1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
1YITP 1YJNP 1QVGO 3CC2P 3CCQP 3CCEP 1NJIQ 1YJWP 1M1KQ 3CCLP 3CCJP 3CMAP 3G6EP 1VQ4P 1VQ7P 3CCUP 3CCRP 3CCSP 3CCVP 2OTJP 1W2BO 3CC4P 1JJ2O 1VQOP 3CXCO 1Q7YQ 1YJ9P 1Q82Q 1Q86Q 3G71P 1N8RQ 3G4SP 1K73Q 1YI2P 1KD1Q 1VQ5P 1YHQP 3CCMP 2OTLP 1VQMP 1KQSO 3CD6P 2QA4P 2QEXP 1K9MQ 1KC8Q 3CMEP 1VQLP 1YIJP 1Q81Q 1VQ9P 1VQ6P 3CPWO 1VQNP 1VQ8P 1VQKP 1S72P 1K8AQ 3I56P 3CC7P 1VQPP 1M90Q 3I55P 1QVFO 3OW2O
chains in the Genus database with same CATH superfamily
1VF5D 1ACPA 2D2CC 1QVGO 3USSA 1WMKA 4DJGA 4NPDA 2KK7A 1KYOE 2LL8A 2W6JH 2H88C 3LRYA 2PEKA 4COCA 2X2BA 2L4BA 2L5GB 2JQ4A 2FADA 2FVFA 3W67A 3BVHA 1SQBK 4PV1C 3RG6C 3L75G 1KILB 1KYOI 2N6YA 1BDDA 2WSEJ 2FFDA 1KTMA 1U7JA 2IFMA 2LR2A 3N4XA 4H13C 1K04A 1NTZE 1BSNA 4A7PA 1EDJA 2YO3A 1Q7YQ 1LWUA 3CD6P 4H0LB 3L71D 3RK3B 1IZNB 2CPSA 2EFJA 3G0VA 5CJ0A 2IZ1A 2K3RA 3S4RA 2BEQD 2BCCG 2IBZE 1N2DC 1RE4A 1SQBE 1SVFA 1JJ2O 1HGVA 4PV1D 2J59M 5HGLA 2OYIC 3L74E 5AW6B 2Y9ZA 3VYIA 2QIWA 1FZCA 2ZT9C 2ZVOB 2N1TB 3HTKA 2IBZI 1PIXA 4H13D 1MV8A 4WVZA 2AEFA 5DJTB 3TNUA 2K1AA 1WRGA 4GR2A 1YJWP 2A45G 5HVCA 2QE7H 2O1KA 3L4FA 1AFOA 1Q81Q 4BPHA 1IFPA 1HJBA 1FZEA 1L0HA 3H1JJ 5APXA 4GDOA 1KILC 3H1LE 1QRJA 5BS2A 3E1IA 1BE3E 1FBMA 1PP9G 3JSVC 2KS1A 1GU5A 4H0LC 3RK3C 2CK3H 3M9QA 4NPEA 1OZHA 3GMAA 3Q5PA 2C9NY 4U3FE 2GZFA 2JWDA 2I8DA 5APSA 1M7LA 1SFCB 2N6ZA 1GK4A 2PEMA 2GDYA 3R4YA 1KILD 3SFDC 2GM4A 2N1TC 2LMLA 3SWKA 1MZ8A 1IFJA 1JY2N 3L72D 2P7JA 5KLVE 4H0LD 1FR2A 1P84E 3L37A 1D1DA 2M5AA 3TGUE 1NU1G 3D6YA 1KN7A 2AFDA 2IX7C 4AYCA 1SQPE 5CHXA 1VQKP 1SQXE 1X79B 3AEEC 1K05A 3Q2YA 1S5LE 1P84I 3H1KG 3A7OA 1SQQD 1SQVK 2IYPA 3SFEC 3U43A 5BS1A 5AW7B 1KB9H 2KW2A 2N1TD 3MUDC 1L0LK 3H32A 3HE5A 3VP8A 2HFED 3H0DA 1IFMA 3L71J 4UHPB 3H4EA 1SP4A 5APUA 1DD3A 2K93A 3LW5H 2YNYA 1S2EA 2OYHB 1EDLA 5AW3B 1Q90D 2OTJP 3VMZA 1SFCC 1FC2C 5AVTB 1JMBA 1NVOA 4YXDC 4M3LA 1M6NA 3V2QA 2ONTA 4WWIA 4HJGH 1DEBA 3V2PA 1LTJA 1MFZA 1Z6MA 3WU2E 2L91A 4L73A 1OW6A 2XU6A 3CCMP 1T3JA 1RF1A 4GODA 1NAYA 1VQNP 1K30A 2W27A 4BRYB 1L4AD 4XFZA 1SFCD 2XZ1C 2GUSA 2JKVA 3CCQP 4IPYA 1VQ7P 2ZYGA 2KOSA 2K88A 3P8CD 2VSQA 2B87A 2Z5HA 5B66E 5AVYB 4B86A 2GUVA 3HUSB 2M8RA 1AUMA 4OGQD 2OYHC 5APYA 1RF0A 3L73E 3DS5A 3GZMA 1UNKA 3A0HH 5AVUB 1AVOA 1SQVD 5CCHC 3L70E 2A45H 1D7MA 1FZBA 2M3BA 1L0LD 3A0HE 5BU5A 4BPFA 3L72J 3GKLC 3LIEA 1YYCA 2R5DA 1HBWA 2E43A 2P9XA 3MD0A 1VQ4P 2JR8A 2WSFJ 2E74B 3I5CA 4LC1A 3TF5A 2B88A 2FXPA 1GTWA 1SQQJ 3L75D 2Z44A 1ZRTD 2LXCB 2K0YA 5CCHD 1ZR4A 4KT0J 1JCDA 3GLMA 3CXHI 1HY8A 2FFDB 1UJZA 3FXEA 3GJNA 1H88A 1QL2A 5KAIH 2JYGA 1NTZG 1PZQA 4AUWA 1LWUB 3HUSC 2QVAA 2ZAEB 1NU1K 5CCGA 4IFFA 5K5GB 3CX5H 1E79H 2VRSA 1L4AA 2XV6A 2HODA 3CCJP 2FVEA 5EW5E 2KODA 2IBZG 1QLED 2XNDH 4PXHB 2GZIA 3NY7B 4HKZH 2KOGA 3L74G 1FZCB 3FWNA 5M1BA 3HTKB 1U7MA 4OH8B 3U1AA 1M57D 1JM0A 2K94A 3CWBD 2E74C 2KGCA 2YKQA 4QKOA 1N73A 2P10A 4HKGA 3JCUE 2PFXA 3D70A 2R32A 4EDFA 5DJUB 1HWTC 1M6EX 2FQ0A 4D6TE 5KKZB 2LTEA 1ZN5A 5JPAA 1S1CX 1PP9D 3CCSP 3L36A 2HR3A 3H1LG 3R2PA 3U59A 2FFDC 2CNRA 3CL3D 5KP8B 5CZDB 1VF5B 2M5RA 1YQ4C 5E79H 1A02J 4TT3H 1BE3G 4PWVB 2KS1B 1LWUC 2PEOA 2KP8A 4WY4D 2E74D 2VLPA 3Q3DA 3BCCE 2K0XA 3OA7A 1IFDA 2QJYB 1SQVJ 4PJ0H 4RO0A 4U3FG 3CX5D 1GK6A 1RE4C 1L0LJ 2A06E 5AVVB 1PGJA 3A5TA 2N98A 2O01J 2WTYA 1FZCC 3A3YB 2K2QA 4BXLA 4RJTA 2E5TA 3U1CA 1EZVD 4IFDK 5AVWB 4DOJA 2MY5A 1NTKD 2H8PD 3CC4P 4W7ZA 5KLVG 4UB8H 3L75J 2WPSA 3KPEA 1UIIA 3TGUG 4UB8E 3CI9A 5HGOA 1MFTA 2GZGA 4HYTB 3UIAA 2KNCA 3MTUE 3C1LA 1SQPG 5KKZC 1SQXG 1QVFO 4L74A 3BRTB 3KDPB 4GIFA 2FXMA 2JP3A 1OVRA 3H32B 1NTMG 1FE6A 4QMAA 1VF5C 1TU3F 3Q5RA 2K5XA 2PRRA 5CBNA 4U0EA 2GDWA 1FOSE 4XFYA 1EDIA 4IOIH 2ZFCA 4Z1MH 2KG8A 5L8RJ 5KTBA 3M9HA 1G1JA 2CG5B 1VQMP 3V4WA 1NHLA 3GF3A 1X3OA 5AVQB 1JNMA 1RE3A 1G2CA 1ZV8A 1NTZK 3Q20A 3CWBJ 3RG2A 4H2WC 1LTJB 4WY4A 1KYOH 3GF7A 1CI6B 3P32A 3AEGC 1L0NE 1CZQA 3HRNA 4XRQA 2GZEA 1A8OA 2AVAA 2FYUE 3TSIA 1KQSO 2I1JA 2MKVA 1T8KA 4R4MA 4EI2A 1Y9BA 2JYLA 1RF1B 3M0AA 2O3JA 3FXDA 2JWAA 1PP9J 3GZLA 3H1ID 2EHSA 4N3YB 1BGYE 2V7QH 2Z45A 3W68A 2N5IA 3PTZA 4HH2A 5APQA 2B87B 2J58A 5APVA 1J1EB 2FY8A 1EXJA 1M1JA 3Q5SA 4OVNF 1OR5A 3L73G 1PPJE 2PGDA 1Q82Q 2MJZA 2KGAA 4ZNCA 2FACA 2LKIA 3AE7C 2Z46A 3L70G 2AEJA 1NTKJ 2XDJA 1LTJC 1KV4A 1AV1A 4IL6E 5HGMA 4U0DA 3ITKA 1PEMA 2HG5D 3G9RA 1JY3O 2OYOA 1N86A 1RF1C 1BCCJ 3P7KA 4YPCA 1M74A 3L72E 3A2AA 3RK3E 2PAJA 1FZGA 3WMM0 2L9FA 1LTSC 2ROQA 3BATA 1OIPA 2B89A 1NTZD 4N6JA 1RH5B 2AXTH 1NAFA 1EOQA 1QL1A 5KLVK 3RBZA 1J1EC 1SQQE 3VRLC 4COPA 2AXTE 4C7RA 2KORA 1PL5A 2ZXXA 1S5LX 1JY3P 1RF0C 3PRJA 1FJPA 1L4AB 1SQBD 2E5YA 1SQPK 1SQXK 2HODB 4YXWH 1K9MQ 3L74D 2IPPA 1KQGB 3IAOA 1NTMK 1Q2NA 3EFFK 1NH4A 4U0CA 1GMJA 1P84H 3T97A 2BEZF 1YJNP 3AEBC 2J5UA 2RN0A 2YO2A 2I1KA 4OGQB 2QEXP 4DG9A 1S9KD 1URQA 1S5LH 2O1JA 1N73B 3I56P 3O8ZA 3H1IJ 3SWFA 2LOLA 1VHNA 4H44B 3G29A 2QNWA 2WWWA 3H1LD 1OX3A 4D6TG 4RKUJ 3AE2C 2M8NA 1NTME 1XTCC 2RMZA 1VQ5P 1WT6A 1JO5A 2WPQA 1BE3D 2Q1KA 1E6JP 3II6A 1MZ9A 5F2KA 1MUUA 2PENA 2OTKE 2QM8A 2PNGA 4ZKPA 1R5SA 1KORA 5CCGC 2KOPA 1KQFB 2DGYA 2M0BA 1L4AC 1UIXA 2E76D 3BCCG 2Q9IA 1LT9A 5AW5B 2FQ2A 2M8LA 5EFWB 1GPJA 1AJYA 2A06G 2KR5A 2JU1A 3VMYA 3KHUA 2KI7B 5CJ4A 3IN6A 1OFCX 1PV3A 3WU2H 1CI6A 3WUTA 2BUOA 4U0AA 1YITP 3CMAP 3M91A 3F5HA 5KLVD 2PEIA 3K5BA 1P84D 1RO2A 5AW4B 4OGQC 5BU8B 3TGUD 2KYVA 3NXSA 5CCGD 1LT1A 1N73C 1NYHA 2Q3IA 1BXIA 4I1LA 2WQYC 1SQXD 4R0MA 4R4LA 2E1MA 4H44C 4K3AA 1NTZJ 2KNCB 1EC5A 1FDOA 4GR6A 5B66H 4DZOA 2DNWA 1Q86Q 5KP6B 2QM7A 1YHQP 2OARA 5KP7B 1KB9D 1IUQA 2N50A 1S4XA 2BASA 1FOSF 1NO4A 1H0TA 1SQBJ 3IR9A 1PEQA 2ZYDA 4JF7A 2V4HA 2EHTA 2BQ1E 3L74J 1LTAC 3H1HE 3RK2B 5AVRB 1GZLA 4H44D 1S3JA 2N9BA 3GHGA 2QG4A 1ZP0C 3KYQA 1ZOYC 2R3CA 1G2CB 3AECC 2O01N 1X8YA 4U0BA 1ZW0A 1EMVA 1YQ3C 2P1JA 2WSCH 4WY4B 4PD4E 2MVVA 3CXHH 3DS4A 1L0NG 5EJDA 1N7SB 2XZRA 3CMEP 2FYUG 3CXHE 1S72P 5CBOA 2WSSH 3H1LJ 2LIUA 4PD4I 2RKLA 3CWBE 3CE7A 3G6EP 1BE3J 5H2FH 1IFNA 3G71P 1XTGB 2B9BA 3RL0B 5F2NA 1BGYG 3AE3C 5H2FE 4L75A 1RY3A 1VQLP 1YIJP 1VQ9P 1AQTA 5AW8B 3VTPC 1CSBA 2JBGA 4L76A 1KFMA 2BCCD 2GZJA 2WSEH 4IZ6A 3AE9C 1GXHA 2JJLA 3L73D 2CQ8A 2YIUB 1W2BO 1M1JB 1HUCA 1LNQA 2KWLA 2WPRA 3EWKA 3VN0A 1PPJG 5CMZA 3G26A 3HZQA 1JB0J 2XZ0D 5I4TG 4H2XC 2C9LY 5KLVJ 2K9YA 1RE3C 1JY2O 1J1DB 3S1KA 3RBXA 3D71A 2MD9A 3TGUJ 5F2OA 2AF8A 4WY4C 3JCUH 3DTJA 1SQXJ 3A0BE 1OXZA 1N7SC 1YTZT 2R3SA 1VQ8P 3FX0A 1EZVE 1KLPA 3I55P 3RK2D 1NKZB 2FYNB 1ZR2A 2GA1A 1BAJA 3L72G 1Z56A 3EJDA 5AVXB 4QNBA 2CWOA 3G4SP 1EZVI 3RL0C 3BASA 1X22A 4BWNA 1GL2A 1R5LA 1JY2P 4AQRD 1BCCE 3LW5J 3H1JE 4U7JA 1N7SD 4GT1A 1RQUA 2L22A 1SQQG 2K37A 5AVSB 3S9OA 2YIUC 3HD7A 1M1JC 2WT7A 1LP1B 1K73Q 1OVUA 2K9JA 4EYYQ 1DX7A 3SWYA 3WBHA 3SSUA 5GTIE 2WPVB 3LIDA 1VQPP 3MGNA 1JMMA 3RL0D 2G3AA 2PP6A 1J1DC 3PH0A 3FWLA 1NOHA 3B8EB 3T97B 4H2YC 1NU1D 2VLQA 4XFXA 4N78E 2ERHA 2JU2A 1IJDB 3B5NA 4O9BA 2MR8A 3IFMA 4W7YA 3C9IA 1JCCA 3H1KD 1URQB 2LF4A 3V5BA 3MHVA 1E0HA 2K0DX 4D6TD 2D2CB 1PEUA 2FYNC 4GOFA 1NWQA 3E1RA 2P67A 1MKMA 2YXRB 1T3UA 2H7HA 4C46A 5APWA 1ZXGA 2BCCJ 4MRTC 2IFNA 5HGNA 4W80A 4IFMA 1AQ5A 1L0NK 2FYUK 2N5HA 1QEXA 1U57A 3BCCD 2QJYC 3V2RA 1DNYA 3DS0A 4WBAA 2Q5UA 3L71E 7CEIA 2A06D 1A02F 2M8PA 1LT9B 3RGUA 3O6QA 1BDCA 2ZVNB 1HGZA 1OWAA 1NQ4A 3DS1A 1M1KQ 2FYZA 2Y9YA 4Y28J 1LTBC 4ASWA 3EJEA 5KAFH 1N7SA 1AVYA 2ZT9B 5KAFE 1GD2E 1FDMA 1M8OB 1H8AA 1URQC 4JQ0D 2WVRA 1L0IA 2KG9A 1OVVA 3B4QA 1H89A 5BVZA 3PP5A 2NPSA 1LGHB 5APTA 2EG5A 1KD1Q 2XKMA 1IK9A 1X0TA 4IL6X 1HJ0A 1BSHA 3NMDA 1IFIA 2Y0DA 4U0FA 2HYNA 2E75D 1F80D 4F37A 1H0TB 4HB1A 3CXCO 1YJ9P 1URQD 4TLFA 2D2CD 3H1HG 3P8MC 1LT9C 2MR7A 3P05A 5KLIB 3QH9A 1RQVA 3GHGB 1JTHA 4IL6H 5TISH 1IO4A 1DH3A 4EOTA 4XE5B 2AEMA 4DCKA 1LTTC 1NU1J 2N9YB 1RO0A 5TISE 2KGDA 3AEAC 3GW6A 1L0ND 1KILE 1FS0E 2FYUD 1SQQK 1KYOD 3H1KJ 2KOOA 2EIAA 1NGMB 4D6TJ 4I7ZB 2KOQA 3VOPA 4ZKUA 2E76B 2WZ7A 4XFJA 2LXBA 5KJ7A 2ZJSE 2WSFH 1IC2A 1BGYD 3CWBG 1S9KE 5B5EH 3C8VA 2MF4A 2CGQA 4I6MC 5B5EE 2W90A 3CLQA 3BCCJ 5TJHA 3NTNA 2ZT9D 2JDIH 3AE6C 1EIAA 3DS3A 1LP1A 1PGQA 1FJKA 2IBZD 3B5IA 3IF4A 2R5BA 1ZLLA 2PEQA 1JOCA 2HPCB 4PH0A 1PPJD 4C7NB 3EQ2A 2L0QA 2P58A 1GDTA 5KLIC 3GHGC 2E42A 1RNIA 1VKUA 2C0XA 2KG6A 3GG2A 3CCUP 3DPHA 1W5CE 1A43A 2KSEA 1GW3A 4I7ZC 2FVAA 4K35A 2E76C 1LTGC 2NZ2A 4LGDE 2QJPB 2FBWC 2FQ1A 2AFEA 4JYBA 1EZVG 3RK3D 2POHA 3PJSK 1NTKG 1SLQA 2NO8A 3NTEA 1J2JB 3MGEA 2LKMA 2QJKB 4Y99B 1YBKA 1HVVA 2KSJA 1ZNVA 1GL2B 2ITAA 1IMQA 3CCEP 3P8CE 1BCCG 3V4QA 3MP7B 3MZWB 4U3FD 1GW4A 4UB6H 3H1JG 4JYCA 4OWFA 2XNXA 1KB9E 4MN4C 3HD7B 1OW7A 4UB6E 2WT7B 1AA0A 2YXQB 2QSIA 2KUBA 2K9JB 4GOEA 2PY8A 1KB9I 4LLHA 1L0NJ 4PH1A 1N7LA 2OYIA 2FYUJ 3VP9A 2GDXA 3VMAA 1KQLA 3G28A 1SQVE 2O01H 2KIKA 2PEJA 2KGEA 1L0LE 1GU4A 3E7KA 5AW9B 3G1IA 1Y47A 2UWJE 1HQBA 3B5NB 1SQPD 1VPCA 3TK1A 2QJPC 2FXOA 3M0DC 1BGYJ 3BRVB 3CC2P 3CCLP 1DEEG 1FZFA 1PFIA 3HE4B 2V7QJ 1NTMD 3EJBA 2ZXEB 3M9BA 2QJKC 4Y99C 3L75E 1KILA 1PGOA 4WB4A 4JPZB 1ZRTE 3LMOA 4BPGA 1GL2C 3F89A 2VLNA 2W6AA 2Y0EA 2H89C 3H1IG 1DD4A 2JGPA 1JEKA 1N8RQ 4XA4A 1KZUB 3HD7C 2QRXA 2WITA 3B71A 3G21A 3H47A 1JUNA 1YTZI 1EQ7A 3AE1C 1HTLC 1VL2A 2MVUA 2DW3A 3L71G 2BCCE 3MIWA 1USEA 1LTIC 4M0IA 3H6PA 3AEDC 4PD4H 3O6QB 3FGAD 2HLOA 2N1TA 1GL2D 1KFNA 1IK7A 3KXDA 2K92A 1T6AA 1K8AQ 1ZMEC 3CC7P 3B5NC 2JB0A 1FZAA 3B4SA 3HD7D 4ASVA 2Q6QA 3N7NA 1R8EA 3AE4C 3EFGA 1RHZB 2A45I 2KZJA 2NPSB 3PHLA 2ZYAA 2RH0A 2SPZA 2BHVA 4U3FJ 2JO1A 3MUDA 3G1GA 1PP9E 2Q7CA 3G3ZA 2HPCA 4C7NA 1CEIA 3OJAB 3B5ND 3Q1MA 2OTLP 3TYYA 3RK2C 3H1HD 1AYIA 3ABVC 5AW2B 1NTKK 3L70D 5KAIE 1L2PA 3DS2A 3JC22 1PEOA 2YMYA 3OW2O 3ZDMA 1W2EA 4NPFX 1SFCA 1JTHB 3CX5E 3KQGA 1VQOP 3A0BH 1FAVA 1SQBG 2Z5IA 4PD4D 3V6IA 2FKWB 3RL0g 2GYKA 4WYMA 1KC8Q 1SQPJ 2VLOA 5AVZB 3M0DA 4EIJA 3CXHD 3WUUA 3CX5I 4I2LC 5DCKA 1SS1A 2KLVA 1NTKE 1EXIA 1NTMJ 1NJIQ 1VDFA 3TNUB 1NU1E 1QGKB 1E5WA 2W6BA 2H43A 2M3EA 2NRGA 1KMIZ 4DT0A 1JY3N 1CW5A 2KB7P 2NPSC 5GTHH 3H1KE 3CPWO 1USDA 5GTHE 2XT1A 5AW1B 5C39A 4KHXA 4GKGA 1OW8A 2CPBA 4CPGA 3KZIH 2KLUA 5GTIH 2QA4P 3KZIE 2WPTA 3V2NA 2OYHA 2Y0CA 1PGPA 3E2DA 2WMMA 5E79E 2FAEA 5HV8A 1HF9A 3VMXA 2NPSD 3QWOC 3D6ZA 1NKNA 2IZ0A 2W83C 5CCHA 2E75B 1YI2P 3OAKA 4PJ0E 2YKPA 3NFQA 1FU1A 2JO0A 2YMKA 3HE4A 1IMPA 2C0WA 1GXGA 5AW0B 3M06A 5KJ7C 4BRYA 2M5AB 2JAZA 1X9VA 2AXCA 2G8YA 2P2UA 3WUVA 2OQQA 3PLNA 2IDBA 2IYOA 2FHSC 4PV1B 3L73J 2LIWA 2L6EA 3H1IE 1G1IA 1BCCD 1T2KC 1DIPA 2YKOA 4ZMDA 1FDIA 3H1JD 4H13B 2LPKA 2W8ZA 3H1HJ 3L35A 4NEOA 1AF8A 1OMIA 3HE5B 3L70J 3HYBA 4XROA 3HUSA 2JEEA 1VQ6P 2KXPB 2KZIA 4CA3A 3AE5C 4JBZA 4KJMA 1HH0A 5KJ7D 3TDKA 2Q3EA 1LJ2A 3M1MA 3CCRP 3CCVP 4YTPC 2WSCJ 4RESB 2E75C 2OYIB 2XXMA 2R44A 3AE8C 3H25A 4N78D 1T2KD 1EDKA 1ZMBA 1SQVG 2OGUA 1T8ZA 3AEFC 1DV5A 1M56D 1QX8A 1Y8AA 2Z4EA 1L0LG 2XV5A 1M90Q
chains in the Genus database with same CATH topology
1QRJA 1PEUA 3G1GA 2P9XA 5JPAA 1QVGO 3CC2P 3CCLP 1PEQA 5BS2A 5HGMA 4U0DA 1VQ4P 3CCUP 3CCSP 2OTJP 2BQ1E 2M8NA 5F2OA 3CXCO 1YJ9P 3DPHA 1PEMA 1YI2P 1VQ5P 2OTLP 3LRYA 3DTJA 1VQMP 1A43A 2PEKA 4COCA 1M6NA 1E6JP 2ONTA 5F2KA 1VQ8P 2PENA 2PEOA 5HGNA 3P05A 1M74A 3DS2A 2Z44A 1PEOA 3RG6C 2JO0A 3I55P 3Q20A 3OW2O 4U0BA 1BAJA 1RO0A 2DGYA 4QNBA 4XRQA 1VQOP 1A8OA 3DS0A 1Q7YQ 2CWOA 1N8RQ 3G4SP 2PEMA 3CCMP 3DS4A 3NTEA 1KQSO 3CD6P 2JYGA 3MGEA 4WYMA 2M8LA 3G21A 1KC8Q 3CMEP 3H47A 1VQNP 1EOQA 2EIAA 1K30A 2M8PA 1S72P 2JYLA 4XFZA 3VRLC 2EFJA 4COPA 3G0VA 2L6EA 5DCKA 2BUOA 4U0AA 4M0IA 2XV6A 1YITP 3DS1A 3CCEP 3CCQP 1NJIQ 1M1KQ 4IPYA 3CCJP 3CMAP 3G6EP 1VQ7P 2PEIA 3CC4P 2Z45A 2KODA 1JJ2O 1D1DA 3G71P 1RO2A 5HGLA 1K73Q 5F2NA 3HYBA 4XROA 1K9MQ 1VQ6P 1VQLP 1YIJP 1VQ9P 3WBHA 3CPWO 1VQKP 1K8AQ 5HGOA 3CC7P 1VQPP 2XT1A 1AUMA 2E1MA 4U0CA 1QVFO 2PY8A 1YJNP 4GR2A 4PH1A 3DS5A 5BS1A 1YJWP 3M1MA 1EIAA 3DS3A 4GR6A 3CCRP 3CCVP 1W2BO 3B5IA 3H0DA 2EG5A 3G28A 2PEQA 1Q82Q 1Q86Q 1KD1Q 4PH0A 4XFXA 3H4EA 2XXMA 1YHQP 2QA4P 2PEJA 2QEXP 2OARA 1ZMBA 1Q81Q 1IUQA 3G1IA 3G26A 3I56P 3HZQA 4U0FA 3E2DA 4U0EA 2Z46A 5I4TG 1M6EX 2LF4A 1M90Q 4XFYA 2BHVA 1RNIA 3G29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  1YJN P;  1QVG O;  3CC2 P;  3CCQ P;  3CCE P;  1NJI Q;  1YJW P;  1M1K Q;  3CCL P;  3CCJ P;  3CMA P;  3G6E P;  1VQ4 P;  1VQ7 P;  3CCU P;  3CCR P;  3CCS P;  3CCV P;  2OTJ P;  1W2B O;  3CC4 P;  1JJ2 O;  1VQO P;  3CXC O;  1Q7Y Q;  1YJ9 P;  1Q82 Q;  1Q86 Q;  3G71 P;  1N8R Q;  3G4S P;  1K73 Q;  1YI2 P;  1KD1 Q;  1VQ5 P;  1YHQ P;  3CCM P;  2OTL P;  1VQM P;  1KQS O;  3CD6 P;  2QA4 P;  2QEX P;  1K9M Q;  1KC8 Q;  3CME P;  1VQL P;  1YIJ P;  1Q81 Q;  1VQ9 P;  1VQ6 P;  3CPW O;  1VQN P;  1VQ8 P;  1VQK P;  1S72 P;  1K8A Q;  3I56 P;  3CC7 P;  1VQP P;  1M90 Q;  3I55 P;  1QVF O;  3OW2 O; 
#chains in the Genus database with same CATH topology
 1VF5 D;  1ACP A;  2D2C C;  1QVG O;  3USS A;  1WMK A;  4DJG A;  4NPD A;  2KK7 A;  1KYO E;  2LL8 A;  2W6J H;  2H88 C;  3LRY A;  2PEK A;  4COC A;  2X2B A;  2L4B A;  2L5G B;  2JQ4 A;  2FAD A;  2FVF A;  3W67 A;  3BVH A;  1SQB K;  4PV1 C;  3RG6 C;  3L75 G;  1KIL B;  1KYO I;  2N6Y A;  1BDD A;  2WSE J;  2FFD A;  1KTM A;  1U7J A;  2IFM A;  2LR2 A;  3N4X A;  4H13 C;  1K04 A;  1NTZ E;  1BSN A;  4A7P A;  1EDJ A;  2YO3 A;  1Q7Y Q;  1LWU A;  3CD6 P;  4H0L B;  3L71 D;  3RK3 B;  1IZN B;  2CPS A;  2EFJ A;  3G0V A;  5CJ0 A;  2IZ1 A;  2K3R A;  3S4R A;  2BEQ D;  2BCC G;  2IBZ E;  1N2D C;  1RE4 A;  1SQB E;  1SVF A;  1JJ2 O;  1HGV A;  4PV1 D;  2J59 M;  5HGL A;  2OYI C;  3L74 E;  5AW6 B;  2Y9Z A;  3VYI A;  2QIW A;  1FZC A;  2ZT9 C;  2ZVO B;  2N1T B;  3HTK A;  2IBZ I;  1PIX A;  4H13 D;  1MV8 A;  4WVZ A;  2AEF A;  5DJT B;  3TNU A;  2K1A A;  1WRG A;  4GR2 A;  1YJW P;  2A45 G;  5HVC A;  2QE7 H;  2O1K A;  3L4F A;  1AFO A;  1Q81 Q;  4BPH A;  1IFP A;  1HJB A;  1FZE A;  1L0H A;  3H1J J;  5APX A;  4GDO A;  1KIL C;  3H1L E;  1QRJ A;  5BS2 A;  3E1I A;  1BE3 E;  1FBM A;  1PP9 G;  3JSV C;  2KS1 A;  1GU5 A;  4H0L C;  3RK3 C;  2CK3 H;  3M9Q A;  4NPE A;  1OZH A;  3GMA A;  3Q5P A;  2C9N Y;  4U3F E;  2GZF A;  2JWD A;  2I8D A;  5APS A;  1M7L A;  1SFC B;  2N6Z A;  1GK4 A;  2PEM A;  2GDY A;  3R4Y A;  1KIL D;  3SFD C;  2GM4 A;  2N1T C;  2LML A;  3SWK A;  1MZ8 A;  1IFJ A;  1JY2 N;  3L72 D;  2P7J A;  5KLV E;  4H0L D;  1FR2 A;  1P84 E;  3L37 A;  1D1D A;  2M5A A;  3TGU E;  1NU1 G;  3D6Y A;  1KN7 A;  2AFD A;  2IX7 C;  4AYC A;  1SQP E;  5CHX A;  1VQK P;  1SQX E;  1X79 B;  3AEE C;  1K05 A;  3Q2Y A;  1S5L E;  1P84 I;  3H1K G;  3A7O A;  1SQQ D;  1SQV K;  2IYP A;  3SFE C;  3U43 A;  5BS1 A;  5AW7 B;  1KB9 H;  2KW2 A;  2N1T D;  3MUD C;  1L0L K;  3H32 A;  3HE5 A;  3VP8 A;  2HFE D;  3H0D A;  1IFM A;  3L71 J;  4UHP B;  3H4E A;  1SP4 A;  5APU A;  1DD3 A;  2K93 A;  3LW5 H;  2YNY A;  1S2E A;  2OYH B;  1EDL A;  5AW3 B;  1Q90 D;  2OTJ P;  3VMZ A;  1SFC C;  1FC2 C;  5AVT B;  1JMB A;  1NVO A;  4YXD C;  4M3L A;  1M6N A;  3V2Q A;  2ONT A;  4WWI A;  4HJG H;  1DEB A;  3V2P A;  1LTJ A;  1MFZ A;  1Z6M A;  3WU2 E;  2L91 A;  4L73 A;  1OW6 A;  2XU6 A;  3CCM P;  1T3J A;  1RF1 A;  4GOD A;  1NAY A;  1VQN P;  1K30 A;  2W27 A;  4BRY B;  1L4A D;  4XFZ A;  1SFC D;  2XZ1 C;  2GUS A;  2JKV A;  3CCQ P;  4IPY A;  1VQ7 P;  2ZYG A;  2KOS A;  2K88 A;  3P8C D;  2VSQ A;  2B87 A;  2Z5H A;  5B66 E;  5AVY B;  4B86 A;  2GUV A;  3HUS B;  2M8R A;  1AUM A;  4OGQ D;  2OYH C;  5APY A;  1RF0 A;  3L73 E;  3DS5 A;  3GZM A;  1UNK A;  3A0H H;  5AVU B;  1AVO A;  1SQV D;  5CCH C;  3L70 E;  2A45 H;  1D7M A;  1FZB A;  2M3B A;  1L0L D;  3A0H E;  5BU5 A;  4BPF A;  3L72 J;  3GKL C;  3LIE A;  1YYC A;  2R5D A;  1HBW A;  2E43 A;  2P9X A;  3MD0 A;  1VQ4 P;  2JR8 A;  2WSF J;  2E74 B;  3I5C A;  4LC1 A;  3TF5 A;  2B88 A;  2FXP A;  1GTW A;  1SQQ J;  3L75 D;  2Z44 A;  1ZRT D;  2LXC B;  2K0Y A;  5CCH D;  1ZR4 A;  4KT0 J;  1JCD A;  3GLM A;  3CXH I;  1HY8 A;  2FFD B;  1UJZ A;  3FXE A;  3GJN A;  1H88 A;  1QL2 A;  5KAI H;  2JYG A;  1NTZ G;  1PZQ A;  4AUW A;  1LWU B;  3HUS C;  2QVA A;  2ZAE B;  1NU1 K;  5CCG A;  4IFF A;  5K5G B;  3CX5 H;  1E79 H;  2VRS A;  1L4A A;  2XV6 A;  2HOD A;  3CCJ P;  2FVE A;  5EW5 E;  2KOD A;  2IBZ G;  1QLE D;  2XND H;  4PXH B;  2GZI A;  3NY7 B;  4HKZ H;  2KOG A;  3L74 G;  1FZC B;  3FWN A;  5M1B A;  3HTK B;  1U7M A;  4OH8 B;  3U1A A;  1M57 D;  1JM0 A;  2K94 A;  3CWB D;  2E74 C;  2KGC A;  2YKQ A;  4QKO A;  1N73 A;  2P10 A;  4HKG A;  3JCU E;  2PFX A;  3D70 A;  2R32 A;  4EDF A;  5DJU B;  1HWT C;  1M6E X;  2FQ0 A;  4D6T E;  5KKZ B;  2LTE A;  1ZN5 A;  5JPA A;  1S1C X;  1PP9 D;  3CCS P;  3L36 A;  2HR3 A;  3H1L G;  3R2P A;  3U59 A;  2FFD C;  2CNR A;  3CL3 D;  5KP8 B;  5CZD B;  1VF5 B;  2M5R A;  1YQ4 C;  5E79 H;  1A02 J;  4TT3 H;  1BE3 G;  4PWV B;  2KS1 B;  1LWU C;  2PEO A;  2KP8 A;  4WY4 D;  2E74 D;  2VLP A;  3Q3D A;  3BCC E;  2K0X A;  3OA7 A;  1IFD A;  2QJY B;  1SQV J;  4PJ0 H;  4RO0 A;  4U3F G;  3CX5 D;  1GK6 A;  1RE4 C;  1L0L J;  2A06 E;  5AVV B;  1PGJ A;  3A5T A;  2N98 A;  2O01 J;  2WTY A;  1FZC C;  3A3Y B;  2K2Q A;  4BXL A;  4RJT A;  2E5T A;  3U1C A;  1EZV D;  4IFD K;  5AVW B;  4DOJ A;  2MY5 A;  1NTK D;  2H8P D;  3CC4 P;  4W7Z A;  5KLV G;  4UB8 H;  3L75 J;  2WPS A;  3KPE A;  1UII A;  3TGU G;  4UB8 E;  3CI9 A;  5HGO A;  1MFT A;  2GZG A;  4HYT B;  3UIA A;  2KNC A;  3MTU E;  3C1L A;  1SQP G;  5KKZ C;  1SQX G;  1QVF O;  4L74 A;  3BRT B;  3KDP B;  4GIF A;  2FXM A;  2JP3 A;  1OVR A;  3H32 B;  1NTM G;  1FE6 A;  4QMA A;  1VF5 C;  1TU3 F;  3Q5R A;  2K5X A;  2PRR A;  5CBN A;  4U0E A;  2GDW A;  1FOS E;  4XFY A;  1EDI A;  4IOI H;  2ZFC A;  4Z1M H;  2KG8 A;  5L8R J;  5KTB A;  3M9H A;  1G1J A;  2CG5 B;  1VQM P;  3V4W A;  1NHL A;  3GF3 A;  1X3O A;  5AVQ B;  1JNM A;  1RE3 A;  1G2C A;  1ZV8 A;  1NTZ K;  3Q20 A;  3CWB J;  3RG2 A;  4H2W C;  1LTJ B;  4WY4 A;  1KYO H;  3GF7 A;  1CI6 B;  3P32 A;  3AEG C;  1L0N E;  1CZQ A;  3HRN A;  4XRQ A;  2GZE A;  1A8O A;  2AVA A;  2FYU E;  3TSI A;  1KQS O;  2I1J A;  2MKV A;  1T8K A;  4R4M A;  4EI2 A;  1Y9B A;  2JYL A;  1RF1 B;  3M0A A;  2O3J A;  3FXD A;  2JWA A;  1PP9 J;  3GZL A;  3H1I D;  2EHS A;  4N3Y B;  1BGY E;  2V7Q H;  2Z45 A;  3W68 A;  2N5I A;  3PTZ A;  4HH2 A;  5APQ A;  2B87 B;  2J58 A;  5APV A;  1J1E B;  2FY8 A;  1EXJ A;  1M1J A;  3Q5S A;  4OVN F;  1OR5 A;  3L73 G;  1PPJ E;  2PGD A;  1Q82 Q;  2MJZ A;  2KGA A;  4ZNC A;  2FAC A;  2LKI A;  3AE7 C;  2Z46 A;  3L70 G;  2AEJ A;  1NTK J;  2XDJ A;  1LTJ C;  1KV4 A;  1AV1 A;  4IL6 E;  5HGM A;  4U0D A;  3ITK A;  1PEM A;  2HG5 D;  3G9R A;  1JY3 O;  2OYO A;  1N86 A;  1RF1 C;  1BCC J;  3P7K A;  4YPC A;  1M74 A;  3L72 E;  3A2A A;  3RK3 E;  2PAJ A;  1FZG A;  3WMM 0;  2L9F A;  1LTS C;  2ROQ A;  3BAT A;  1OIP A;  2B89 A;  1NTZ D;  4N6J A;  1RH5 B;  2AXT H;  1NAF A;  1EOQ A;  1QL1 A;  5KLV K;  3RBZ A;  1J1E C;  1SQQ E;  3VRL C;  4COP A;  2AXT E;  4C7R A;  2KOR A;  1PL5 A;  2ZXX A;  1S5L X;  1JY3 P;  1RF0 C;  3PRJ A;  1FJP A;  1L4A B;  1SQB D;  2E5Y A;  1SQP K;  1SQX K;  2HOD B;  4YXW H;  1K9M Q;  3L74 D;  2IPP A;  1KQG B;  3IAO A;  1NTM K;  1Q2N A;  3EFF K;  1NH4 A;  4U0C A;  1GMJ A;  1P84 H;  3T97 A;  2BEZ F;  1YJN P;  3AEB C;  2J5U A;  2RN0 A;  2YO2 A;  2I1K A;  4OGQ B;  2QEX P;  4DG9 A;  1S9K D;  1URQ A;  1S5L H;  2O1J A;  1N73 B;  3I56 P;  3O8Z A;  3H1I J;  3SWF A;  2LOL A;  1VHN A;  4H44 B;  3G29 A;  2QNW A;  2WWW A;  3H1L D;  1OX3 A;  4D6T G;  4RKU J;  3AE2 C;  2M8N A;  1NTM E;  1XTC C;  2RMZ A;  1VQ5 P;  1WT6 A;  1JO5 A;  2WPQ A;  1BE3 D;  2Q1K A;  1E6J P;  3II6 A;  1MZ9 A;  5F2K A;  1MUU A;  2PEN A;  2OTK E;  2QM8 A;  2PNG A;  4ZKP A;  1R5S A;  1KOR A;  5CCG C;  2KOP A;  1KQF B;  2DGY A;  2M0B A;  1L4A C;  1UIX A;  2E76 D;  3BCC G;  2Q9I A;  1LT9 A;  5AW5 B;  2FQ2 A;  2M8L A;  5EFW B;  1GPJ A;  1AJY A;  2A06 G;  2KR5 A;  2JU1 A;  3VMY A;  3KHU A;  2KI7 B;  5CJ4 A;  3IN6 A;  1OFC X;  1PV3 A;  3WU2 H;  1CI6 A;  3WUT A;  2BUO A;  4U0A A;  1YIT P;  3CMA P;  3M91 A;  3F5H A;  5KLV D;  2PEI A;  3K5B A;  1P84 D;  1RO2 A;  5AW4 B;  4OGQ C;  5BU8 B;  3TGU D;  2KYV A;  3NXS A;  5CCG D;  1LT1 A;  1N73 C;  1NYH A;  2Q3I A;  1BXI A;  4I1L A;  2WQY C;  1SQX D;  4R0M A;  4R4L A;  2E1M A;  4H44 C;  4K3A A;  1NTZ J;  2KNC B;  1EC5 A;  1FDO A;  4GR6 A;  5B66 H;  4DZO A;  2DNW A;  1Q86 Q;  5KP6 B;  2QM7 A;  1YHQ P;  2OAR A;  5KP7 B;  1KB9 D;  1IUQ A;  2N50 A;  1S4X A;  2BAS A;  1FOS F;  1NO4 A;  1H0T A;  1SQB J;  3IR9 A;  1PEQ A;  2ZYD A;  4JF7 A;  2V4H A;  2EHT A;  2BQ1 E;  3L74 J;  1LTA C;  3H1H E;  3RK2 B;  5AVR B;  1GZL A;  4H44 D;  1S3J A;  2N9B A;  3GHG A;  2QG4 A;  1ZP0 C;  3KYQ A;  1ZOY C;  2R3C A;  1G2C B;  3AEC C;  2O01 N;  1X8Y A;  4U0B A;  1ZW0 A;  1EMV A;  1YQ3 C;  2P1J A;  2WSC H;  4WY4 B;  4PD4 E;  2MVV A;  3CXH H;  3DS4 A;  1L0N G;  5EJD A;  1N7S B;  2XZR A;  3CME P;  2FYU G;  3CXH E;  1S72 P;  5CBO A;  2WSS H;  3H1L J;  2LIU A;  4PD4 I;  2RKL A;  3CWB E;  3CE7 A;  3G6E P;  1BE3 J;  5H2F H;  1IFN A;  3G71 P;  1XTG B;  2B9B A;  3RL0 B;  5F2N A;  1BGY G;  3AE3 C;  5H2F E;  4L75 A;  1RY3 A;  1VQL P;  1YIJ P;  1VQ9 P;  1AQT A;  5AW8 B;  3VTP C;  1CSB A;  2JBG A;  4L76 A;  1KFM A;  2BCC D;  2GZJ A;  2WSE H;  4IZ6 A;  3AE9 C;  1GXH A;  2JJL A;  3L73 D;  2CQ8 A;  2YIU B;  1W2B O;  1M1J B;  1HUC A;  1LNQ A;  2KWL A;  2WPR A;  3EWK A;  3VN0 A;  1PPJ G;  5CMZ A;  3G26 A;  3HZQ A;  1JB0 J;  2XZ0 D;  5I4T G;  4H2X C;  2C9L Y;  5KLV J;  2K9Y A;  1RE3 C;  1JY2 O;  1J1D B;  3S1K A;  3RBX A;  3D71 A;  2MD9 A;  3TGU J;  5F2O A;  2AF8 A;  4WY4 C;  3JCU H;  3DTJ A;  1SQX J;  3A0B E;  1OXZ A;  1N7S C;  1YTZ T;  2R3S A;  1VQ8 P;  3FX0 A;  1EZV E;  1KLP A;  3I55 P;  3RK2 D;  1NKZ B;  2FYN B;  1ZR2 A;  2GA1 A;  1BAJ A;  3L72 G;  1Z56 A;  3EJD A;  5AVX B;  4QNB A;  2CWO A;  3G4S P;  1EZV I;  3RL0 C;  3BAS A;  1X22 A;  4BWN A;  1GL2 A;  1R5L A;  1JY2 P;  4AQR D;  1BCC E;  3LW5 J;  3H1J E;  4U7J A;  1N7S D;  4GT1 A;  1RQU A;  2L22 A;  1SQQ G;  2K37 A;  5AVS B;  3S9O A;  2YIU C;  3HD7 A;  1M1J C;  2WT7 A;  1LP1 B;  1K73 Q;  1OVU A;  2K9J A;  4EYY Q;  1DX7 A;  3SWY A;  3WBH A;  3SSU A;  5GTI E;  2WPV B;  3LID A;  1VQP P;  3MGN A;  1JMM A;  3RL0 D;  2G3A A;  2PP6 A;  1J1D C;  3PH0 A;  3FWL A;  1NOH A;  3B8E B;  3T97 B;  4H2Y C;  1NU1 D;  2VLQ A;  4XFX A;  4N78 E;  2ERH A;  2JU2 A;  1IJD B;  3B5N A;  4O9B A;  2MR8 A;  3IFM A;  4W7Y A;  3C9I A;  1JCC A;  3H1K D;  1URQ B;  2LF4 A;  3V5B A;  3MHV A;  1E0H A;  2K0D X;  4D6T D;  2D2C B;  1PEU A;  2FYN C;  4GOF A;  1NWQ A;  3E1R A;  2P67 A;  1MKM A;  2YXR B;  1T3U A;  2H7H A;  4C46 A;  5APW A;  1ZXG A;  2BCC J;  4MRT C;  2IFN A;  5HGN A;  4W80 A;  4IFM A;  1AQ5 A;  1L0N K;  2FYU K;  2N5H A;  1QEX A;  1U57 A;  3BCC D;  2QJY C;  3V2R A;  1DNY A;  3DS0 A;  4WBA A;  2Q5U A;  3L71 E;  7CEI A;  2A06 D;  1A02 F;  2M8P A;  1LT9 B;  3RGU A;  3O6Q A;  1BDC A;  2ZVN B;  1HGZ A;  1OWA A;  1NQ4 A;  3DS1 A;  1M1K Q;  2FYZ A;  2Y9Y A;  4Y28 J;  1LTB C;  4ASW A;  3EJE A;  5KAF H;  1N7S A;  1AVY A;  2ZT9 B;  5KAF E;  1GD2 E;  1FDM A;  1M8O B;  1H8A A;  1URQ C;  4JQ0 D;  2WVR A;  1L0I A;  2KG9 A;  1OVV A;  3B4Q A;  1H89 A;  5BVZ A;  3PP5 A;  2NPS A;  1LGH B;  5APT A;  2EG5 A;  1KD1 Q;  2XKM A;  1IK9 A;  1X0T A;  4IL6 X;  1HJ0 A;  1BSH A;  3NMD A;  1IFI A;  2Y0D A;  4U0F A;  2HYN A;  2E75 D;  1F80 D;  4F37 A;  1H0T B;  4HB1 A;  3CXC O;  1YJ9 P;  1URQ D;  4TLF A;  2D2C D;  3H1H G;  3P8M C;  1LT9 C;  2MR7 A;  3P05 A;  5KLI B;  3QH9 A;  1RQV A;  3GHG B;  1JTH A;  4IL6 H;  5TIS H;  1IO4 A;  1DH3 A;  4EOT A;  4XE5 B;  2AEM A;  4DCK A;  1LTT C;  1NU1 J;  2N9Y B;  1RO0 A;  5TIS E;  2KGD A;  3AEA C;  3GW6 A;  1L0N D;  1KIL E;  1FS0 E;  2FYU D;  1SQQ K;  1KYO D;  3H1K J;  2KOO A;  2EIA A;  1NGM B;  4D6T J;  4I7Z B;  2KOQ A;  3VOP A;  4ZKU A;  2E76 B;  2WZ7 A;  4XFJ A;  2LXB A;  5KJ7 A;  2ZJS E;  2WSF H;  1IC2 A;  1BGY D;  3CWB G;  1S9K E;  5B5E H;  3C8V A;  2MF4 A;  2CGQ A;  4I6M C;  5B5E E;  2W90 A;  3CLQ A;  3BCC J;  5TJH A;  3NTN A;  2ZT9 D;  2JDI H;  3AE6 C;  1EIA A;  3DS3 A;  1LP1 A;  1PGQ A;  1FJK A;  2IBZ D;  3B5I A;  3IF4 A;  2R5B A;  1ZLL A;  2PEQ A;  1JOC A;  2HPC B;  4PH0 A;  1PPJ D;  4C7N B;  3EQ2 A;  2L0Q A;  2P58 A;  1GDT A;  5KLI C;  3GHG C;  2E42 A;  1RNI A;  1VKU A;  2C0X A;  2KG6 A;  3GG2 A;  3CCU P;  3DPH A;  1W5C E;  1A43 A;  2KSE A;  1GW3 A;  4I7Z C;  2FVA A;  4K35 A;  2E76 C;  1LTG C;  2NZ2 A;  4LGD E;  2QJP B;  2FBW C;  2FQ1 A;  2AFE A;  4JYB A;  1EZV G;  3RK3 D;  2POH A;  3PJS K;  1NTK G;  1SLQ A;  2NO8 A;  3NTE A;  1J2J B;  3MGE A;  2LKM A;  2QJK B;  4Y99 B;  1YBK A;  1HVV A;  2KSJ A;  1ZNV A;  1GL2 B;  2ITA A;  1IMQ A;  3CCE P;  3P8C E;  1BCC G;  3V4Q A;  3MP7 B;  3MZW B;  4U3F D;  1GW4 A;  4UB6 H;  3H1J G;  4JYC A;  4OWF A;  2XNX A;  1KB9 E;  4MN4 C;  3HD7 B;  1OW7 A;  4UB6 E;  2WT7 B;  1AA0 A;  2YXQ B;  2QSI A;  2KUB A;  2K9J B;  4GOE A;  2PY8 A;  1KB9 I;  4LLH A;  1L0N J;  4PH1 A;  1N7L A;  2OYI A;  2FYU J;  3VP9 A;  2GDX A;  3VMA A;  1KQL A;  3G28 A;  1SQV E;  2O01 H;  2KIK A;  2PEJ A;  2KGE A;  1L0L E;  1GU4 A;  3E7K A;  5AW9 B;  3G1I A;  1Y47 A;  2UWJ E;  1HQB A;  3B5N B;  1SQP D;  1VPC A;  3TK1 A;  2QJP C;  2FXO A;  3M0D C;  1BGY J;  3BRV B;  3CC2 P;  3CCL P;  1DEE G;  1FZF A;  1PFI A;  3HE4 B;  2V7Q J;  1NTM D;  3EJB A;  2ZXE B;  3M9B A;  2QJK C;  4Y99 C;  3L75 E;  1KIL A;  1PGO A;  4WB4 A;  4JPZ B;  1ZRT E;  3LMO A;  4BPG A;  1GL2 C;  3F89 A;  2VLN A;  2W6A A;  2Y0E A;  2H89 C;  3H1I G;  1DD4 A;  2JGP A;  1JEK A;  1N8R Q;  4XA4 A;  1KZU B;  3HD7 C;  2QRX A;  2WIT A;  3B71 A;  3G21 A;  3H47 A;  1JUN A;  1YTZ I;  1EQ7 A;  3AE1 C;  1HTL C;  1VL2 A;  2MVU A;  2DW3 A;  3L71 G;  2BCC E;  3MIW A;  1USE A;  1LTI C;  4M0I A;  3H6P A;  3AED C;  4PD4 H;  3O6Q B;  3FGA D;  2HLO A;  2N1T A;  1GL2 D;  1KFN A;  1IK7 A;  3KXD A;  2K92 A;  1T6A A;  1K8A Q;  1ZME C;  3CC7 P;  3B5N C;  2JB0 A;  1FZA A;  3B4S A;  3HD7 D;  4ASV A;  2Q6Q A;  3N7N A;  1R8E A;  3AE4 C;  3EFG A;  1RHZ B;  2A45 I;  2KZJ A;  2NPS B;  3PHL A;  2ZYA A;  2RH0 A;  2SPZ A;  2BHV A;  4U3F J;  2JO1 A;  3MUD A;  3G1G A;  1PP9 E;  2Q7C A;  3G3Z A;  2HPC A;  4C7N A;  1CEI A;  3OJA B;  3B5N D;  3Q1M A;  2OTL P;  3TYY A;  3RK2 C;  3H1H D;  1AYI A;  3ABV C;  5AW2 B;  1NTK K;  3L70 D;  5KAI E;  1L2P A;  3DS2 A;  3JC2 2;  1PEO A;  2YMY A;  3OW2 O;  3ZDM A;  1W2E A;  4NPF X;  1SFC A;  1JTH B;  3CX5 E;  3KQG A;  1VQO P;  3A0B H;  1FAV A;  1SQB G;  2Z5I A;  4PD4 D;  3V6I A;  2FKW B;  3RL0 g;  2GYK A;  4WYM A;  1KC8 Q;  1SQP J;  2VLO A;  5AVZ B;  3M0D A;  4EIJ A;  3CXH D;  3WUU A;  3CX5 I;  4I2L C;  5DCK A;  1SS1 A;  2KLV A;  1NTK E;  1EXI A;  1NTM J;  1NJI Q;  1VDF A;  3TNU B;  1NU1 E;  1QGK B;  1E5W A;  2W6B A;  2H43 A;  2M3E A;  2NRG A;  1KMI Z;  4DT0 A;  1JY3 N;  1CW5 A;  2KB7 P;  2NPS C;  5GTH H;  3H1K E;  3CPW O;  1USD A;  5GTH E;  2XT1 A;  5AW1 B;  5C39 A;  4KHX A;  4GKG A;  1OW8 A;  2CPB A;  4CPG A;  3KZI H;  2KLU A;  5GTI H;  2QA4 P;  3KZI E;  2WPT A;  3V2N A;  2OYH A;  2Y0C A;  1PGP A;  3E2D A;  2WMM A;  5E79 E;  2FAE A;  5HV8 A;  1HF9 A;  3VMX A;  2NPS D;  3QWO C;  3D6Z A;  1NKN A;  2IZ0 A;  2W83 C;  5CCH A;  2E75 B;  1YI2 P;  3OAK A;  4PJ0 E;  2YKP A;  3NFQ A;  1FU1 A;  2JO0 A;  2YMK A;  3HE4 A;  1IMP A;  2C0W A;  1GXG A;  5AW0 B;  3M06 A;  5KJ7 C;  4BRY A;  2M5A B;  2JAZ A;  1X9V A;  2AXC A;  2G8Y A;  2P2U A;  3WUV A;  2OQQ A;  3PLN A;  2IDB A;  2IYO A;  2FHS C;  4PV1 B;  3L73 J;  2LIW A;  2L6E A;  3H1I E;  1G1I A;  1BCC D;  1T2K C;  1DIP A;  2YKO A;  4ZMD A;  1FDI A;  3H1J D;  4H13 B;  2LPK A;  2W8Z A;  3H1H J;  3L35 A;  4NEO A;  1AF8 A;  1OMI A;  3HE5 B;  3L70 J;  3HYB A;  4XRO A;  3HUS A;  2JEE A;  1VQ6 P;  2KXP B;  2KZI A;  4CA3 A;  3AE5 C;  4JBZ A;  4KJM A;  1HH0 A;  5KJ7 D;  3TDK A;  2Q3E A;  1LJ2 A;  3M1M A;  3CCR P;  3CCV P;  4YTP C;  2WSC J;  4RES B;  2E75 C;  2OYI B;  2XXM A;  2R44 A;  3AE8 C;  3H25 A;  4N78 D;  1T2K D;  1EDK A;  1ZMB A;  1SQV G;  2OGU A;  1T8Z A;  3AEF C;  1DV5 A;  1M56 D;  1QX8 A;  1Y8A A;  2Z4E A;  1L0L G;  2XV5 A;  1M90 Q; 
#chains in the Genus database with same CATH homology
 1QRJ A;  1PEU A;  3G1G A;  2P9X A;  5JPA A;  1QVG O;  3CC2 P;  3CCL P;  1PEQ A;  5BS2 A;  5HGM A;  4U0D A;  1VQ4 P;  3CCU P;  3CCS P;  2OTJ P;  2BQ1 E;  2M8N A;  5F2O A;  3CXC O;  1YJ9 P;  3DPH A;  1PEM A;  1YI2 P;  1VQ5 P;  2OTL P;  3LRY A;  3DTJ A;  1VQM P;  1A43 A;  2PEK A;  4COC A;  1M6N A;  1E6J P;  2ONT A;  5F2K A;  1VQ8 P;  2PEN A;  2PEO A;  5HGN A;  3P05 A;  1M74 A;  3DS2 A;  2Z44 A;  1PEO A;  3RG6 C;  2JO0 A;  3I55 P;  3Q20 A;  3OW2 O;  4U0B A;  1BAJ A;  1RO0 A;  2DGY A;  4QNB A;  4XRQ A;  1VQO P;  1A8O A;  3DS0 A;  1Q7Y Q;  2CWO A;  1N8R Q;  3G4S P;  2PEM A;  3CCM P;  3DS4 A;  3NTE A;  1KQS O;  3CD6 P;  2JYG A;  3MGE A;  4WYM A;  2M8L A;  3G21 A;  1KC8 Q;  3CME P;  3H47 A;  1VQN P;  1EOQ A;  2EIA A;  1K30 A;  2M8P A;  1S72 P;  2JYL A;  4XFZ A;  3VRL C;  2EFJ A;  4COP A;  3G0V A;  2L6E A;  5DCK A;  2BUO A;  4U0A A;  4M0I A;  2XV6 A;  1YIT P;  3DS1 A;  3CCE P;  3CCQ P;  1NJI Q;  1M1K Q;  4IPY A;  3CCJ P;  3CMA P;  3G6E P;  1VQ7 P;  2PEI A;  3CC4 P;  2Z45 A;  2KOD A;  1JJ2 O;  1D1D A;  3G71 P;  1RO2 A;  5HGL A;  1K73 Q;  5F2N A;  3HYB A;  4XRO A;  1K9M Q;  1VQ6 P;  1VQL P;  1YIJ P;  1VQ9 P;  3WBH A;  3CPW O;  1VQK P;  1K8A Q;  5HGO A;  3CC7 P;  1VQP P;  2XT1 A;  1AUM A;  2E1M A;  4U0C A;  1QVF O;  2PY8 A;  1YJN P;  4GR2 A;  4PH1 A;  3DS5 A;  5BS1 A;  1YJW P;  3M1M A;  1EIA A;  3DS3 A;  4GR6 A;  3CCR P;  3CCV P;  1W2B O;  3B5I A;  3H0D A;  2EG5 A;  3G28 A;  2PEQ A;  1Q82 Q;  1Q86 Q;  1KD1 Q;  4PH0 A;  4XFX A;  3H4E A;  2XXM A;  1YHQ P;  2QA4 P;  2PEJ A;  2QEX P;  2OAR A;  1ZMB A;  1Q81 Q;  1IUQ A;  3G1I A;  3G26 A;  3I56 P;  3HZQ A;  4U0F A;  3E2D A;  4U0E A;  2Z46 A;  5I4T G;  1M6E X;  2LF4 A;  1M90 Q;  4XFY A;  2BHV A;  1RNI A;  3G29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...