJN A;  1VHN A;  2KOD A;  3G21 A;  3MGE A;  2DNW A;  1K8A Q;  2KOS A;  1HY8 A;  3HYB A;  4XFZ A;  3B4Q A;  1M74 A;  1UJZ A;  2KG6 A;  3G28 A;  1NQ4 A;  2KWL A;  3G4S P;  2FQ0 A;  3CME P;  2K5X A;  4BPG A;  4GR6 A;  3M1M A;  3DS2 A;  4COP A;  2K94 A;  2PY8 A;  3CC4 P;  2LF4 A;  2KOR A;  2L22 A;  4IZ6 A;  2GDX A;  1DNY A;  1QRJ A;  2PNG A;  5BS2 A;  3Q20 A;  4PH0 A;  5EJD A;  1M6N A;  3GZL A;  5KP6 B;  4XFX A;  1YJN P;  1UNK A;  1K9M Q;  2FQ1 A;  1GXG A;  2M8N A;  1OR5 A;  3VRL C;  2MF4 A;  2MY5 A;  2CGQ A;  3CCE P;  1AF8 A;  3CD6 P;  3G1I A;  1ACP A;  2VLO A;  1BXI A;  2K93 A;  2JB0 A;  2CQ8 A;  2JU1 A;  5JPA A;  2JGP A;  1RNI A;  1VQP P;  1M90 Q;  3CC7 P;  3DTJ A;  2E1M A;  4M0I A;  3HZQ A;  2NO8 A;  2JYG A;  2FVA A;  1RO2 A;  5CZD B;  3LRY A;  3DS4 A;  5HV8 A;  2GZE A;  4XFY A;  2KOQ A;  1YJ9 P;  4U0C A;  5KP7 B;  2DGY A;  1VQ7 P;  2L6E A;  2Z46 A;  4UHP B;  1S72 P;  2CG5 B;  2N5I A;  3RG2 A;  1VQL P;  5EW5 E;  2XV6 A;  4NEO A;  2LPK A;  2KOP A;  3EJD A;  3DS3 A;  4U0B A;  1YHQ P;  2GZJ A;  1EIA A;  1W2B O;  1F80 D;  3CCV P;  2FVE A;  3DS0 A;  3EJE A;  2KG8 A;  5HGN A;  2PEK A;  2QA4 P;  2LTE A;  3B5I A;  3P05 A;  2GZI A;  3CE7 A;  4QNB A;  3WBH A;  1N8R Q;  2M5R A;  5HGL A;  2AFE A;  2KR5 A;  2JU2 A;  2ONT A;  1KLP A;  2QEX P;  2M8P A;  4WYM A;  1HQB A;  4HKG A;  2LIU A;  4H2X C;  2AF8 A;  2Z45 A;  1Q7Y Q;  1VQM P;  1MZ8 A;  1Q86 Q;  1VQ8 P;  2PEQ A;  4BPH A;  2PEI A;  2XXM A;  3G0V A;  1YIJ P;  3DS5 A;  2CWO A;  2K0D X;  3CCS P;  1T8K A;  2EHS A;  1GPJ A;  1X3O A;  3CCL P;  1VQ6 P;  2ROQ A;  3DPH A;  2EFJ A;  3CCM P;  4U0F A;  2KGC A;  3GZM A;  2CNR A;  3CCR P;  4R0M A;  3G6E P;  5F2N A;  2QNW A;  1A8O A;  5KP8 B;  1Q81 Q;  5F2K A;  2FAD A;  2MR8 A;  2KOO A;  1VQ9 P;  3CC2 P;  1GXH A;  1M1K Q;  1AYI A;  3NY7 B;  2MVU A;  1VQN P;  2KG9 A;  1KD1 Q;  5F2O A;  1FR2 A;  1YI2 P;  4GR2 A;  2K2Q A;  2AVA A;  3I56 P;  3NTE A;  1E6J P;  2FVF A;  1DV5 A;  2Z44 A;  5I4T G;  2GYK A;  2LIW A;  3H47 A;  2KGE A;  2JQ4 A;  3CCJ P;  2MVV A;  1EOQ A;  1EMV A;  2K92 A;  1YIT P;  2GDY A;  2XZ1 C;  3H0D A;  2EG5 A;  7CEI A;  2P9X A;  2X2B A;  2KW2 A;  4DG9 A;  4XRO A;  4XRQ A;  4MRT C;  2JBG A;  3CPW O;  2BUO A;  1JJ2 O;  2VLQ A;  4BPF A;  2PEM A;  2PEN A;  4U0A A;  2FHS C;  3G26 A;  2LML A;  4COC A;  2VLN A;  1VQ4 P;  1Q82 Q;  1QVG O;  1VQK P;  4U0E A;  4PXH B;  1VKU A;  5HGO A;  1QVF O;  2LKI A;  4PH1 A;  2N5H A;  3EJB A;  1KC8 Q;  1K30 A;  5BS1 A;  2OAR A;  4H2Y C;  1YJW P;  2OTJ P;  5HGM A;  3LMO A;  1L0I A;  4H2W C;  2FQ2 A;  1ZNV A;  1Z6M A;  3OW2 O;  1A43 A;  1IMP A;  2M8L A;  3G29 A;  1VQ5 P;  1VQO P;  2LOL A;  2FAC A;  2GZF A;  3E2D A;  1BAJ A;  2BHV A;  5DCK A;  3CCU P;  3U43 A;  2K0X A;  2WPT A;  1CEI A;  2L0Q A;  2KGD A;  2OTL P;  3H4E A;  2JO0 A;  2MD9 A;  1IMQ A;  1D1D A;  4QKO A;  2EIA A;  3I55 P;  3CXC O;  1RO0 A;  2FAE A;  2N98 A;  3G1G A; 
#chains in the Genus database with same CATH homology
 3B4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...