1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
1YIJP 1VQ6P 3CCLP 3CCQP 1VQLP 1Q86Q 1W2BO 1VQ9P 2OTJP 3I55P 3I56P 1VQ8P 3CC2P 3CD6P 3CMAP 3CCMP 1VQOP 1M90Q 3CMEP 1VQMP 1K8AQ 3OW2O 3CCRP 2OTLP 1K9MQ 1K73Q 2QA4P 3CXCO 1VQKP 1QVGO 3CPWO 1Q81Q 1N8RQ 2QEXP 1VQPP 1JJ2O 1Q7YQ 1NJIQ 1VQNP 3CCSP 3CC4P 1KQSO 1KD1Q 3CCEP 3G6EP 3CC7P 3G71P 3G4SP 1VQ5P 1QVFO 3CCUP 1VQ4P 1S72P 1YJ9P 1YJWP 1YI2P 1Q82Q 1KC8Q 1YITP 1M1KQ 1YJNP 1VQ7P 1YHQP 3CCVP 3CCJP
chains in the Genus database with same CATH superfamily
3IR9A 3TGUD 2FQ2A 2EFJA 2R5DA 3M91A 4IPYA 3GF7A 2KLVA 2WZ7A 4H13D 2VRSA 3VRLC 3H1LD 3AE4C 5AVSB 1KQLA 2W6JH 2OYHA 1SQVJ 2E75C 3VMXA 1YQ4C 1QRJA 1ZV8A 2E5YA 2MR7A 3NFQA 2LTEA 1L0LK 4EIJA 2KS1B 3H1KG 2WPRA 1JM0A 4HJGH 2PY8A 2Y0EA 3GHGC 3CWBJ 1IZNB 3USSA 2CGQA 3PP5A 4Y28J 1MUUA 3CPWO 5AW0B 3DS0A 3L35A 3E1IA 4IFMA 3E2DA 5GTHE 4H44D 4DOJA 2PEIA 2P7JA 1S5LE 3I56P 3TGUJ 1HH0A 2M5AB 1YTZI 3HTKB 2OTLP 1X9VA 1ZRTD 1KILC 3R4YA 2L91A 2FYUJ 2KYVA 3BVHA 1OWAA 1L4AC 4K35A 3KQGA 1CI6B 4OGQB 1ZR2A 4NPDA 4IL6X 1SFCD 1EIAA 2GZEA 3SWFA 1LP1B 1M6NA 1NH4A 1NTMJ 1IK9A 4WY4C 1BGYE 3U1CA 2ZT9B 3RL0C 3RK3B 1PPJE 3BASA 2E43A 1JO5A 2P9XA 4PV1D 3T97B 4UB6H 3EJDA 1GTWA 4ZMDA 2IBZE 1M90Q 3LMOA 5I4TG 5APTA 3MP7B 3H1JD 3TK1A 1SQXD 2N1TB 4QKOA 1JOCA 1NTKD 2MJZA 3F89A 1KYOI 1Q82Q 5CCHD 2JYLA 3O8ZA 5KJ7D 3CXHI 5B5EH 1NQ4A 2PEQA 4XFYA 3CLQA 3NXSA 5KAFE 4U3FE 1WT6A 3WU2E 2A45I 2A45H 5GTIE 5GTIH 4UB6E 3G3ZA 2KNCA 2HODA 1S2EA 1PV3A 3ITKA 4C46A 3CC2P 1KTMA 2YMKA 1QGKB 2XU6A 1T3UA 1CI6A 1T8KA 4A7PA 1PEQA 1N7SD 1AQTA 5KP6B 2IZ0A 2KI7B 4RJTA 1A8OA 2FYUG 2ONTA 2M0BA 1GU5A 1U57A 1RF1A 1FDMA 1LT9C 1EOQA 3G0VA 1ZN5A 1VF5C 1SQVK 2OYIA 4D6TE 4PD4E 2KGDA 3AEBC 1SQBJ 2W27A 3W68A 4H13B 2OYOA 1P84E 3KYQA 1UIIA 1LTAC 4EDFA 2NPSA 4PH0A 1IFDA 4H2YC 1LWUB 1OR5A 3F5HA 1Z56A 1N73A 1U7MA 2JKVA 1JY2P 1NTMK 2GUVA 4GIFA 1IFIA 2GZIA 5APXA 3L72D 4PH1A 2XDJA 1S3JA 1H89A 2LF4A 4OGQC 1KORA 3PH0A 3D6YA 3CX5I 2KZIA 2BQ1E 1BGYJ 2XNXA 3O6QA 2WSCH 4KJMA 2FVAA 1AVYA 1VPCA 1BXIA 3AEFC 5AW4B 4Y99C 2P67A 4COCA 3OJAB 5TISE 1NTKG 1Y47A 3MHVA 2E75B 2KG6A 1FC2C 5AVXB 3HE5A 2E42A 2XNDH 4GR2A 1ZLLA 4I7ZB 2LMLA 2WSEJ 2Z45A 2L22A 2ZYDA 5GTHH 1RHZB 1SQQE 1HQBA 4HYTB 2Q3IA 5CBNA 2JU1A 3BCCE 1NO4A 1X79B 3Q20A 4W80A 1NTMD 3CMEP 1AJYA 2N5IA 1W5CE 1FZBA 4OGQD 2FADA 1PZQA 2Y0CA 3D70A 1NU1E 3TNUA 3C9IA 4PWVB 1YJ9P 4C7NA 3P8MC 2WT7A 1OW6A 5CJ4A 1N7LA 1AVOA 4XFZA 4DCKA 2ZAEB 2WPVB 1K9MQ 3AE7C 3A0BH 1VQKP 2OYHB 1BSNA 1JY3N 3BATA 3EFFK 3M0DC 4U7JA 1RNIA 1SS1A 2O01J 3SFDC 3M0AA 3WMM0 2P58A 2WSFJ 5AW6B 4GDOA 4U3FG 2H43A 1ZXGA 1DV5A 4COPA 1QL1A 2FQ1A 2WVRA 3TNUB 4GR6A 2IPPA 1L0LE 3AE6C 2VLPA 3S9OA 5AW3B 3M9QA 3JCUH 1L0LJ 3TDKA 5KKZC 3V2NA 2K2QA 1R8EA 1L0NK 3HTKA 5DCKA 2GM4A 2CPSA 1CW5A 4OVNF 2PENA 1GD2E 4RESB 1SQXE 3HD7C 1JB0J 1XTCC 1FS0E 4R4LA 2L4BA 2AF8A 4U0AA 1P84H 5KLVD 1F80D 1Z6MA 4PD4I 1LTJC 3M1MA 1G1IA 2KLUA 1HJ0A 2FFDC 3VMYA 3NY7B 2M3BA 1VDFA 2LPKA 3Q5PA 3L75D 1HTLC 1W2BO 2K94A 3RBZA 1KQFB 2QVAA 2JR8A 3WUTA 3OA7A 5H2FH 2W90A 2PRRA 1UIXA 1RQVA 2FACA 1KILD 4BWNA 5KLIB 1GXGA 3B4QA 2WPTA 3H1LJ 2OYHC 1HBWA 4IZ6A 3KZIH 3HD7B 2QJPC 2E74C 2K0XA 1VKUA 2YIUC 3RK3D 2X2BA 2AXTH 3LW5J 5KAFH 5K5GB 4I1LA 1NU1K 3D6ZA 1SQQG 3RG2A 4WY4D 4PJ0E 2LIUA 3FXEA 2JO0A 2GYKA 3RL0D 4ZKUA 2YXQB 1DEEG 2QJPB 1PEMA 4DJGA 4PV1C 3N4XA 1A43A 4YTPC 2N50A 2A06D 2BCCJ 4BRYA 1Y9BA 1HGZA 2ZXEB 3GJNA 2E74B 3H1JG 3BRTB 3HZQA 1YI2P 3VOPA 3CCLP 2D2CC 3BCCJ 2O1KA 1FZCC 3M9HA 1J2JB 2K0YA 3CX5D 4JYBA 4NPEA 2M5RA 3RG6C 1SQBG 2ITAA 4IOIH 2QEXP 1GXHA 2NPSB 3CCEP 2IFMA 2JAZA 3A7OA 1LJ2A 4WYMA 1VQ4P 3H1KE 3DS2A 4UHPB 3L70G 2Y0DA 2ZXXA 2XZRA 3H1LG 3MUDA 4NEOA 2J5UA 2Q6QA 5EFWB 4UB8E 2ZYGA 4N6JA 2NPSD 2IYPA 5F2NA 2V7QH 1KB9I 3G71P 2M8RA 3T97A 4EOTA 2B87B 3H1ID 1NGMB 2KZJA 2QRXA 2EG5A 2E76C 1PP9J 4PD4H 1ZRTE 3L4FA 5CCGA 1GL2C 2KR5A 3L71J 1KYOE 3MGEA 2LL8A 2O1JA 1BSHA 1SP4A 3AE1C 2OTKE 1GW3A 2I1KA 3MUDC 1MZ8A 3RL0g 1ZR4A 3A0HH 1SQQK 3AE9C 1A02F 4H2XC 2CNRA 1NTKE 2DW3A 2VLQA 4ASVA 3GZLA 3CX5E 1WRGA 1M7LA 3CCVP 1NTMG 2GZJA 3CCQP 3AEGC 4LGDE 3L72E 2OTJP 1YBKA 4H0LC 1NHLA 5AVZB 1IUQA 2WSCJ 4WY4A 5KLVK 3C1LA 4PV1B 2E76D 2M8LA 4R0MA 5AW5B 3H0DA 3PTZA 1SQVD 2XT1A 1GMJA 3CXHH 5BU5A 2KXPB 1NTZD 1J1DC 2PNGA 3L75G 3L71E 2CQ8A 1IFJA 1Q81Q 2MKVA 4MN4C 2PEMA 2XXMA 5HGOA 3PLNA 1AUMA 2EHTA 1LWUA 1BE3E 2NZ2A 1SLQA 2QJKC 2P10A 2KW2A 4XROA 4H0LD 1QEXA 1JY3O 2QSIA 1SQVG 1DNYA 1GL2B 5APWA 3FWLA 1S9KD 2N9YB 1FZGA 1S5LX 3IAOA 3CWBG 1VQ7P 4XE5B 1LTTC 3BCCD 1SQPG 2K0DX 1S4XA 2M3EA 2K9YA 2WWWA 4IFDK 2PEOA 2O01H 1K73Q 2JQ4A 2FYUE 3AE2C 3NMDA 2WSFH 1KMIZ 3AECC 2ZVOB 1K04A 2KG9A 2Z5IA 1FBMA 1FJPA 5L8RJ 1Q90D 1UNKA 4JYCA 1RO0A 1OW8A 3FWNA 3RK3C 1USDA 2YNYA 4XFJA 2MR8A 2JWDA 2Q1KA 3L37A 4K3AA 3MZWB 3NTNA 1PGOA 1SQBE 2GZFA 1FDOA 2H88C 1LT9A 1NYHA 3L70E 2C9LY 4AYCA 1ZNVA 3OAKA 5B66E 1K8AQ 2UWJE 4HH2A 2FYZA 1VQPP 1R5SA 3V2QA 1BCCD 1QVFO 2LXCB 1OIPA 1OVVA 4OWFA 1YITP 1PP9D 1G2CA 1EZVI 2JB0A 2QJKB 1AFOA 2N6YA 3IFMA 1HVVA 2JBGA 2NO8A 1VQNP 2KOGA 1ZP0C 2VLNA 2WTYA 3H4EA 1FJKA 4R4MA 2K9JB 4WBAA 2M8PA 1L0LG 4JQ0D 1X3OA 3EJEA 2LIWA 5AVWB 1OW7A 1PFIA 2ZYAA 2JU2A 2GUSA 4L76A 2AEFA 4OH8B 1KILE 2OARA 1NU1G 3G29A 3H25A 2JGPA 2Q7CA 2EIAA 1YTZT 2QE7H 3A5TA 3E1RA 1AQ5A 1NTKJ 3VMZA 2BEZF 2LXBA 2Y9ZA 2N9BA 1YJNP 4I7ZC 3L75E 1YIJP 3RK3E 4ZNCA 2PAJA 4EYYQ 3DS4A 3HUSB 3WUUA 1NU1J 1GK6A 2WPSA 5BS2A 3HE4A 3CXHE 3RK2B 1M1JB 1KFMA 1BGYD 2AEMA 1RF0A 4B86A 3FGAD 4L73A 3G9RA 5CCHC 4PJ0H 5HV8A 2WSSH 1USEA 2CK3H 1M8OB 2WITA 1RH5B 2FFDA 2V4HA 2KS1A 3P05A 1ZOYC 1IFPA 4HB1A 1OZHA 1EZVE 1TU3F 3P8CE 3G6EP 4WVZA 1URQD 5KJ7C 5KP7B 1AV1A 2XZ1C 1NTZE 1IO4A 3KDPB 1OX3A 5DJTB 1SVFA 1BGYG 5B66H 5APUA 2KGEA 3CC4P 3AEDC 2NPSC 1MFTA 4QMAA 2CG5B 1KYOH 1BCCJ 5KLVG 1AF8A 4I6MC 2FAEA 1LGHB 1EDIA 3P8CD 2G3AA 4U0FA 3K5BA 2V7QJ 5CMZA 3Q5SA 1U7JA 1AYIA 1LTIC 2BCCG 2KGCA 2HFED 1GZLA 1L0IA 3KXDA 2LKMA 1S72P 1YQ3C 3H6PA 4C7RA 2FXMA 1LTSC 2BCCD 2QJYC 2BHVA 1NAYA 5F2KA 3QH9A 3O6QB 4UB8H 3WBHA 2H8PD 2H89C 1CEIA 2SPZA 2Z5HA 2IBZD 1J1DB 2ZT9D 2YKQA 2W83C 3H1JE 3SWKA 3H1HD 2N1TA 4EI2A 4MRTC 3B5ND 2AFEA 2KSEA 3L74D 2O3JA 1SFCB 3V2PA 4M3LA 3V5BA 2L0QA 1K30A 2B88A 3KPEA 2R44A 1S5LH 4ASWA 3M0DA 3GLMA 3AE5C 1H0TB 2QJYB 1KQGB 1EXIA 2P2UA 3GF3A 1FE6A 4U3FJ 4Z1MH 5CHXA 2YIUB 3A0BE 4H44B 3CI9A 3H32B 1IMPA 2HODB 3B71A 4JBZA 4GODA 2WT7B 5KLIC 5CBOA 3BCCG 3GKLC 2ZT9C 1RE4C 3L73G 4D6TJ 1RY3A 1ZW0A 2HLOA 3B5NA 3L71D 1WMKA 2J58A 2D2CB 2QG4A 3RGUA 1EZVG 1L4AD 3KZIE 1PGPA 4F37A 3VMAA 4PXHB 1KV4A 4IFFA 1JUNA 1LT9B 1LWUC 2B87A 3TGUG 1BDDA 2BUOA 3WU2H 1SQPD 1NU1D 3ABVC 2LOLA 3CWBD 1FZCA 2FY8A 5CCGC 3H1JJ 2AVAA 3I5CA 5B5EE 1ZMEC 3L74E 2HPCB 2YO3A 3L73J 1EMVA 5AVVB 1JTHA 1KD1Q 5AW2B 1MZ9A 1HGVA 2KGAA 1KYOD 3SWYA 3M06A 2K1AA 2KOQA 2CWOA 3V4QA 2MVUA 4H44C 3HRNA 2AEJA 1H8AA 4IL6H 3U43A 5EJDA 4N3YB 1S1CX 1PL5A 2FBWC 1KLPA 2L5GB 1LNQA 2C0XA 1URQB 1YHQP 1FDIA 1JMMA 4Y99B 3GW6A 2K37A 7CEIA 1SFCC 1KB9H 4JF7A 5AVQB 1IMQA 1N7SB 2HG5D 5BVZA 1L0NG 1NTME 2ZFCA 2M5AA 2WMMA 5APYA 3KHUA 2RN0A 3DS1A 3P7KA 1DD3A 3H1KJ 4L75A 1X8YA 3LRYA 4BPHA 1MFZA 3HUSA 2K3RA 3H1LE 1FOSE 1MV8A 4GKGA 1N8RQ 1JJ2O 1L4AA 4LC1A 1Y8AA 1LP1A 1T6AA 2KB7P 3V4WA 1H88A 1VF5D 3CX5H 3MGNA 3LW5H 2GZGA 2JP3A 1BE3J 5H2FE 1NWQA 2YMYA 3AEAC 2FFDB 3VTPC 3VN0A 3A2AA 4YXDC 3TSIA 3CE7A 5DJUB 2XV6A 3RBXA 2XV5A 1SQXG 5KAIH 3CC7P 1LTGC 3CWBE 2IBZG 1EDKA 2E76B 3HD7D 2ROQA 3NTEA 1Q86Q 1HY8A 3L73D 1VHNA 1GL2A 2AXTE 2GDYA 1KILB 1JCCA 2G8YA 2JEEA 2FHSC 2R5BA 1HWTC 1RE3C 1GW4A 1HUCA 4D6TD 2CPBA 2Z4EA 3AE3C 4AUWA 3H47A 5KLVJ 3I55P 4RO0A 3AEEC 2AXCA 2JO1A 1RQUA 2IDBA 4H2WC 1L0NE 2P1JA 1DX7A 2QNWA 2L6EA 1L0NJ 2XZ0D 3G4SP 1YJWP 3WUVA 2KK7A 2ZVNB 3JCUE 4JPZB 2K9JA 1RF0C 1URQC 1VQLP 1FU1A 1VQ8P 2JDIH 1SQQD 5E79E 2JJLA 3JSVC 1RF1B 1KB9E 4AQRD 3G26A 3LIDA 1M6EX 3CCSP 1IJDB 3R2PA 3U1AA 3CL3D 2FVEA 1P84I 2E1MA 1VQ9P 1FR2A 1Q2NA 1RE4A 1G2CB 1SQXJ 3DPHA 2Y9YA 1VQOP 3II6A 1JEKA 2Q9IA 3H1KD 1JY3P 3BRVB 1CSBA 2K88A 3A3YB 2Q3EA 1E0HA 3RK2D 5KAIE 2W6BA 1HJBA 3W67A 2J59M 3MIWA 3GHGB 3OW2O 1GL2D 1DIPA 1K05A 2FQ0A 5KTBA 3UIAA 4YXWH 1NKZB 1N2DC 2DGYA 1LT1A 1M56D 3DS5A 2N1TC 2WSEH 3EJBA 1SQPJ 5AW8B 5EW5E 2MY5A 3ZDMA 4NPFX 3CD6P 1FZAA 2ZJSE 2FKWB 2MD9A 2A45G 1JMBA 2C0WA 3CXCO 1VF5B 5CCGD 3AE8C 1EZVD 3FXDA 2W6AA 3DS3A 2RKLA 1KB9D 5CCHA 4CA3A 2N6ZA 1QLED 1QX8A 1BDCA 3G21A 1SQBD 1FZCB 2FYNC 4GT1A 4C7NB 2KODA 3MTUE 2KIKA 3M9BA 4HKZH 1NOHA 1QVGO 5JPAA 3GMAA 3HE4B 1FOSF 2HPCA 5APSA 4WWIA 1XTGB 1VQ5P 1EQ7A 4W7YA 2VLOA 1OMIA 3VP8A 4BPGA 4U0EA 3L70D 4HKGA 2N5HA 2IZ1A 3CCRP 3Q5RA 2Z44A 1EXJA 2A06G 1RE3A 1Q7YQ 2KSJA 1W2EA 3VP9A 4KHXA 3VYIA 2KOPA 3L36A 1KC8Q 4O9BA 1MKMA 3G1IA 3L74G 3EFGA 1EDJA 2OGUA 1EDLA 1IC2A 2PEKA 2EHSA 5APVA 2I8DA 1NAFA 2B89A 2KNCB 3TYYA 2JYGA 2QM7A 1FZEA 3L75J 2LKIA 3MD0A 4IL6E 3FX0A 3B4SA 2IBZI 4L74A 4D6TG 1M57D 3S1KA 2KORA 3SSUA 5AVRB 2IYOA 1GPJA 4TT3H 2MF4A 1SQXK 1L4AB 1YYCA 3D71A 1D1DA 1NTKK 2IX7C 2MVVA 2GDXA 2D2CD 4DZOA 1JNMA 1EC5A 3H1HE 3DTJA 1SFCA 3CXHD 1NVOA 3JC22 4H0LB 4U0CA 3L73E 4H13C 2BASA 3SFEC 1RO2A 2R3CA 1GDTA 1PPJD 1H0TA 2B9BA 4XRQA 4U0BA 2N98A 2E74D 3E7KA 4WB4A 4QNBA 3CMAP 4PD4D 1KZUB 3G1GA 5F2OA 1SQPK 5HGNA 3HE5B 1BE3D 2O01N 5AW1B 1J1EC 5TISH 1L0LD 4GOEA 1FAVA 1KQSO 2QIWA 1M74A 3Q3DA 1IFMA 3L70J 3P32A 1KN7A 4BXLA 2HR3A 1ZMBA 3CCJP 3TGUE 3B5NB 5KLVE 1VQMP 3H32A 2K92A 3EWKA 3PJSK 1OVUA 2VSQA 2GDWA 2R32A 1UJZA 3H1IE 3HUSC 5AW7B 4U3FD 5BS1A 3IF4A 1PP9G 2YKPA 2YXRB 1KFNA 2XKMA 1N73B 4N78D 2BCCE 1BCCG 2KG8A 1R5LA 2DNWA 4TLFA 2PFXA 5HVCA 1E79H 1M1JA 5M1BA 2YO2A 2PGDA 1BCCE 2K93A 2OQQA 4KT0J 1G1JA 1N73C 1GK4A 2GA1A 1IK7A 2FYUK 1JTHB 2POHA 1HF9A 1X22A 2L9FA 1PEOA 5KJ7A 3LIEA 1IFNA 1CZQA 1DD4A 2WPQA 1NTZJ 2FXPA 1NTZK 4N78E 1PPJG 4M0IA 1SQQJ 4GOFA 5C39A 5TJHA 3RK2C 2HYNA 5AVTB 3HYBA 1PGQA 5CZDB 4XFXA 1URQA 1D7MA 2FVFA 3CCMP 3GHGA 2JWAA 4LLHA 2E5TA 3A0HE 2R3SA 3QWOC 2YKOA 1J1EB 1N7SA 1AA0A 3B5IA 1NJIQ 2WQYC 1OVRA 1NKNA 3L71G 1M1KQ 2FYUD 1VQ6P 1RF1C 5AVUB 3G28A 1PIXA 1T8ZA 1N86A 3IN6A 2Z46A 1LTJA 2KOSA 1SQVE 1SQBK 1PGJA 5AVYB 3L74J 2C9NY 1KILA 4I2LC 1E6JP 4W7ZA 1OXZA 2W8ZA 3B8EB 3H1IJ 1L2PA 3L72J 2H7HA 1SQPE 4RKUJ 2OYIB 1JCDA 5KKZB 5HGMA 3C8VA 1T2KC 2IFNA 2KWLA 5APQA 1N7SC 1ACPA 1NTZG 1PEUA 3PHLA 3RL0B 1GU4A 3L72G 4WY4B 1LTJB 3TF5A 2N1TD 3HD7A 1S9KE 3B5NC 2K5XA 3H1HG 4U0DA 1DH3A 3GZMA 1L0ND 2M8NA 2I1JA 3H1IG 1FZFA 1PP9E 4XA4A 2OYIC 3Q1MA 3CCUP 3Q2YA 2BEQD 1DEBA 2ERHA 1P84D 2KUBA 3EQ2A 4DT0A 3N7NA 2QM8A 4CPGA 3H1HJ 2Q5UA 1T3JA 2LR2A 1T2KD 1A02J 5E79H 2PP6A 2AFDA 2NRGA 4BRYB 3V6IA 2E75D 1JY2N 1JY2O 1BE3G 1BAJA 1LTBC 1L0HA 2KP8A 3PRJA 1E5WA 3U59A 3V2RA 2A06E 2FYNB 4BPFA 2FXOA 3GG2A 2KOOA 1M1JC 3S4RA 1X0TA 2RMZA 4ZKPA 2QA4P 5KP8B 5HGLA 5CJ0A 1OFCX 4DG9A 1VL2A 5BU8B 2PEJA 5AW9B 2RH0A 1QL2A 4YPCA
chains in the Genus database with same CATH topology
2EFJA 4XROA 3I55P 3CD6P 4IPYA 5HGMA 1M90Q 5I4TG 2EG5A 4PH1A 4COPA 4GR6A 3CXCO 2LF4A 3VRLC 1PEUA 2BQ1E 3DS3A 1VQNP 2L6EA 2JO0A 3CC4P 1QRJA 1D1DA 3MGEA 3H4EA 3G4SP 1YJWP 1PEOA 1VQ7P 1PEMA 1Q82Q 2JYLA 2M8PA 1A43A 4COCA 2PY8A 3DTJA 1VQLP 3DS1A 3G21A 1VQ8P 3LRYA 2PEQA 4XFYA 4U0DA 4U0FA 5DCKA 2PEOA 4U0CA 1K73Q 2KODA 4M0IA 2M8NA 4GR2A 2OARA 3G29A 3G26A 5JPAA 3CPWO 1QVGO 1N8RQ 2EIAA 2Z45A 1JJ2O 3DS0A 1M6EX 1RO2A 3CCSP 2PENA 3HYBA 1VQ5P 3HZQA 4XRQA 3CCUP 1S72P 4XFXA 1YI2P 3E2DA 1YJNP 4U0BA 3CCVP 2E1MA 1YIJP 3CCLP 3CCQP 2PEIA 3Q20A 1VQ9P 2BHVA 4U0EA 5F2KA 3CC2P 2BUOA 3I56P 2OTJP 4QNBA 1RO0A 4U0AA 3CMAP 3DPHA 3CCMP 1VQOP 3CMEP 3DS4A 3CCRP 2OTLP 3G1GA 5F2OA 5HGNA 1IUQA 2Z44A 3WBHA 3M1MA 3RG6C 2M8LA 5BS2A 2QEXP 1PEQA 1Q7YQ 3B5IA 3H0DA 1NJIQ 1A8OA 3CCEP 2ONTA 2XV6A 1M74A 1KQSO 1KD1Q 1BAJA 2XT1A 4WYMA 1VQ4P 1KC8Q 1YJ9P 3CC7P 1EOQA 3DS2A 1M1KQ 3G1IA 3G0VA 1ZMBA 3CCJP 1VQ6P 2CWOA 3NTEA 1W2BO 3G28A 1Q86Q 1EIAA 1VQMP 1M6NA 4XFZA 1K8AQ 3OW2O 1K9MQ 2Z46A 1K30A 2QA4P 2PEKA 1VQKP 3P05A 1Q81Q 5HGLA 1E6JP 2PEMA 5BS1A 1VQPP 2XXMA 5F2NA 2DGYA 2P9XA 1RNIA 4PH0A 3G6EP 2PEJA 3G71P 1QVFO 3DS5A 5HGOA 1AUMA 1YITP 2JYGA 1YHQP 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIJ P;  1VQ6 P;  3CCL P;  3CCQ P;  1VQL P;  1Q86 Q;  1W2B O;  1VQ9 P;  2OTJ P;  3I55 P;  3I56 P;  1VQ8 P;  3CC2 P;  3CD6 P;  3CMA P;  3CCM P;  1VQO P;  1M90 Q;  3CME P;  1VQM P;  1K8A Q;  3OW2 O;  3CCR P;  2OTL P;  1K9M Q;  1K73 Q;  2QA4 P;  3CXC O;  1VQK P;  1QVG O;  3CPW O;  1Q81 Q;  1N8R Q;  2QEX P;  1VQP P;  1JJ2 O;  1Q7Y Q;  1NJI Q;  1VQN P;  3CCS P;  3CC4 P;  1KQS O;  1KD1 Q;  3CCE P;  3G6E P;  3CC7 P;  3G71 P;  3G4S P;  1VQ5 P;  1QVF O;  3CCU P;  1VQ4 P;  1S72 P;  1YJ9 P;  1YJW P;  1YI2 P;  1Q82 Q;  1KC8 Q;  1YIT P;  1M1K Q;  1YJN P;  1VQ7 P;  1YHQ P;  3CCV P;  3CCJ P; 
#chains in the Genus database with same CATH topology
 3IR9 A;  3TGU D;  2FQ2 A;  2EFJ A;  2R5D A;  3M91 A;  4IPY A;  3GF7 A;  2KLV A;  2WZ7 A;  4H13 D;  2VRS A;  3VRL C;  3H1L D;  3AE4 C;  5AVS B;  1KQL A;  2W6J H;  2OYH A;  1SQV J;  2E75 C;  3VMX A;  1YQ4 C;  1QRJ A;  1ZV8 A;  2E5Y A;  2MR7 A;  3NFQ A;  2LTE A;  1L0L K;  4EIJ A;  2KS1 B;  3H1K G;  2WPR A;  1JM0 A;  4HJG H;  2PY8 A;  2Y0E A;  3GHG C;  3CWB J;  1IZN B;  3USS A;  2CGQ A;  3PP5 A;  4Y28 J;  1MUU A;  3CPW O;  5AW0 B;  3DS0 A;  3L35 A;  3E1I A;  4IFM A;  3E2D A;  5GTH E;  4H44 D;  4DOJ A;  2PEI A;  2P7J A;  1S5L E;  3I56 P;  3TGU J;  1HH0 A;  2M5A B;  1YTZ I;  3HTK B;  2OTL P;  1X9V A;  1ZRT D;  1KIL C;  3R4Y A;  2L91 A;  2FYU J;  2KYV A;  3BVH A;  1OWA A;  1L4A C;  4K35 A;  3KQG A;  1CI6 B;  4OGQ B;  1ZR2 A;  4NPD A;  4IL6 X;  1SFC D;  1EIA A;  2GZE A;  3SWF A;  1LP1 B;  1M6N A;  1NH4 A;  1NTM J;  1IK9 A;  4WY4 C;  1BGY E;  3U1C A;  2ZT9 B;  3RL0 C;  3RK3 B;  1PPJ E;  3BAS A;  2E43 A;  1JO5 A;  2P9X A;  4PV1 D;  3T97 B;  4UB6 H;  3EJD A;  1GTW A;  4ZMD A;  2IBZ E;  1M90 Q;  3LMO A;  5I4T G;  5APT A;  3MP7 B;  3H1J D;  3TK1 A;  1SQX D;  2N1T B;  4QKO A;  1JOC A;  1NTK D;  2MJZ A;  3F89 A;  1KYO I;  1Q82 Q;  5CCH D;  2JYL A;  3O8Z A;  5KJ7 D;  3CXH I;  5B5E H;  1NQ4 A;  2PEQ A;  4XFY A;  3CLQ A;  3NXS A;  5KAF E;  4U3F E;  1WT6 A;  3WU2 E;  2A45 I;  2A45 H;  5GTI E;  5GTI H;  4UB6 E;  3G3Z A;  2KNC A;  2HOD A;  1S2E A;  1PV3 A;  3ITK A;  4C46 A;  3CC2 P;  1KTM A;  2YMK A;  1QGK B;  2XU6 A;  1T3U A;  1CI6 A;  1T8K A;  4A7P A;  1PEQ A;  1N7S D;  1AQT A;  5KP6 B;  2IZ0 A;  2KI7 B;  4RJT A;  1A8O A;  2FYU G;  2ONT A;  2M0B A;  1GU5 A;  1U57 A;  1RF1 A;  1FDM A;  1LT9 C;  1EOQ A;  3G0V A;  1ZN5 A;  1VF5 C;  1SQV K;  2OYI A;  4D6T E;  4PD4 E;  2KGD A;  3AEB C;  1SQB J;  2W27 A;  3W68 A;  4H13 B;  2OYO A;  1P84 E;  3KYQ A;  1UII A;  1LTA C;  4EDF A;  2NPS A;  4PH0 A;  1IFD A;  4H2Y C;  1LWU B;  1OR5 A;  3F5H A;  1Z56 A;  1N73 A;  1U7M A;  2JKV A;  1JY2 P;  1NTM K;  2GUV A;  4GIF A;  1IFI A;  2GZI A;  5APX A;  3L72 D;  4PH1 A;  2XDJ A;  1S3J A;  1H89 A;  2LF4 A;  4OGQ C;  1KOR A;  3PH0 A;  3D6Y A;  3CX5 I;  2KZI A;  2BQ1 E;  1BGY J;  2XNX A;  3O6Q A;  2WSC H;  4KJM A;  2FVA A;  1AVY A;  1VPC A;  1BXI A;  3AEF C;  5AW4 B;  4Y99 C;  2P67 A;  4COC A;  3OJA B;  5TIS E;  1NTK G;  1Y47 A;  3MHV A;  2E75 B;  2KG6 A;  1FC2 C;  5AVX B;  3HE5 A;  2E42 A;  2XND H;  4GR2 A;  1ZLL A;  4I7Z B;  2LML A;  2WSE J;  2Z45 A;  2L22 A;  2ZYD A;  5GTH H;  1RHZ B;  1SQQ E;  1HQB A;  4HYT B;  2Q3I A;  5CBN A;  2JU1 A;  3BCC E;  1NO4 A;  1X79 B;  3Q20 A;  4W80 A;  1NTM D;  3CME P;  1AJY A;  2N5I A;  1W5C E;  1FZB A;  4OGQ D;  2FAD A;  1PZQ A;  2Y0C A;  3D70 A;  1NU1 E;  3TNU A;  3C9I A;  4PWV B;  1YJ9 P;  4C7N A;  3P8M C;  2WT7 A;  1OW6 A;  5CJ4 A;  1N7L A;  1AVO A;  4XFZ A;  4DCK A;  2ZAE B;  2WPV B;  1K9M Q;  3AE7 C;  3A0B H;  1VQK P;  2OYH B;  1BSN A;  1JY3 N;  3BAT A;  3EFF K;  3M0D C;  4U7J A;  1RNI A;  1SS1 A;  2O01 J;  3SFD C;  3M0A A;  3WMM 0;  2P58 A;  2WSF J;  5AW6 B;  4GDO A;  4U3F G;  2H43 A;  1ZXG A;  1DV5 A;  4COP A;  1QL1 A;  2FQ1 A;  2WVR A;  3TNU B;  4GR6 A;  2IPP A;  1L0L E;  3AE6 C;  2VLP A;  3S9O A;  5AW3 B;  3M9Q A;  3JCU H;  1L0L J;  3TDK A;  5KKZ C;  3V2N A;  2K2Q A;  1R8E A;  1L0N K;  3HTK A;  5DCK A;  2GM4 A;  2CPS A;  1CW5 A;  4OVN F;  2PEN A;  1GD2 E;  4RES B;  1SQX E;  3HD7 C;  1JB0 J;  1XTC C;  1FS0 E;  4R4L A;  2L4B A;  2AF8 A;  4U0A A;  1P84 H;  5KLV D;  1F80 D;  1Z6M A;  4PD4 I;  1LTJ C;  3M1M A;  1G1I A;  2KLU A;  1HJ0 A;  2FFD C;  3VMY A;  3NY7 B;  2M3B A;  1VDF A;  2LPK A;  3Q5P A;  3L75 D;  1HTL C;  1W2B O;  2K94 A;  3RBZ A;  1KQF B;  2QVA A;  2JR8 A;  3WUT A;  3OA7 A;  5H2F H;  2W90 A;  2PRR A;  1UIX A;  1RQV A;  2FAC A;  1KIL D;  4BWN A;  5KLI B;  1GXG A;  3B4Q A;  2WPT A;  3H1L J;  2OYH C;  1HBW A;  4IZ6 A;  3KZI H;  3HD7 B;  2QJP C;  2E74 C;  2K0X A;  1VKU A;  2YIU C;  3RK3 D;  2X2B A;  2AXT H;  3LW5 J;  5KAF H;  5K5G B;  4I1L A;  1NU1 K;  3D6Z A;  1SQQ G;  3RG2 A;  4WY4 D;  4PJ0 E;  2LIU A;  3FXE A;  2JO0 A;  2GYK A;  3RL0 D;  4ZKU A;  2YXQ B;  1DEE G;  2QJP B;  1PEM A;  4DJG A;  4PV1 C;  3N4X A;  1A43 A;  4YTP C;  2N50 A;  2A06 D;  2BCC J;  4BRY A;  1Y9B A;  1HGZ A;  2ZXE B;  3GJN A;  2E74 B;  3H1J G;  3BRT B;  3HZQ A;  1YI2 P;  3VOP A;  3CCL P;  2D2C C;  3BCC J;  2O1K A;  1FZC C;  3M9H A;  1J2J B;  2K0Y A;  3CX5 D;  4JYB A;  4NPE A;  2M5R A;  3RG6 C;  1SQB G;  2ITA A;  4IOI H;  2QEX P;  1GXH A;  2NPS B;  3CCE P;  2IFM A;  2JAZ A;  3A7O A;  1LJ2 A;  4WYM A;  1VQ4 P;  3H1K E;  3DS2 A;  4UHP B;  3L70 G;  2Y0D A;  2ZXX A;  2XZR A;  3H1L G;  3MUD A;  4NEO A;  2J5U A;  2Q6Q A;  5EFW B;  4UB8 E;  2ZYG A;  4N6J A;  2NPS D;  2IYP A;  5F2N A;  2V7Q H;  1KB9 I;  3G71 P;  2M8R A;  3T97 A;  4EOT A;  2B87 B;  3H1I D;  1NGM B;  2KZJ A;  2QRX A;  2EG5 A;  2E76 C;  1PP9 J;  4PD4 H;  1ZRT E;  3L4F A;  5CCG A;  1GL2 C;  2KR5 A;  3L71 J;  1KYO E;  3MGE A;  2LL8 A;  2O1J A;  1BSH A;  1SP4 A;  3AE1 C;  2OTK E;  1GW3 A;  2I1K A;  3MUD C;  1MZ8 A;  3RL0 g;  1ZR4 A;  3A0H H;  1SQQ K;  3AE9 C;  1A02 F;  4H2X C;  2CNR A;  1NTK E;  2DW3 A;  2VLQ A;  4ASV A;  3GZL A;  3CX5 E;  1WRG A;  1M7L A;  3CCV P;  1NTM G;  2GZJ A;  3CCQ P;  3AEG C;  4LGD E;  3L72 E;  2OTJ P;  1YBK A;  4H0L C;  1NHL A;  5AVZ B;  1IUQ A;  2WSC J;  4WY4 A;  5KLV K;  3C1L A;  4PV1 B;  2E76 D;  2M8L A;  4R0M A;  5AW5 B;  3H0D A;  3PTZ A;  1SQV D;  2XT1 A;  1GMJ A;  3CXH H;  5BU5 A;  2KXP B;  1NTZ D;  1J1D C;  2PNG A;  3L75 G;  3L71 E;  2CQ8 A;  1IFJ A;  1Q81 Q;  2MKV A;  4MN4 C;  2PEM A;  2XXM A;  5HGO A;  3PLN A;  1AUM A;  2EHT A;  1LWU A;  1BE3 E;  2NZ2 A;  1SLQ A;  2QJK C;  2P10 A;  2KW2 A;  4XRO A;  4H0L D;  1QEX A;  1JY3 O;  2QSI A;  1SQV G;  1DNY A;  1GL2 B;  5APW A;  3FWL A;  1S9K D;  2N9Y B;  1FZG A;  1S5L X;  3IAO A;  3CWB G;  1VQ7 P;  4XE5 B;  1LTT C;  3BCC D;  1SQP G;  2K0D X;  1S4X A;  2M3E A;  2K9Y A;  2WWW A;  4IFD K;  2PEO A;  2O01 H;  1K73 Q;  2JQ4 A;  2FYU E;  3AE2 C;  3NMD A;  2WSF H;  1KMI Z;  3AEC C;  2ZVO B;  1K04 A;  2KG9 A;  2Z5I A;  1FBM A;  1FJP A;  5L8R J;  1Q90 D;  1UNK A;  4JYC A;  1RO0 A;  1OW8 A;  3FWN A;  3RK3 C;  1USD A;  2YNY A;  4XFJ A;  2MR8 A;  2JWD A;  2Q1K A;  3L37 A;  4K3A A;  3MZW B;  3NTN A;  1PGO A;  1SQB E;  2GZF A;  1FDO A;  2H88 C;  1LT9 A;  1NYH A;  3L70 E;  2C9L Y;  4AYC A;  1ZNV A;  3OAK A;  5B66 E;  1K8A Q;  2UWJ E;  4HH2 A;  2FYZ A;  1VQP P;  1R5S A;  3V2Q A;  1BCC D;  1QVF O;  2LXC B;  1OIP A;  1OVV A;  4OWF A;  1YIT P;  1PP9 D;  1G2C A;  1EZV I;  2JB0 A;  2QJK B;  1AFO A;  2N6Y A;  3IFM A;  1HVV A;  2JBG A;  2NO8 A;  1VQN P;  2KOG A;  1ZP0 C;  2VLN A;  2WTY A;  3H4E A;  1FJK A;  4R4M A;  2K9J B;  4WBA A;  2M8P A;  1L0L G;  4JQ0 D;  1X3O A;  3EJE A;  2LIW A;  5AVW B;  1OW7 A;  1PFI A;  2ZYA A;  2JU2 A;  2GUS A;  4L76 A;  2AEF A;  4OH8 B;  1KIL E;  2OAR A;  1NU1 G;  3G29 A;  3H25 A;  2JGP A;  2Q7C A;  2EIA A;  1YTZ T;  2QE7 H;  3A5T A;  3E1R A;  1AQ5 A;  1NTK J;  3VMZ A;  2BEZ F;  2LXB A;  2Y9Z A;  2N9B A;  1YJN P;  4I7Z C;  3L75 E;  1YIJ P;  3RK3 E;  4ZNC A;  2PAJ A;  4EYY Q;  3DS4 A;  3HUS B;  3WUU A;  1NU1 J;  1GK6 A;  2WPS A;  5BS2 A;  3HE4 A;  3CXH E;  3RK2 B;  1M1J B;  1KFM A;  1BGY D;  2AEM A;  1RF0 A;  4B86 A;  3FGA D;  4L73 A;  3G9R A;  5CCH C;  4PJ0 H;  5HV8 A;  2WSS H;  1USE A;  2CK3 H;  1M8O B;  2WIT A;  1RH5 B;  2FFD A;  2V4H A;  2KS1 A;  3P05 A;  1ZOY C;  1IFP A;  4HB1 A;  1OZH A;  1EZV E;  1TU3 F;  3P8C E;  3G6E P;  4WVZ A;  1URQ D;  5KJ7 C;  5KP7 B;  1AV1 A;  2XZ1 C;  1NTZ E;  1IO4 A;  3KDP B;  1OX3 A;  5DJT B;  1SVF A;  1BGY G;  5B66 H;  5APU A;  2KGE A;  3CC4 P;  3AED C;  2NPS C;  1MFT A;  4QMA A;  2CG5 B;  1KYO H;  1BCC J;  5KLV G;  1AF8 A;  4I6M C;  2FAE A;  1LGH B;  1EDI A;  3P8C D;  2G3A A;  4U0F A;  3K5B A;  2V7Q J;  5CMZ A;  3Q5S A;  1U7J A;  1AYI A;  1LTI C;  2BCC G;  2KGC A;  2HFE D;  1GZL A;  1L0I A;  3KXD A;  2LKM A;  1S72 P;  1YQ3 C;  3H6P A;  4C7R A;  2FXM A;  1LTS C;  2BCC D;  2QJY C;  2BHV A;  1NAY A;  5F2K A;  3QH9 A;  3O6Q B;  4UB8 H;  3WBH A;  2H8P D;  2H89 C;  1CEI A;  2SPZ A;  2Z5H A;  2IBZ D;  1J1D B;  2ZT9 D;  2YKQ A;  2W83 C;  3H1J E;  3SWK A;  3H1H D;  2N1T A;  4EI2 A;  4MRT C;  3B5N D;  2AFE A;  2KSE A;  3L74 D;  2O3J A;  1SFC B;  3V2P A;  4M3L A;  3V5B A;  2L0Q A;  1K30 A;  2B88 A;  3KPE A;  2R44 A;  1S5L H;  4ASW A;  3M0D A;  3GLM A;  3AE5 C;  1H0T B;  2QJY B;  1KQG B;  1EXI A;  2P2U A;  3GF3 A;  1FE6 A;  4U3F J;  4Z1M H;  5CHX A;  2YIU B;  3A0B E;  4H44 B;  3CI9 A;  3H32 B;  1IMP A;  2HOD B;  3B71 A;  4JBZ A;  4GOD A;  2WT7 B;  5KLI C;  5CBO A;  3BCC G;  3GKL C;  2ZT9 C;  1RE4 C;  3L73 G;  4D6T J;  1RY3 A;  1ZW0 A;  2HLO A;  3B5N A;  3L71 D;  1WMK A;  2J58 A;  2D2C B;  2QG4 A;  3RGU A;  1EZV G;  1L4A D;  3KZI E;  1PGP A;  4F37 A;  3VMA A;  4PXH B;  1KV4 A;  4IFF A;  1JUN A;  1LT9 B;  1LWU C;  2B87 A;  3TGU G;  1BDD A;  2BUO A;  3WU2 H;  1SQP D;  1NU1 D;  3ABV C;  2LOL A;  3CWB D;  1FZC A;  2FY8 A;  5CCG C;  3H1J J;  2AVA A;  3I5C A;  5B5E E;  1ZME C;  3L74 E;  2HPC B;  2YO3 A;  3L73 J;  1EMV A;  5AVV B;  1JTH A;  1KD1 Q;  5AW2 B;  1MZ9 A;  1HGV A;  2KGA A;  1KYO D;  3SWY A;  3M06 A;  2K1A A;  2KOQ A;  2CWO A;  3V4Q A;  2MVU A;  4H44 C;  3HRN A;  2AEJ A;  1H8A A;  4IL6 H;  3U43 A;  5EJD A;  4N3Y B;  1S1C X;  1PL5 A;  2FBW C;  1KLP A;  2L5G B;  1LNQ A;  2C0X A;  1URQ B;  1YHQ P;  1FDI A;  1JMM A;  4Y99 B;  3GW6 A;  2K37 A;  7CEI A;  1SFC C;  1KB9 H;  4JF7 A;  5AVQ B;  1IMQ A;  1N7S B;  2HG5 D;  5BVZ A;  1L0N G;  1NTM E;  2ZFC A;  2M5A A;  2WMM A;  5APY A;  3KHU A;  2RN0 A;  3DS1 A;  3P7K A;  1DD3 A;  3H1K J;  4L75 A;  1X8Y A;  3LRY A;  4BPH A;  1MFZ A;  3HUS A;  2K3R A;  3H1L E;  1FOS E;  1MV8 A;  4GKG A;  1N8R Q;  1JJ2 O;  1L4A A;  4LC1 A;  1Y8A A;  1LP1 A;  1T6A A;  2KB7 P;  3V4W A;  1H88 A;  1VF5 D;  3CX5 H;  3MGN A;  3LW5 H;  2GZG A;  2JP3 A;  1BE3 J;  5H2F E;  1NWQ A;  2YMY A;  3AEA C;  2FFD B;  3VTP C;  3VN0 A;  3A2A A;  4YXD C;  3TSI A;  3CE7 A;  5DJU B;  2XV6 A;  3RBX A;  2XV5 A;  1SQX G;  5KAI H;  3CC7 P;  1LTG C;  3CWB E;  2IBZ G;  1EDK A;  2E76 B;  3HD7 D;  2ROQ A;  3NTE A;  1Q86 Q;  1HY8 A;  3L73 D;  1VHN A;  1GL2 A;  2AXT E;  2GDY A;  1KIL B;  1JCC A;  2G8Y A;  2JEE A;  2FHS C;  2R5B A;  1HWT C;  1RE3 C;  1GW4 A;  1HUC A;  4D6T D;  2CPB A;  2Z4E A;  3AE3 C;  4AUW A;  3H47 A;  5KLV J;  3I55 P;  4RO0 A;  3AEE C;  2AXC A;  2JO1 A;  1RQU A;  2IDB A;  4H2W C;  1L0N E;  2P1J A;  1DX7 A;  2QNW A;  2L6E A;  1L0N J;  2XZ0 D;  3G4S P;  1YJW P;  3WUV A;  2KK7 A;  2ZVN B;  3JCU E;  4JPZ B;  2K9J A;  1RF0 C;  1URQ C;  1VQL P;  1FU1 A;  1VQ8 P;  2JDI H;  1SQQ D;  5E79 E;  2JJL A;  3JSV C;  1RF1 B;  1KB9 E;  4AQR D;  3G26 A;  3LID A;  1M6E X;  3CCS P;  1IJD B;  3R2P A;  3U1A A;  3CL3 D;  2FVE A;  1P84 I;  2E1M A;  1VQ9 P;  1FR2 A;  1Q2N A;  1RE4 A;  1G2C B;  1SQX J;  3DPH A;  2Y9Y A;  1VQO P;  3II6 A;  1JEK A;  2Q9I A;  3H1K D;  1JY3 P;  3BRV B;  1CSB A;  2K88 A;  3A3Y B;  2Q3E A;  1E0H A;  3RK2 D;  5KAI E;  2W6B A;  1HJB A;  3W67 A;  2J59 M;  3MIW A;  3GHG B;  3OW2 O;  1GL2 D;  1DIP A;  1K05 A;  2FQ0 A;  5KTB A;  3UIA A;  4YXW H;  1NKZ B;  1N2D C;  2DGY A;  1LT1 A;  1M56 D;  3DS5 A;  2N1T C;  2WSE H;  3EJB A;  1SQP J;  5AW8 B;  5EW5 E;  2MY5 A;  3ZDM A;  4NPF X;  3CD6 P;  1FZA A;  2ZJS E;  2FKW B;  2MD9 A;  2A45 G;  1JMB A;  2C0W A;  3CXC O;  1VF5 B;  5CCG D;  3AE8 C;  1EZV D;  3FXD A;  2W6A A;  3DS3 A;  2RKL A;  1KB9 D;  5CCH A;  4CA3 A;  2N6Z A;  1QLE D;  1QX8 A;  1BDC A;  3G21 A;  1SQB D;  1FZC B;  2FYN C;  4GT1 A;  4C7N B;  2KOD A;  3MTU E;  2KIK A;  3M9B A;  4HKZ H;  1NOH A;  1QVG O;  5JPA A;  3GMA A;  3HE4 B;  1FOS F;  2HPC A;  5APS A;  4WWI A;  1XTG B;  1VQ5 P;  1EQ7 A;  4W7Y A;  2VLO A;  1OMI A;  3VP8 A;  4BPG A;  4U0E A;  3L70 D;  4HKG A;  2N5H A;  2IZ1 A;  3CCR P;  3Q5R A;  2Z44 A;  1EXJ A;  2A06 G;  1RE3 A;  1Q7Y Q;  2KSJ A;  1W2E A;  3VP9 A;  4KHX A;  3VYI A;  2KOP A;  3L36 A;  1KC8 Q;  4O9B A;  1MKM A;  3G1I A;  3L74 G;  3EFG A;  1EDJ A;  2OGU A;  1EDL A;  1IC2 A;  2PEK A;  2EHS A;  5APV A;  2I8D A;  1NAF A;  2B89 A;  2KNC B;  3TYY A;  2JYG A;  2QM7 A;  1FZE A;  3L75 J;  2LKI A;  3MD0 A;  4IL6 E;  3FX0 A;  3B4S A;  2IBZ I;  4L74 A;  4D6T G;  1M57 D;  3S1K A;  2KOR A;  3SSU A;  5AVR B;  2IYO A;  1GPJ A;  4TT3 H;  2MF4 A;  1SQX K;  1L4A B;  1YYC A;  3D71 A;  1D1D A;  1NTK K;  2IX7 C;  2MVV A;  2GDX A;  2D2C D;  4DZO A;  1JNM A;  1EC5 A;  3H1H E;  3DTJ A;  1SFC A;  3CXH D;  1NVO A;  3JC2 2;  4H0L B;  4U0C A;  3L73 E;  4H13 C;  2BAS A;  3SFE C;  1RO2 A;  2R3C A;  1GDT A;  1PPJ D;  1H0T A;  2B9B A;  4XRQ A;  4U0B A;  2N98 A;  2E74 D;  3E7K A;  4WB4 A;  4QNB A;  3CMA P;  4PD4 D;  1KZU B;  3G1G A;  5F2O A;  1SQP K;  5HGN A;  3HE5 B;  1BE3 D;  2O01 N;  5AW1 B;  1J1E C;  5TIS H;  1L0L D;  4GOE A;  1FAV A;  1KQS O;  2QIW A;  1M74 A;  3Q3D A;  1IFM A;  3L70 J;  3P32 A;  1KN7 A;  4BXL A;  2HR3 A;  1ZMB A;  3CCJ P;  3TGU E;  3B5N B;  5KLV E;  1VQM P;  3H32 A;  2K92 A;  3EWK A;  3PJS K;  1OVU A;  2VSQ A;  2GDW A;  2R32 A;  1UJZ A;  3H1I E;  3HUS C;  5AW7 B;  4U3F D;  5BS1 A;  3IF4 A;  1PP9 G;  2YKP A;  2YXR B;  1KFN A;  2XKM A;  1N73 B;  4N78 D;  2BCC E;  1BCC G;  2KG8 A;  1R5L A;  2DNW A;  4TLF A;  2PFX A;  5HVC A;  1E79 H;  1M1J A;  5M1B A;  2YO2 A;  2PGD A;  1BCC E;  2K93 A;  2OQQ A;  4KT0 J;  1G1J A;  1N73 C;  1GK4 A;  2GA1 A;  1IK7 A;  2FYU K;  1JTH B;  2POH A;  1HF9 A;  1X22 A;  2L9F A;  1PEO A;  5KJ7 A;  3LIE A;  1IFN A;  1CZQ A;  1DD4 A;  2WPQ A;  1NTZ J;  2FXP A;  1NTZ K;  4N78 E;  1PPJ G;  4M0I A;  1SQQ J;  4GOF A;  5C39 A;  5TJH A;  3RK2 C;  2HYN A;  5AVT B;  3HYB A;  1PGQ A;  5CZD B;  4XFX A;  1URQ A;  1D7M A;  2FVF A;  3CCM P;  3GHG A;  2JWA A;  4LLH A;  2E5T A;  3A0H E;  2R3S A;  3QWO C;  2YKO A;  1J1E B;  1N7S A;  1AA0 A;  3B5I A;  1NJI Q;  2WQY C;  1OVR A;  1NKN A;  3L71 G;  1M1K Q;  2FYU D;  1VQ6 P;  1RF1 C;  5AVU B;  3G28 A;  1PIX A;  1T8Z A;  1N86 A;  3IN6 A;  2Z46 A;  1LTJ A;  2KOS A;  1SQV E;  1SQB K;  1PGJ A;  5AVY B;  3L74 J;  2C9N Y;  1KIL A;  4I2L C;  1E6J P;  4W7Z A;  1OXZ A;  2W8Z A;  3B8E B;  3H1I J;  1L2P A;  3L72 J;  2H7H A;  1SQP E;  4RKU J;  2OYI B;  1JCD A;  5KKZ B;  5HGM A;  3C8V A;  1T2K C;  2IFN A;  2KWL A;  5APQ A;  1N7S C;  1ACP A;  1NTZ G;  1PEU A;  3PHL A;  3RL0 B;  1GU4 A;  3L72 G;  4WY4 B;  1LTJ B;  3TF5 A;  2N1T D;  3HD7 A;  1S9K E;  3B5N C;  2K5X A;  3H1H G;  4U0D A;  1DH3 A;  3GZM A;  1L0N D;  2M8N A;  2I1J A;  3H1I G;  1FZF A;  1PP9 E;  4XA4 A;  2OYI C;  3Q1M A;  3CCU P;  3Q2Y A;  2BEQ D;  1DEB A;  2ERH A;  1P84 D;  2KUB A;  3EQ2 A;  4DT0 A;  3N7N A;  2QM8 A;  4CPG A;  3H1H J;  2Q5U A;  1T3J A;  2LR2 A;  1T2K D;  1A02 J;  5E79 H;  2PP6 A;  2AFD A;  2NRG A;  4BRY B;  3V6I A;  2E75 D;  1JY2 N;  1JY2 O;  1BE3 G;  1BAJ A;  1LTB C;  1L0H A;  2KP8 A;  3PRJ A;  1E5W A;  3U59 A;  3V2R A;  2A06 E;  2FYN B;  4BPF A;  2FXO A;  3GG2 A;  2KOO A;  1M1J C;  3S4R A;  1X0T A;  2RMZ A;  4ZKP A;  2QA4 P;  5KP8 B;  5HGL A;  5CJ0 A;  1OFC X;  4DG9 A;  1VL2 A;  5BU8 B;  2PEJ A;  5AW9 B;  2RH0 A;  1QL2 A;  4YPC A; 
#chains in the Genus database with same CATH homology
 2EFJ A;  4XRO A;  3I55 P;  3CD6 P;  4IPY A;  5HGM A;  1M90 Q;  5I4T G;  2EG5 A;  4PH1 A;  4COP A;  4GR6 A;  3CXC O;  2LF4 A;  3VRL C;  1PEU A;  2BQ1 E;  3DS3 A;  1VQN P;  2L6E A;  2JO0 A;  3CC4 P;  1QRJ A;  1D1D A;  3MGE A;  3H4E A;  3G4S P;  1YJW P;  1PEO A;  1VQ7 P;  1PEM A;  1Q82 Q;  2JYL A;  2M8P A;  1A43 A;  4COC A;  2PY8 A;  3DTJ A;  1VQL P;  3DS1 A;  3G21 A;  1VQ8 P;  3LRY A;  2PEQ A;  4XFY A;  4U0D A;  4U0F A;  5DCK A;  2PEO A;  4U0C A;  1K73 Q;  2KOD A;  4M0I A;  2M8N A;  4GR2 A;  2OAR A;  3G29 A;  3G26 A;  5JPA A;  3CPW O;  1QVG O;  1N8R Q;  2EIA A;  2Z45 A;  1JJ2 O;  3DS0 A;  1M6E X;  1RO2 A;  3CCS P;  2PEN A;  3HYB A;  1VQ5 P;  3HZQ A;  4XRQ A;  3CCU P;  1S72 P;  4XFX A;  1YI2 P;  3E2D A;  1YJN P;  4U0B A;  3CCV P;  2E1M A;  1YIJ P;  3CCL P;  3CCQ P;  2PEI A;  3Q20 A;  1VQ9 P;  2BHV A;  4U0E A;  5F2K A;  3CC2 P;  2BUO A;  3I56 P;  2OTJ P;  4QNB A;  1RO0 A;  4U0A A;  3CMA P;  3DPH A;  3CCM P;  1VQO P;  3CME P;  3DS4 A;  3CCR P;  2OTL P;  3G1G A;  5F2O A;  5HGN A;  1IUQ A;  2Z44 A;  3WBH A;  3M1M A;  3RG6 C;  2M8L A;  5BS2 A;  2QEX P;  1PEQ A;  1Q7Y Q;  3B5I A;  3H0D A;  1NJI Q;  1A8O A;  3CCE P;  2ONT A;  2XV6 A;  1M74 A;  1KQS O;  1KD1 Q;  1BAJ A;  2XT1 A;  4WYM A;  1VQ4 P;  1KC8 Q;  1YJ9 P;  3CC7 P;  1EOQ A;  3DS2 A;  1M1K Q;  3G1I A;  3G0V A;  1ZMB A;  3CCJ P;  1VQ6 P;  2CWO A;  3NTE A;  1W2B O;  3G28 A;  1Q86 Q;  1EIA A;  1VQM P;  1M6N A;  4XFZ A;  1K8A Q;  3OW2 O;  1K9M Q;  2Z46 A;  1K30 A;  2QA4 P;  2PEK A;  1VQK P;  3P05 A;  1Q81 Q;  5HGL A;  1E6J P;  2PEM A;  5BS1 A;  1VQP P;  2XXM A;  5F2N A;  2DGY A;  2P9X A;  1RNI A;  4PH0 A;  3G6E P;  2PEJ A;  3G71 P;  1QVF O;  3DS5 A;  5HGO A;  1AUM A;  1YIT P;  2JYG A;  1YHQ P;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...