1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
1VQ6P 3CPWO 3CCSP 1M90Q 1VQ5P 1QVGO 1VQLP 3CCQP 3CMEP 1YJNP 1S72P 3I56P 1YI2P 3CCRP 1K8AQ 1VQ9P 3G6EP 1Q7YQ 1Q82Q 1W2BO 1M1KQ 1YITP 3CD6P 1YIJP 1Q81Q 1NJIQ 1YJWP 3G4SP 3CCVP 1N8RQ 3CCEP 2QEXP 1VQNP 3CCMP 1KQSO 3CXCO 1KD1Q 2QA4P 1VQ8P 3G71P 1VQOP 3CC7P 1YJ9P 1VQPP 1K9MQ 3CCUP 1Q86Q 1VQKP 1QVFO 2OTLP 2OTJP 1YHQP 3CC2P 1K73Q 3CCLP 1JJ2O 1KC8Q 3CC4P 3CMAP 1VQ4P 3I55P 1VQ7P 1VQMP 3OW2O 3CCJP
chains in the Genus database with same CATH superfamily
4YTPC 4Z1MH 4I2LC 3E1RA 3GW6A 4NPFX 1JTHB 1GDTA 3KXDA 1NTKD 3RK3E 3L70G 4WYMA 1FZAA 1KMIZ 1HVVA 2FY8A 2H89C 2HODB 3OA7A 4GIFA 4WB4A 1LTJC 1M1JA 4PJ0E 3H1IG 3B5ND 3RL0C 4D6TE 4PH0A 3USSA 1LJ2A 3H1JE 2FYZA 3P8CD 2K88A 3BCCG 1DX7A 1SQQE 5AVQB 1RF0A 1SQVK 2QM8A 1ZN5A 4XROA 2ZJSE 1L4AB 3AE6C 2BEQD 2RKLA 3A0HH 3CPWO 1A8OA 2NRGA 2LIWA 3AEBC 1YTZT 4O9BA 1Y8AA 3A0BE 3M0DC 3BATA 3NY7B 1ZLLA 1LWUC 4KHXA 3L37A 4Y99B 5CCGD 1CSBA 2M8RA 2L0QA 2XV5A 1WRGA 1NQ4A 3O8ZA 1AVOA 3PRJA 5JPAA 2ITAA 2ZXEB 4U0FA 1VQPP 2I1JA 4EYYQ 4XRQA 2FYUE 3II6A 4B86A 1RF1A 2HFED 2W27A 3EFFK 4R4LA 1ZNVA 1IUQA 1X8YA 3FGAD 1BSNA 1BCCE 1RF1B 3M06A 1KZUB 1DD4A 1FZCC 1MFZA 2KI7B 4ASVA 1QL2A 1L0ND 4GT1A 2QNWA 2IBZG 1BGYG 3M0AA 1M56D 3G21A 1CEIA 1HQBA 3AEGC 1NH4A 3GZLA 2EHTA 1NTMD 1IK7A 1GZLA 3CXHE 2PP6A 3UIAA 4GDOA 1L0LD 3MUDC 1LT9B 1UJZA 3EJBA 3CE7A 3KHUA 2L9FA 5AW1B 4N3YB 1HJ0A 2XT1A 1MKMA 2EFJA 1QX8A 3P05A 5HGLA 1EZVD 3AEAC 1JY3N 2XZ0D 1LTJB 3U43A 4BPHA 2XXMA 3JSVC 4DT0A 5AW9B 3MGEA 1KQSO 3AE2C 3B71A 1VF5C 3GHGC 2PEMA 4JYCA 3CC2P 3RL0B 2BEZF 3VYIA 3G9RA 3L71E 2Z4EA 2GUVA 4N78D 2AXTE 1Y47A 5AVXB 1NKZB 1NYHA 1SQPD 3H1LJ 4PD4I 3IFMA 4IFMA 1HJBA 5KLVG 1T6AA 1QVFO 2K9JB 1LWUA 2D2CC 1ZR4A 3B5NA 3W68A 5I4TG 1J2JB 1RE3C 2JO0A 1LWUB 1KILD 1QL1A 3B5NB 1NTZD 4BXLA 2IPPA 3L70E 4JPZB 3JC22 1OZHA 1E6JP 3WBHA 4L74A 3L74J 1DEBA 1T2KD 1VQ7P 2H88C 2JU1A 3H25A 4IL6E 2JYGA 2FADA 1R5LA 1ZV8A 3H1IE 4OGQD 1S3JA 2KNCA 5AVZB 5HV8A 1EZVI 3GG2A 3U1CA 3BCCE 4RO0A 5CCGA 4XFYA 1PP9J 4H13C 2WSEJ 5GTHE 2KODA 1K73Q 3CCLP 1FZCB 3M91A 1N7SD 3KDPB 2R3SA 1USEA 4H0LD 1NKNA 2E76D 1CI6B 2O1JA 5APXA 1JB0J 4JF7A 3RBZA 4U3FJ 2WQYC 3MTUE 5BVZA 1Q81Q 2E74C 2K0DX 3VMZA 3PLNA 2YIUC 2R5BA 4UHPB 3S9OA 2M8LA 5GTIH 4QMAA 1Q86Q 4ZKUA 3CWBD 2E75C 3TGUG 4H0LC 4I6MC 2GZIA 4TLFA 1QVGO 3MD0A 2JBGA 2M5AA 5KAIH 1VF5B 5BS2A 2R3CA 1SQBD 1KYOH 1BE3G 4H2WC 1IFMA 2M5AB 3DS4A 3GLMA 2WZ7A 1JY3P 1SQPJ 4GR2A 3VMYA 2FFDC 3H1KJ 3L72J 4YPCA 2Z5IA 2IBZE 2ERHA 1BGYE 2X2BA 2PRRA 4PV1C 4DZOA 1FDMA 3M1MA 1RE4A 1RO2A 4LGDE 2LPKA 1VQ8P 4NPEA 4H44D 2A06G 2LIUA 2CNRA 2RMZA 3VMXA 2KGEA 2B87A 1L0HA 1E0HA 1X0TA 1PEMA 2HPCA 1AUMA 1T8KA 1J1EB 2XV6A 1KTMA 5B5EH 2OTJP 2HPCB 1K30A 3L75J 1SQPK 1KILA 1AQ5A 1EMVA 3L73J 4PD4E 4R4MA 1G1IA 2XDJA 2PNGA 1N73A 5BU8B 4H13B 1ZW0A 3G4SP 1SQVD 1ZRTE 1NU1G 4W7YA 1FDIA 3E7KA 2QVAA 1DV5A 3CI9A 1LTAC 5HGNA 3V4QA 1KB9D 5KLVE 4XA4A 1LTIC 4OH8B 5APVA 3CCJP 1E5WA 2HYNA 2PFXA 2Z44A 5APWA 1PGOA 3B4SA 3WU2H 3CCMP 1KYOD 2E1MA 1HY8A 2PAJA 2K37A 1IK9A 2JAZA 1N7SA 4BPFA 2QE7H 1M1JC 5AW4B 3CLQA 1AVYA 2YIUB 2AFDA 1S9KD 2KG8A 3CCRP 3H6PA 2ZFCA 3H4EA 1LT1A 1YIJP 4D6TJ 2EIAA 2KSJA 3NXSA 1D7MA 3FWNA 2E75B 3TDKA 3H1JJ 4H0LB 4L75A 2BCCG 1RF0C 2XNDH 2E76B 1SQQJ 3H1HG 2R44A 5H2FH 1OWAA 2O01N 2WPVB 4QKOA 3HYBA 3NTEA 1OIPA 1HGZA 4K3AA 4Y99C 1PPJD 1H8AA 2NZ2A 2FFDB 4R0MA 2QJPC 2PGDA 3BRVB 4PV1B 5F2NA 1M74A 4CPGA 2W6AA 1ZP0C 2HLOA 2W90A 2G3AA 1YJWP 3HE5A 2LTEA 2YNYA 4WY4D 1VDFA 3H47A 3HE4A 3LIEA 3D6YA 1R5SA 1RF1C 2VSQA 3HE5B 1ZMBA 2BUOA 1SQQK 2FYUJ 1KC8Q 1KYOI 2GZGA 3HE4B 4TT3H 2CQ8A 4DJGA 4WBAA 3TGUE 1LTSC 1PEQA 1BCCJ 4XFZA 5AW7B 1OW6A 2YMKA 3LW5J 1NJIQ 2CWOA 1GXHA 1BE3E 1JMBA 3CX5E 2QA4P 1ZR2A 2GZEA 1AJYA 4RESB 2AEJA 1TU3F 3MP7B 3OAKA 1BDCA 2MY5A 2FYNC 4H44B 5KAFE 5TISH 2OYIC 1Q2NA 3FXEA 1NHLA 3WUVA 2K92A 1FOSE 1LP1B 1M6EX 4L76A 1NO4A 2QJKB 3E1IA 2IYOA 3W67A 1AYIA 2WSEH 1DH3A 1KORA 2ZT9D 1SS1A 1EDIA 3VTPC 2QRXA 4C46A 1MV8A 3AEEC 3AEDC 1YBKA 2A06E 1JNMA 4U0BA 2BHVA 2N9YB 1AA0A 4GKGA 2FYUK 2W6JH 3DS1A 5CZDB 3I56P 2MR7A 1QGKB 2WSFH 2M5RA 1YQ3C 2A45H 2YKOA 1M1JB 2C0XA 5APSA 1MUUA 2WSSH 3S1KA 3O6QA 2K94A 1FAVA 1HTLC 2GA1A 3RL0g 4C7NA 1SFCD 1ZOYC 1YQ4C 4YXWH 3O6QB 2WSCH 4C7NB 2OYHC 5AVWB 2JYLA 3L71J 1MFTA 3U59A 3VP9A 3H1LD 3Q5SA 1N8RQ 3K5BA 2V7QJ 1NU1E 2KLUA 1EXJA 3IF4A 1GL2A 4HJGH 1JCCA 2DNWA 3B5NC 1JY2N 1SQXG 2O01J 5TJHA 2DGYA 2J59M 2QJPB 3CCEP 5AVYB 2KIKA 1NTKG 3VP8A 1KD1Q 2L5GB 3RG6C 2IFNA 3HD7D 3L74D 2N5HA 2M8PA 1U57A 2Y9ZA 3F89A 2GDYA 2CPSA 3RK2D 2IDBA 3KPEA 2JEEA 3PTZA 2KORA 3MZWB 2KOGA 2J58A 3H1IJ 2C9LY 4W7ZA 3D70A 1EDKA 5CCGC 1PP9D 4LC1A 3BCCJ 2BCCE 2JGPA 2ZYAA 3PHLA 1JY2O 4KT0J 3CC4P 3H1HE 3B4QA 2L91A 2OYIA 3JCUE 4EI2A 1IFNA 4WY4A 2JU2A 2FYNB 2OYIB 1HWTC 4EOTA 3RK2C 3C1LA 4WY4B 2P9XA 1CZQA 2KGCA 3G1IA 3AE3C 3I5CA 2OARA 2PEJA 2XU6A 4U3FD 5CMZA 3CCQP 1T3JA 3WUUA 4GOEA 4GR6A 1RQUA 1P84E 3CCVP 1KV4A 4HYTB 2NPSD 1FZEA 3L74G 2FKWB 2YXRB 1URQA 4HKGA 1GD2E 3Q20A 1SQXD 2YO3A 3Q5RA 1JEKA 3AECC 1KN7A 2O1KA 1PFIA 3VRLC 4GODA 1EXIA 2OYHA 3QWOC 3C9IA 3IN6A 3QH9A 2KG6A 3DS5A 2WWWA 1A02J 1GU5A 3EJEA 1YJ9P 1L0NG 3H32A 2OYHB 3H1KD 1JCDA 3L72D 4PJ0H 5CHXA 1EDLA 3RG2A 2IFMA 1DNYA 3PJSK 3KYQA 1BGYJ 1JY3O 1NTMG 3CD6P 1RE4C 1L0LG 2Q1KA 2A45G 1SFCA 3VMAA 1EQ7A 1IFPA 2KWLA 2M3EA 3SWYA 2GDXA 1X9VA 5HGOA 4BRYA 2A45I 1SFCB 2ZVOB 2M0BA 1YTZI 2L6EA 5DJTB 1J1EC 1EZVG 3A0BH 1KQGB 2VLOA 2Y9YA 1JY2P 4PWVB 1SLQA 4K35A 3L75D 2LOLA 1KILC 2K9YA 3KQGA 2KNCB 5AW8B 3L73D 1M6NA 4U7JA 1G1JA 1N73C 4BPGA 4UB8E 3HD7A 1ACPA 5KJ7D 1F80D 1SQPG 1T2KC 3G71P 1G2CA 5AW5B 2M8NA 1FBMA 1H0TA 4OGQC 3LW5H 1G2CB 5KLVJ 3RK2B 1KFNA 1SQXE 2FACA 2LF4A 1FZGA 2P7JA 1Y9BA 2XZRA 2CPBA 1NTZG 2K0YA 3KZIE 5F2KA 1NTKE 1WT6A 1N7SC 1Q90D 1KB9H 2OYOA 2B88A 2EHSA 5H2FE 1AQTA 2FQ2A 3CXHH 2E76C 2W6BA 4D6TD 2P1JA 4OVNF 2LL8A 2N50A 3H1JD 4IOIH 1EC5A 5APUA 4IFFA 5B66E 1SQQD 1X22A 5L8RJ 3P8CE 2KGAA 3E2DA 1IFIA 1HUCA 1M8OB 1H89A 5KLVK 1JMMA 2NPSA 1K04A 2Z5HA 1FJPA 2ZAEB 1HH0A 3P32A 3R2PA 1IO4A 3AE7C 1K9MQ 1S5LE 2PEOA 4I1LA 4JBZA 1H88A 2V7QH 1VQ9P 2WPQA 3FX0A 2B87B 4ASWA 1J1DC 4I7ZB 1SP4A 1RO0A 5KKZB 2FYUD 3L36A 2O01H 1KFMA 3CWBG 1FS0E 2C0WA 2MVVA 1BCCD 3FXDA 4DG9A 2YMYA 3TGUJ 4H44C 1SQBG 1KILB 5F2OA 2IX7C 1NWQA 2AF8A 1BE3J 2RH0A 1VQOP 4UB6H 2KS1A 1JM0A 1N73B 2QJKC 5BU5A 1L0NE 3HTKA 3DS2A 3A3YB 2VLQA 4COCA 2OQQA 4NPDA 5AW2B 1YI2P 3CL3D 2LXBA 2WPRA 3CXHD 1OVUA 4PXHB 2N6YA 2MF4A 2CK3H 1NTME 2LXCB 5APTA 4OGQB 1X3OA 1L0LE 5GTHH 4EDFA 1A02F 2WT7A 3MHVA 3T97A 1L4AD 1BDDA 2E43A 3DS3A 4LLHA 2Q5UA 4M0IA 2GZJA 1VQMP 1GL2D 3V2QA 2LMLA 4U0CA 5KJ7A 1N7SB 2Z46A 1YITP 1EZVE 3A0HE 2FVAA 1HGVA 3V6IA 3RBXA 4QNBA 5KP7B 1IMPA 2H43A 3TNUA 2KGDA 4H2XC 2B9BA 1W5CE 4H2YC 2WPSA 3TYYA 3A5TA 1CW5A 2ZXXA 3L71D 3Q3DA 1N86A 1JO5A 2KK7A 1VKUA 4PH1A 2JO1A 4F37A 1SQVG 2R32A 4N78E 3N4XA 1GL2C 2JB0A 1NU1J 1SQPE 1M7LA 2AEMA 2K1AA 5CJ0A 2CG5B 3G26A 4OWFA 3I55P 2WMMA 3G6EP 1KB9I 1KILE 1PZQA 3V2RA 1NTZE 3L70D 2HR3A 3CXHI 4XFJA 5HVCA 1VQKP 2QSIA 1J1DB 2FQ1A 3G3ZA 3H1ID 2N1TD 3HRNA 1KLPA 2P67A 3BCCD 2K5XA 4AUWA 5APYA 3AE4C 2XNXA 5EJDA 3V4WA 1NU1K 2BCCJ 1BSHA 3H1HJ 3HUSA 1W2BO 1URQD 4WY4C 1D1DA 3BRTB 3B8EB 1S72P 1WMKA 3SFEC 1PPJG 1S1CX 3SWFA 2MKVA 3HUSB 1S4XA 2H8PD 4WWIA 3SWKA 3RL0D 2KLVA 1E79H 5AW3B 2I1KA 2FBWC 2Y0EA 1K8AQ 2HODA 3TF5A 1GMJA 4U0EA 1IFDA 1MZ9A 2ZYGA 1URQC 2LR2A 1AF8A 2FXOA 2GYKA 2VLNA 2MJZA 3GMAA 2GM4A 3LMOA 2K2QA 1YHQP 3EQ2A 1LTBC 3CWBE 2YKQA 2ZT9C 2Q6QA 2MVUA 1OVVA 1PEOA 4IFDK 1UNKA 1SQBE 2WVRA 2PEKA 2WPTA 1L4AA 2KSEA 5CCHD 3VN0A 1LNQA 1OW8A 1W2EA 3D71A 2Q3EA 3D6ZA 2IBZD 1BGYD 3EFGA 2E5TA 1GL2B 3IAOA 4IZ6A 1OMIA 4N6JA 1SFCC 3NTNA 2KZJA 1VQNP 1XTGB 2AFEA 5E79H 1IFJA 1FE6A 3AEFC 1GK4A 1A43A 3L70J 2UWJE 1FOSF 1U7JA 2FQ0A 2K93A 2JWDA 3BASA 5AW0B 5CCHC 1OW7A 1DIPA 2LKMA 2OGUA 5AVVB 3U1AA 2C9NY 2KW2A 2QJYC 2SPZA 2Q3IA 3G29A 3SFDC 5EW5E 3IR9A 2N9BA 3B5IA 3H0DA 1UIXA 2KOOA 1LGHB 1M90Q 4PD4D 4AQRD 3HD7C 2Q9IA 1ZRTD 1M1KQ 3H1LG 3Q2YA 2J5UA 2Q7CA 3AE8C 2CGQA 2WTYA 1KQLA 1SQVE 3ABVC 2Y0CA 5KLVD 5KP6B 1FU1A 5GTIE 2N1TA 1KB9E 1VF5D 3CCSP 1LT9A 2W8ZA 1GPJA 1SQXJ 2KYVA 3CX5H 4A7PA 2N1TB 2IBZI 5DJUB 5KAIE 3G0VA 1GTWA 5KAFH 3SSUA 2M3BA 1KYOE 2PY8A 1NTKJ 1RQVA 1IZNB 1USDA 1LTJA 2XZ1C 1JOCA 4JYBA 5CBNA 2QG4A 4MN4C 3CMEP 1URQB 2FHSC 2KG9A 3GJNA 1S9KE 3PH0A 2D2CD 2FVEA 3N7NA 3NMDA 1L0IA 3TSIA 5K5GB 1PP9G 3EWKA 1PIXA 2ZT9B 3AE1C 2YKPA 1R8EA 3V2NA 1GW3A 1FZFA 1PEUA 3Q1MA 2NPSC 3A2AA 3H32B 1SQXK 2K9JA 2R5DA 1PPJE 3A7OA 3L4FA 5HGMA 3M0DA 4U0AA 1Z6MA 1BXIA 1ZXGA 4ZNCA 1NTKK 1EOQA 1QRJA 2I8DA 4Y28J 1VQ4P 1K05A 1L2PA 1IMQA 5AW6B 4I7ZC 3P7KA 2ZVNB 4U3FG 5B5EE 1VQLP 1PGJA 3PP5A 5KKZC 2MR8A 2JR8A 1PGQA 4H13D 1JUNA 1EIAA 4BRYB 5CCHA 3Q5PA 2GDWA 2JQ4A 1FC2C 4M3LA 3LIDA 2O3JA 2VRSA 4UB6E 3C8VA 4HB1A 2IYPA 3TGUD 2JP3A 4WVZA 5EFWB 3NFQA 2QJYB 1NAYA 1BE3D 2Y0DA 3CX5D 4RJTA 2GUSA 1PV3A 1FZCA 3WU2E 1NVOA 3H1KG 5AVUB 3L72G 3HD7B 2E74D 2IZ0A 1QLED 2K0XA 1L0NJ 2P2UA 2HG5D 1CI6A 1QEXA 2OTKE 5C39A 1OXZA 4IL6X 1H0TB 2KOQA 2E75D 1OX3A 1GW4A 1RHZB 1NTMJ 3RK3D 3MUDA 2WSFJ 1L0LJ 3V5BA 3V2PA 1HBWA 3CCUP 2A06D 2QM7A 3JCUH 7CEIA 4AYCA 2E42A 4C7RA 5KJ7C 3OJAB 3DTJA 2ONTA 1Q7YQ 2KB7P 2PENA 3M9HA 5M1BA 2WSCJ 2YXQB 3DS0A 2KUBA 5KLIC 3L75G 3FWLA 3GHGA 4PV1D 1KQFB 2KOSA 3L73G 3MIWA 3RK3C 1L0NK 1P84H 2Z45A 2K3RA 3GHGB 3TK1A 4DCKA 2BASA 1NU1D 3H1LE 1XTCC 3AE9C 5AVTB 1NTMK 2NPSB 1M57D 1L0LK 1S2EA 3CX5I 1FR2A 4XE5B 2AXTH 1RY3A 3M9BA 4IPYA 1HF9A 1LTGC 4RKUJ 5KTBA 2KR5A 2N6ZA 1RE3A 2BQ1E 2D2CB 2AXCA 1NAFA 1AV1A 2G8YA 1NTZJ 4DOJA 1RNIA 3L74E 2B89A 2PEIA 1JJ2O 2POHA 2ZYDA 3LRYA 1PL5A 3OW2O 1VHNA 3G28A 1T8ZA 5TISE 4D6TG 1LTTC 3H1JG 1Q82Q 2N98A 2FXPA 1IJDB 4ZKPA 1SQQG 1OVRA 3AE5C 1NOHA 2BCCD 4JQ0D 1PP9E 4HH2A 1X79B 3H1HD 2H7HA 2KXPB 5AVRB 1S5LX 3HUSC 1OFCX 4IL6H 4CA3A 4W80A 4BWNA 4L73A 2RN0A 3EJDA 1VQ5P 2KS1B 3HTKB 1N7LA 1T3UA 1UIIA 2JKVA 3ZDMA 2KOPA 3DPHA 4HKZH 2VLPA 2E5YA 2P58A 5APQA 1ZMEC 5DCKA 3GF3A 1NTZK 4KJMA 3G1GA 2ROQA 1IC2A 3RGUA 4UB8H 2DW3A 2PEQA 2WT7B 5KP8B 1YJNP 4U3FE 3T97B 4ZMDA 1P84D 2JDIH 1DEEG 3HZQA 1GXGA 1GU4A 3CC7P 2FYUG 3GKLC 1FZBA 2OTLP 2E74B 1OR5A 4YXDC 1BCCG 3CWBJ 2FAEA 2KP8A 3TNUB 1YYCA 1EDJA 5KLIB 3KZIH 1RH5B 1L4AC 2QEXP 4MRTC 1SQBJ 1AFOA 3RK3B 1FDOA 4GOFA 2P10A 3BVHA 3GF7A 3P8MC 3WUTA 2N5IA 3H1KE 3L72E 2QIWA 5E79E 2KZIA 2FFDA 5B66H 2NO8A 5CJ4A 5AVSB 2JWAA 1FJKA 3CXCO 5BS1A 2AVAA 3M9QA 3S4RA 3CMAP 4U0DA 1Z56A 2L4BA 1VL2A 3MGNA 1BAJA 2WITA 3GZMA 4NEOA 3L35A 1DD3A 2W83C 1S5LH 2MD9A 1SVFA 1VPCA 2GZFA 4XFXA 1P84I 1SQBK 3R4YA 1PGPA 1MZ8A 3L75E 2IZ1A 3L71G 5CBOA 2XKMA 1VQ6P 2YO2A 4EIJA 3L73E 3ITKA 1N2DC 2AEFA 2V4HA 3F5HA 2L22A 2LKIA 2FXMA 3WMM0 3VOPA 2EG5A 1SQVJ 4COPA 1LP1A 2JJLA 1GK6A 2N1TC 1NGMB 1JTHA 1LT9C 4PD4H 2FVFA 1U7MA
chains in the Genus database with same CATH topology
1IUQA 3CCSP 5I4TG 1QVGO 1PEQA 2Z44A 4IPYA 3VRLC 2LF4A 2JO0A 4XFZA 5BS2A 3G6EP 1PEOA 2DGYA 2BQ1E 1NJIQ 2CWOA 3CCEP 2QEXP 3G0VA 5F2OA 3CCMP 2PEKA 1KD1Q 2QA4P 2E1MA 3RG6C 3DS4A 5F2KA 4WYMA 3DS5A 1VQOP 2PY8A 1YJ9P 2M8PA 1RNIA 1VQKP 4GR2A 1E6JP 3WBHA 2PEIA 3DS2A 1JJ2O 3LRYA 1VQ7P 3OW2O 3G28A 4COCA 3CMEP 3G21A 2JYGA 1YI2P 3CCRP 1M6EX 3H4EA 1Q82Q 3CD6P 4PH0A 1YIJP 2EIAA 3M1MA 1VQNP 3CXCO 1RO2A 1VQ8P 3E2DA 5BS1A 4XFYA 3CCUP 2KODA 3DS3A 1A43A 4XROA 5HGOA 1K73Q 3CCLP 3CC4P 4M0IA 3CMAP 4U0BA 2BHVA 4U0DA 2XT1A 1VQMP 1W2BO 3HYBA 2EFJA 3NTEA 2L6EA 3CPWO 1PEUA 1VQ5P 1D1DA 3DS1A 4U0CA 3P05A 1A8OA 3DTJA 5HGLA 3I56P 1S72P 1BAJA 2ONTA 2Z46A 1Q7YQ 2PENA 1YITP 2XXMA 1PEMA 1AUMA 3DS0A 3MGEA 1KQSO 4QNBA 3DPHA 2P9XA 2XV6A 5HGMA 4XFXA 2PEMA 4U0AA 3G29A 1K9MQ 3G1IA 2OTJP 5DCKA 2OARA 3CC2P 3G1GA 1EOQA 1K30A 1QRJA 2PEOA 3B5IA 1VQ4P 3H0DA 2PEJA 5F2NA 1VQ6P 1M6NA 2PEQA 1M90Q 1VQLP 1M74A 3CCQP 1YJNP 2Z45A 2JYLA 1K8AQ 1VQ9P 4PH1A 1EIAA 1M1KQ 4GR6A 1Q81Q 1YJWP 3G4SP 3CCVP 3HZQA 1N8RQ 4U0EA 3H47A 2EG5A 3G71P 2M8LA 1RO0A 4COPA 5JPAA 2M8NA 3CC7P 4U0FA 1VQPP 1Q86Q 3Q20A 1QVFO 1ZMBA 2BUOA 1YHQP 2OTLP 5HGNA 3G26A 1KC8Q 3I55P 4XRQA 3CCJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  3CPW O;  3CCS P;  1M90 Q;  1VQ5 P;  1QVG O;  1VQL P;  3CCQ P;  3CME P;  1YJN P;  1S72 P;  3I56 P;  1YI2 P;  3CCR P;  1K8A Q;  1VQ9 P;  3G6E P;  1Q7Y Q;  1Q82 Q;  1W2B O;  1M1K Q;  1YIT P;  3CD6 P;  1YIJ P;  1Q81 Q;  1NJI Q;  1YJW P;  3G4S P;  3CCV P;  1N8R Q;  3CCE P;  2QEX P;  1VQN P;  3CCM P;  1KQS O;  3CXC O;  1KD1 Q;  2QA4 P;  1VQ8 P;  3G71 P;  1VQO P;  3CC7 P;  1YJ9 P;  1VQP P;  1K9M Q;  3CCU P;  1Q86 Q;  1VQK P;  1QVF O;  2OTL P;  2OTJ P;  1YHQ P;  3CC2 P;  1K73 Q;  3CCL P;  1JJ2 O;  1KC8 Q;  3CC4 P;  3CMA P;  1VQ4 P;  3I55 P;  1VQ7 P;  1VQM P;  3OW2 O;  3CCJ P; 
#chains in the Genus database with same CATH topology
 4YTP C;  4Z1M H;  4I2L C;  3E1R A;  3GW6 A;  4NPF X;  1JTH B;  1GDT A;  3KXD A;  1NTK D;  3RK3 E;  3L70 G;  4WYM A;  1FZA A;  1KMI Z;  1HVV A;  2FY8 A;  2H89 C;  2HOD B;  3OA7 A;  4GIF A;  4WB4 A;  1LTJ C;  1M1J A;  4PJ0 E;  3H1I G;  3B5N D;  3RL0 C;  4D6T E;  4PH0 A;  3USS A;  1LJ2 A;  3H1J E;  2FYZ A;  3P8C D;  2K88 A;  3BCC G;  1DX7 A;  1SQQ E;  5AVQ B;  1RF0 A;  1SQV K;  2QM8 A;  1ZN5 A;  4XRO A;  2ZJS E;  1L4A B;  3AE6 C;  2BEQ D;  2RKL A;  3A0H H;  3CPW O;  1A8O A;  2NRG A;  2LIW A;  3AEB C;  1YTZ T;  4O9B A;  1Y8A A;  3A0B E;  3M0D C;  3BAT A;  3NY7 B;  1ZLL A;  1LWU C;  4KHX A;  3L37 A;  4Y99 B;  5CCG D;  1CSB A;  2M8R A;  2L0Q A;  2XV5 A;  1WRG A;  1NQ4 A;  3O8Z A;  1AVO A;  3PRJ A;  5JPA A;  2ITA A;  2ZXE B;  4U0F A;  1VQP P;  2I1J A;  4EYY Q;  4XRQ A;  2FYU E;  3II6 A;  4B86 A;  1RF1 A;  2HFE D;  2W27 A;  3EFF K;  4R4L A;  1ZNV A;  1IUQ A;  1X8Y A;  3FGA D;  1BSN A;  1BCC E;  1RF1 B;  3M06 A;  1KZU B;  1DD4 A;  1FZC C;  1MFZ A;  2KI7 B;  4ASV A;  1QL2 A;  1L0N D;  4GT1 A;  2QNW A;  2IBZ G;  1BGY G;  3M0A A;  1M56 D;  3G21 A;  1CEI A;  1HQB A;  3AEG C;  1NH4 A;  3GZL A;  2EHT A;  1NTM D;  1IK7 A;  1GZL A;  3CXH E;  2PP6 A;  3UIA A;  4GDO A;  1L0L D;  3MUD C;  1LT9 B;  1UJZ A;  3EJB A;  3CE7 A;  3KHU A;  2L9F A;  5AW1 B;  4N3Y B;  1HJ0 A;  2XT1 A;  1MKM A;  2EFJ A;  1QX8 A;  3P05 A;  5HGL A;  1EZV D;  3AEA C;  1JY3 N;  2XZ0 D;  1LTJ B;  3U43 A;  4BPH A;  2XXM A;  3JSV C;  4DT0 A;  5AW9 B;  3MGE A;  1KQS O;  3AE2 C;  3B71 A;  1VF5 C;  3GHG C;  2PEM A;  4JYC A;  3CC2 P;  3RL0 B;  2BEZ F;  3VYI A;  3G9R A;  3L71 E;  2Z4E A;  2GUV A;  4N78 D;  2AXT E;  1Y47 A;  5AVX B;  1NKZ B;  1NYH A;  1SQP D;  3H1L J;  4PD4 I;  3IFM A;  4IFM A;  1HJB A;  5KLV G;  1T6A A;  1QVF O;  2K9J B;  1LWU A;  2D2C C;  1ZR4 A;  3B5N A;  3W68 A;  5I4T G;  1J2J B;  1RE3 C;  2JO0 A;  1LWU B;  1KIL D;  1QL1 A;  3B5N B;  1NTZ D;  4BXL A;  2IPP A;  3L70 E;  4JPZ B;  3JC2 2;  1OZH A;  1E6J P;  3WBH A;  4L74 A;  3L74 J;  1DEB A;  1T2K D;  1VQ7 P;  2H88 C;  2JU1 A;  3H25 A;  4IL6 E;  2JYG A;  2FAD A;  1R5L A;  1ZV8 A;  3H1I E;  4OGQ D;  1S3J A;  2KNC A;  5AVZ B;  5HV8 A;  1EZV I;  3GG2 A;  3U1C A;  3BCC E;  4RO0 A;  5CCG A;  4XFY A;  1PP9 J;  4H13 C;  2WSE J;  5GTH E;  2KOD A;  1K73 Q;  3CCL P;  1FZC B;  3M91 A;  1N7S D;  3KDP B;  2R3S A;  1USE A;  4H0L D;  1NKN A;  2E76 D;  1CI6 B;  2O1J A;  5APX A;  1JB0 J;  4JF7 A;  3RBZ A;  4U3F J;  2WQY C;  3MTU E;  5BVZ A;  1Q81 Q;  2E74 C;  2K0D X;  3VMZ A;  3PLN A;  2YIU C;  2R5B A;  4UHP B;  3S9O A;  2M8L A;  5GTI H;  4QMA A;  1Q86 Q;  4ZKU A;  3CWB D;  2E75 C;  3TGU G;  4H0L C;  4I6M C;  2GZI A;  4TLF A;  1QVG O;  3MD0 A;  2JBG A;  2M5A A;  5KAI H;  1VF5 B;  5BS2 A;  2R3C A;  1SQB D;  1KYO H;  1BE3 G;  4H2W C;  1IFM A;  2M5A B;  3DS4 A;  3GLM A;  2WZ7 A;  1JY3 P;  1SQP J;  4GR2 A;  3VMY A;  2FFD C;  3H1K J;  3L72 J;  4YPC A;  2Z5I A;  2IBZ E;  2ERH A;  1BGY E;  2X2B A;  2PRR A;  4PV1 C;  4DZO A;  1FDM A;  3M1M A;  1RE4 A;  1RO2 A;  4LGD E;  2LPK A;  1VQ8 P;  4NPE A;  4H44 D;  2A06 G;  2LIU A;  2CNR A;  2RMZ A;  3VMX A;  2KGE A;  2B87 A;  1L0H A;  1E0H A;  1X0T A;  1PEM A;  2HPC A;  1AUM A;  1T8K A;  1J1E B;  2XV6 A;  1KTM A;  5B5E H;  2OTJ P;  2HPC B;  1K30 A;  3L75 J;  1SQP K;  1KIL A;  1AQ5 A;  1EMV A;  3L73 J;  4PD4 E;  4R4M A;  1G1I A;  2XDJ A;  2PNG A;  1N73 A;  5BU8 B;  4H13 B;  1ZW0 A;  3G4S P;  1SQV D;  1ZRT E;  1NU1 G;  4W7Y A;  1FDI A;  3E7K A;  2QVA A;  1DV5 A;  3CI9 A;  1LTA C;  5HGN A;  3V4Q A;  1KB9 D;  5KLV E;  4XA4 A;  1LTI C;  4OH8 B;  5APV A;  3CCJ P;  1E5W A;  2HYN A;  2PFX A;  2Z44 A;  5APW A;  1PGO A;  3B4S A;  3WU2 H;  3CCM P;  1KYO D;  2E1M A;  1HY8 A;  2PAJ A;  2K37 A;  1IK9 A;  2JAZ A;  1N7S A;  4BPF A;  2QE7 H;  1M1J C;  5AW4 B;  3CLQ A;  1AVY A;  2YIU B;  2AFD A;  1S9K D;  2KG8 A;  3CCR P;  3H6P A;  2ZFC A;  3H4E A;  1LT1 A;  1YIJ P;  4D6T J;  2EIA A;  2KSJ A;  3NXS A;  1D7M A;  3FWN A;  2E75 B;  3TDK A;  3H1J J;  4H0L B;  4L75 A;  2BCC G;  1RF0 C;  2XND H;  2E76 B;  1SQQ J;  3H1H G;  2R44 A;  5H2F H;  1OWA A;  2O01 N;  2WPV B;  4QKO A;  3HYB A;  3NTE A;  1OIP A;  1HGZ A;  4K3A A;  4Y99 C;  1PPJ D;  1H8A A;  2NZ2 A;  2FFD B;  4R0M A;  2QJP C;  2PGD A;  3BRV B;  4PV1 B;  5F2N A;  1M74 A;  4CPG A;  2W6A A;  1ZP0 C;  2HLO A;  2W90 A;  2G3A A;  1YJW P;  3HE5 A;  2LTE A;  2YNY A;  4WY4 D;  1VDF A;  3H47 A;  3HE4 A;  3LIE A;  3D6Y A;  1R5S A;  1RF1 C;  2VSQ A;  3HE5 B;  1ZMB A;  2BUO A;  1SQQ K;  2FYU J;  1KC8 Q;  1KYO I;  2GZG A;  3HE4 B;  4TT3 H;  2CQ8 A;  4DJG A;  4WBA A;  3TGU E;  1LTS C;  1PEQ A;  1BCC J;  4XFZ A;  5AW7 B;  1OW6 A;  2YMK A;  3LW5 J;  1NJI Q;  2CWO A;  1GXH A;  1BE3 E;  1JMB A;  3CX5 E;  2QA4 P;  1ZR2 A;  2GZE A;  1AJY A;  4RES B;  2AEJ A;  1TU3 F;  3MP7 B;  3OAK A;  1BDC A;  2MY5 A;  2FYN C;  4H44 B;  5KAF E;  5TIS H;  2OYI C;  1Q2N A;  3FXE A;  1NHL A;  3WUV A;  2K92 A;  1FOS E;  1LP1 B;  1M6E X;  4L76 A;  1NO4 A;  2QJK B;  3E1I A;  2IYO A;  3W67 A;  1AYI A;  2WSE H;  1DH3 A;  1KOR A;  2ZT9 D;  1SS1 A;  1EDI A;  3VTP C;  2QRX A;  4C46 A;  1MV8 A;  3AEE C;  3AED C;  1YBK A;  2A06 E;  1JNM A;  4U0B A;  2BHV A;  2N9Y B;  1AA0 A;  4GKG A;  2FYU K;  2W6J H;  3DS1 A;  5CZD B;  3I56 P;  2MR7 A;  1QGK B;  2WSF H;  2M5R A;  1YQ3 C;  2A45 H;  2YKO A;  1M1J B;  2C0X A;  5APS A;  1MUU A;  2WSS H;  3S1K A;  3O6Q A;  2K94 A;  1FAV A;  1HTL C;  2GA1 A;  3RL0 g;  4C7N A;  1SFC D;  1ZOY C;  1YQ4 C;  4YXW H;  3O6Q B;  2WSC H;  4C7N B;  2OYH C;  5AVW B;  2JYL A;  3L71 J;  1MFT A;  3U59 A;  3VP9 A;  3H1L D;  3Q5S A;  1N8R Q;  3K5B A;  2V7Q J;  1NU1 E;  2KLU A;  1EXJ A;  3IF4 A;  1GL2 A;  4HJG H;  1JCC A;  2DNW A;  3B5N C;  1JY2 N;  1SQX G;  2O01 J;  5TJH A;  2DGY A;  2J59 M;  2QJP B;  3CCE P;  5AVY B;  2KIK A;  1NTK G;  3VP8 A;  1KD1 Q;  2L5G B;  3RG6 C;  2IFN A;  3HD7 D;  3L74 D;  2N5H A;  2M8P A;  1U57 A;  2Y9Z A;  3F89 A;  2GDY A;  2CPS A;  3RK2 D;  2IDB A;  3KPE A;  2JEE A;  3PTZ A;  2KOR A;  3MZW B;  2KOG A;  2J58 A;  3H1I J;  2C9L Y;  4W7Z A;  3D70 A;  1EDK A;  5CCG C;  1PP9 D;  4LC1 A;  3BCC J;  2BCC E;  2JGP A;  2ZYA A;  3PHL A;  1JY2 O;  4KT0 J;  3CC4 P;  3H1H E;  3B4Q A;  2L91 A;  2OYI A;  3JCU E;  4EI2 A;  1IFN A;  4WY4 A;  2JU2 A;  2FYN B;  2OYI B;  1HWT C;  4EOT A;  3RK2 C;  3C1L A;  4WY4 B;  2P9X A;  1CZQ A;  2KGC A;  3G1I A;  3AE3 C;  3I5C A;  2OAR A;  2PEJ A;  2XU6 A;  4U3F D;  5CMZ A;  3CCQ P;  1T3J A;  3WUU A;  4GOE A;  4GR6 A;  1RQU A;  1P84 E;  3CCV P;  1KV4 A;  4HYT B;  2NPS D;  1FZE A;  3L74 G;  2FKW B;  2YXR B;  1URQ A;  4HKG A;  1GD2 E;  3Q20 A;  1SQX D;  2YO3 A;  3Q5R A;  1JEK A;  3AEC C;  1KN7 A;  2O1K A;  1PFI A;  3VRL C;  4GOD A;  1EXI A;  2OYH A;  3QWO C;  3C9I A;  3IN6 A;  3QH9 A;  2KG6 A;  3DS5 A;  2WWW A;  1A02 J;  1GU5 A;  3EJE A;  1YJ9 P;  1L0N G;  3H32 A;  2OYH B;  3H1K D;  1JCD A;  3L72 D;  4PJ0 H;  5CHX A;  1EDL A;  3RG2 A;  2IFM A;  1DNY A;  3PJS K;  3KYQ A;  1BGY J;  1JY3 O;  1NTM G;  3CD6 P;  1RE4 C;  1L0L G;  2Q1K A;  2A45 G;  1SFC A;  3VMA A;  1EQ7 A;  1IFP A;  2KWL A;  2M3E A;  3SWY A;  2GDX A;  1X9V A;  5HGO A;  4BRY A;  2A45 I;  1SFC B;  2ZVO B;  2M0B A;  1YTZ I;  2L6E A;  5DJT B;  1J1E C;  1EZV G;  3A0B H;  1KQG B;  2VLO A;  2Y9Y A;  1JY2 P;  4PWV B;  1SLQ A;  4K35 A;  3L75 D;  2LOL A;  1KIL C;  2K9Y A;  3KQG A;  2KNC B;  5AW8 B;  3L73 D;  1M6N A;  4U7J A;  1G1J A;  1N73 C;  4BPG A;  4UB8 E;  3HD7 A;  1ACP A;  5KJ7 D;  1F80 D;  1SQP G;  1T2K C;  3G71 P;  1G2C A;  5AW5 B;  2M8N A;  1FBM A;  1H0T A;  4OGQ C;  3LW5 H;  1G2C B;  5KLV J;  3RK2 B;  1KFN A;  1SQX E;  2FAC A;  2LF4 A;  1FZG A;  2P7J A;  1Y9B A;  2XZR A;  2CPB A;  1NTZ G;  2K0Y A;  3KZI E;  5F2K A;  1NTK E;  1WT6 A;  1N7S C;  1Q90 D;  1KB9 H;  2OYO A;  2B88 A;  2EHS A;  5H2F E;  1AQT A;  2FQ2 A;  3CXH H;  2E76 C;  2W6B A;  4D6T D;  2P1J A;  4OVN F;  2LL8 A;  2N50 A;  3H1J D;  4IOI H;  1EC5 A;  5APU A;  4IFF A;  5B66 E;  1SQQ D;  1X22 A;  5L8R J;  3P8C E;  2KGA A;  3E2D A;  1IFI A;  1HUC A;  1M8O B;  1H89 A;  5KLV K;  1JMM A;  2NPS A;  1K04 A;  2Z5H A;  1FJP A;  2ZAE B;  1HH0 A;  3P32 A;  3R2P A;  1IO4 A;  3AE7 C;  1K9M Q;  1S5L E;  2PEO A;  4I1L A;  4JBZ A;  1H88 A;  2V7Q H;  1VQ9 P;  2WPQ A;  3FX0 A;  2B87 B;  4ASW A;  1J1D C;  4I7Z B;  1SP4 A;  1RO0 A;  5KKZ B;  2FYU D;  3L36 A;  2O01 H;  1KFM A;  3CWB G;  1FS0 E;  2C0W A;  2MVV A;  1BCC D;  3FXD A;  4DG9 A;  2YMY A;  3TGU J;  4H44 C;  1SQB G;  1KIL B;  5F2O A;  2IX7 C;  1NWQ A;  2AF8 A;  1BE3 J;  2RH0 A;  1VQO P;  4UB6 H;  2KS1 A;  1JM0 A;  1N73 B;  2QJK C;  5BU5 A;  1L0N E;  3HTK A;  3DS2 A;  3A3Y B;  2VLQ A;  4COC A;  2OQQ A;  4NPD A;  5AW2 B;  1YI2 P;  3CL3 D;  2LXB A;  2WPR A;  3CXH D;  1OVU A;  4PXH B;  2N6Y A;  2MF4 A;  2CK3 H;  1NTM E;  2LXC B;  5APT A;  4OGQ B;  1X3O A;  1L0L E;  5GTH H;  4EDF A;  1A02 F;  2WT7 A;  3MHV A;  3T97 A;  1L4A D;  1BDD A;  2E43 A;  3DS3 A;  4LLH A;  2Q5U A;  4M0I A;  2GZJ A;  1VQM P;  1GL2 D;  3V2Q A;  2LML A;  4U0C A;  5KJ7 A;  1N7S B;  2Z46 A;  1YIT P;  1EZV E;  3A0H E;  2FVA A;  1HGV A;  3V6I A;  3RBX A;  4QNB A;  5KP7 B;  1IMP A;  2H43 A;  3TNU A;  2KGD A;  4H2X C;  2B9B A;  1W5C E;  4H2Y C;  2WPS A;  3TYY A;  3A5T A;  1CW5 A;  2ZXX A;  3L71 D;  3Q3D A;  1N86 A;  1JO5 A;  2KK7 A;  1VKU A;  4PH1 A;  2JO1 A;  4F37 A;  1SQV G;  2R32 A;  4N78 E;  3N4X A;  1GL2 C;  2JB0 A;  1NU1 J;  1SQP E;  1M7L A;  2AEM A;  2K1A A;  5CJ0 A;  2CG5 B;  3G26 A;  4OWF A;  3I55 P;  2WMM A;  3G6E P;  1KB9 I;  1KIL E;  1PZQ A;  3V2R A;  1NTZ E;  3L70 D;  2HR3 A;  3CXH I;  4XFJ A;  5HVC A;  1VQK P;  2QSI A;  1J1D B;  2FQ1 A;  3G3Z A;  3H1I D;  2N1T D;  3HRN A;  1KLP A;  2P67 A;  3BCC D;  2K5X A;  4AUW A;  5APY A;  3AE4 C;  2XNX A;  5EJD A;  3V4W A;  1NU1 K;  2BCC J;  1BSH A;  3H1H J;  3HUS A;  1W2B O;  1URQ D;  4WY4 C;  1D1D A;  3BRT B;  3B8E B;  1S72 P;  1WMK A;  3SFE C;  1PPJ G;  1S1C X;  3SWF A;  2MKV A;  3HUS B;  1S4X A;  2H8P D;  4WWI A;  3SWK A;  3RL0 D;  2KLV A;  1E79 H;  5AW3 B;  2I1K A;  2FBW C;  2Y0E A;  1K8A Q;  2HOD A;  3TF5 A;  1GMJ A;  4U0E A;  1IFD A;  1MZ9 A;  2ZYG A;  1URQ C;  2LR2 A;  1AF8 A;  2FXO A;  2GYK A;  2VLN A;  2MJZ A;  3GMA A;  2GM4 A;  3LMO A;  2K2Q A;  1YHQ P;  3EQ2 A;  1LTB C;  3CWB E;  2YKQ A;  2ZT9 C;  2Q6Q A;  2MVU A;  1OVV A;  1PEO A;  4IFD K;  1UNK A;  1SQB E;  2WVR A;  2PEK A;  2WPT A;  1L4A A;  2KSE A;  5CCH D;  3VN0 A;  1LNQ A;  1OW8 A;  1W2E A;  3D71 A;  2Q3E A;  3D6Z A;  2IBZ D;  1BGY D;  3EFG A;  2E5T A;  1GL2 B;  3IAO A;  4IZ6 A;  1OMI A;  4N6J A;  1SFC C;  3NTN A;  2KZJ A;  1VQN P;  1XTG B;  2AFE A;  5E79 H;  1IFJ A;  1FE6 A;  3AEF C;  1GK4 A;  1A43 A;  3L70 J;  2UWJ E;  1FOS F;  1U7J A;  2FQ0 A;  2K93 A;  2JWD A;  3BAS A;  5AW0 B;  5CCH C;  1OW7 A;  1DIP A;  2LKM A;  2OGU A;  5AVV B;  3U1A A;  2C9N Y;  2KW2 A;  2QJY C;  2SPZ A;  2Q3I A;  3G29 A;  3SFD C;  5EW5 E;  3IR9 A;  2N9B A;  3B5I A;  3H0D A;  1UIX A;  2KOO A;  1LGH B;  1M90 Q;  4PD4 D;  4AQR D;  3HD7 C;  2Q9I A;  1ZRT D;  1M1K Q;  3H1L G;  3Q2Y A;  2J5U A;  2Q7C A;  3AE8 C;  2CGQ A;  2WTY A;  1KQL A;  1SQV E;  3ABV C;  2Y0C A;  5KLV D;  5KP6 B;  1FU1 A;  5GTI E;  2N1T A;  1KB9 E;  1VF5 D;  3CCS P;  1LT9 A;  2W8Z A;  1GPJ A;  1SQX J;  2KYV A;  3CX5 H;  4A7P A;  2N1T B;  2IBZ I;  5DJU B;  5KAI E;  3G0V A;  1GTW A;  5KAF H;  3SSU A;  2M3B A;  1KYO E;  2PY8 A;  1NTK J;  1RQV A;  1IZN B;  1USD A;  1LTJ A;  2XZ1 C;  1JOC A;  4JYB A;  5CBN A;  2QG4 A;  4MN4 C;  3CME P;  1URQ B;  2FHS C;  2KG9 A;  3GJN A;  1S9K E;  3PH0 A;  2D2C D;  2FVE A;  3N7N A;  3NMD A;  1L0I A;  3TSI A;  5K5G B;  1PP9 G;  3EWK A;  1PIX A;  2ZT9 B;  3AE1 C;  2YKP A;  1R8E A;  3V2N A;  1GW3 A;  1FZF A;  1PEU A;  3Q1M A;  2NPS C;  3A2A A;  3H32 B;  1SQX K;  2K9J A;  2R5D A;  1PPJ E;  3A7O A;  3L4F A;  5HGM A;  3M0D A;  4U0A A;  1Z6M A;  1BXI A;  1ZXG A;  4ZNC A;  1NTK K;  1EOQ A;  1QRJ A;  2I8D A;  4Y28 J;  1VQ4 P;  1K05 A;  1L2P A;  1IMQ A;  5AW6 B;  4I7Z C;  3P7K A;  2ZVN B;  4U3F G;  5B5E E;  1VQL P;  1PGJ A;  3PP5 A;  5KKZ C;  2MR8 A;  2JR8 A;  1PGQ A;  4H13 D;  1JUN A;  1EIA A;  4BRY B;  5CCH A;  3Q5P A;  2GDW A;  2JQ4 A;  1FC2 C;  4M3L A;  3LID A;  2O3J A;  2VRS A;  4UB6 E;  3C8V A;  4HB1 A;  2IYP A;  3TGU D;  2JP3 A;  4WVZ A;  5EFW B;  3NFQ A;  2QJY B;  1NAY A;  1BE3 D;  2Y0D A;  3CX5 D;  4RJT A;  2GUS A;  1PV3 A;  1FZC A;  3WU2 E;  1NVO A;  3H1K G;  5AVU B;  3L72 G;  3HD7 B;  2E74 D;  2IZ0 A;  1QLE D;  2K0X A;  1L0N J;  2P2U A;  2HG5 D;  1CI6 A;  1QEX A;  2OTK E;  5C39 A;  1OXZ A;  4IL6 X;  1H0T B;  2KOQ A;  2E75 D;  1OX3 A;  1GW4 A;  1RHZ B;  1NTM J;  3RK3 D;  3MUD A;  2WSF J;  1L0L J;  3V5B A;  3V2P A;  1HBW A;  3CCU P;  2A06 D;  2QM7 A;  3JCU H;  7CEI A;  4AYC A;  2E42 A;  4C7R A;  5KJ7 C;  3OJA B;  3DTJ A;  2ONT A;  1Q7Y Q;  2KB7 P;  2PEN A;  3M9H A;  5M1B A;  2WSC J;  2YXQ B;  3DS0 A;  2KUB A;  5KLI C;  3L75 G;  3FWL A;  3GHG A;  4PV1 D;  1KQF B;  2KOS A;  3L73 G;  3MIW A;  3RK3 C;  1L0N K;  1P84 H;  2Z45 A;  2K3R A;  3GHG B;  3TK1 A;  4DCK A;  2BAS A;  1NU1 D;  3H1L E;  1XTC C;  3AE9 C;  5AVT B;  1NTM K;  2NPS B;  1M57 D;  1L0L K;  1S2E A;  3CX5 I;  1FR2 A;  4XE5 B;  2AXT H;  1RY3 A;  3M9B A;  4IPY A;  1HF9 A;  1LTG C;  4RKU J;  5KTB A;  2KR5 A;  2N6Z A;  1RE3 A;  2BQ1 E;  2D2C B;  2AXC A;  1NAF A;  1AV1 A;  2G8Y A;  1NTZ J;  4DOJ A;  1RNI A;  3L74 E;  2B89 A;  2PEI A;  1JJ2 O;  2POH A;  2ZYD A;  3LRY A;  1PL5 A;  3OW2 O;  1VHN A;  3G28 A;  1T8Z A;  5TIS E;  4D6T G;  1LTT C;  3H1J G;  1Q82 Q;  2N98 A;  2FXP A;  1IJD B;  4ZKP A;  1SQQ G;  1OVR A;  3AE5 C;  1NOH A;  2BCC D;  4JQ0 D;  1PP9 E;  4HH2 A;  1X79 B;  3H1H D;  2H7H A;  2KXP B;  5AVR B;  1S5L X;  3HUS C;  1OFC X;  4IL6 H;  4CA3 A;  4W80 A;  4BWN A;  4L73 A;  2RN0 A;  3EJD A;  1VQ5 P;  2KS1 B;  3HTK B;  1N7L A;  1T3U A;  1UII A;  2JKV A;  3ZDM A;  2KOP A;  3DPH A;  4HKZ H;  2VLP A;  2E5Y A;  2P58 A;  5APQ A;  1ZME C;  5DCK A;  3GF3 A;  1NTZ K;  4KJM A;  3G1G A;  2ROQ A;  1IC2 A;  3RGU A;  4UB8 H;  2DW3 A;  2PEQ A;  2WT7 B;  5KP8 B;  1YJN P;  4U3F E;  3T97 B;  4ZMD A;  1P84 D;  2JDI H;  1DEE G;  3HZQ A;  1GXG A;  1GU4 A;  3CC7 P;  2FYU G;  3GKL C;  1FZB A;  2OTL P;  2E74 B;  1OR5 A;  4YXD C;  1BCC G;  3CWB J;  2FAE A;  2KP8 A;  3TNU B;  1YYC A;  1EDJ A;  5KLI B;  3KZI H;  1RH5 B;  1L4A C;  2QEX P;  4MRT C;  1SQB J;  1AFO A;  3RK3 B;  1FDO A;  4GOF A;  2P10 A;  3BVH A;  3GF7 A;  3P8M C;  3WUT A;  2N5I A;  3H1K E;  3L72 E;  2QIW A;  5E79 E;  2KZI A;  2FFD A;  5B66 H;  2NO8 A;  5CJ4 A;  5AVS B;  2JWA A;  1FJK A;  3CXC O;  5BS1 A;  2AVA A;  3M9Q A;  3S4R A;  3CMA P;  4U0D A;  1Z56 A;  2L4B A;  1VL2 A;  3MGN A;  1BAJ A;  2WIT A;  3GZM A;  4NEO A;  3L35 A;  1DD3 A;  2W83 C;  1S5L H;  2MD9 A;  1SVF A;  1VPC A;  2GZF A;  4XFX A;  1P84 I;  1SQB K;  3R4Y A;  1PGP A;  1MZ8 A;  3L75 E;  2IZ1 A;  3L71 G;  5CBO A;  2XKM A;  1VQ6 P;  2YO2 A;  4EIJ A;  3L73 E;  3ITK A;  1N2D C;  2AEF A;  2V4H A;  3F5H A;  2L22 A;  2LKI A;  2FXM A;  3WMM 0;  3VOP A;  2EG5 A;  1SQV J;  4COP A;  1LP1 A;  2JJL A;  1GK6 A;  2N1T C;  1NGM B;  1JTH A;  1LT9 C;  4PD4 H;  2FVF A;  1U7M A; 
#chains in the Genus database with same CATH homology
 1IUQ A;  3CCS P;  5I4T G;  1QVG O;  1PEQ A;  2Z44 A;  4IPY A;  3VRL C;  2LF4 A;  2JO0 A;  4XFZ A;  5BS2 A;  3G6E P;  1PEO A;  2DGY A;  2BQ1 E;  1NJI Q;  2CWO A;  3CCE P;  2QEX P;  3G0V A;  5F2O A;  3CCM P;  2PEK A;  1KD1 Q;  2QA4 P;  2E1M A;  3RG6 C;  3DS4 A;  5F2K A;  4WYM A;  3DS5 A;  1VQO P;  2PY8 A;  1YJ9 P;  2M8P A;  1RNI A;  1VQK P;  4GR2 A;  1E6J P;  3WBH A;  2PEI A;  3DS2 A;  1JJ2 O;  3LRY A;  1VQ7 P;  3OW2 O;  3G28 A;  4COC A;  3CME P;  3G21 A;  2JYG A;  1YI2 P;  3CCR P;  1M6E X;  3H4E A;  1Q82 Q;  3CD6 P;  4PH0 A;  1YIJ P;  2EIA A;  3M1M A;  1VQN P;  3CXC O;  1RO2 A;  1VQ8 P;  3E2D A;  5BS1 A;  4XFY A;  3CCU P;  2KOD A;  3DS3 A;  1A43 A;  4XRO A;  5HGO A;  1K73 Q;  3CCL P;  3CC4 P;  4M0I A;  3CMA P;  4U0B A;  2BHV A;  4U0D A;  2XT1 A;  1VQM P;  1W2B O;  3HYB A;  2EFJ A;  3NTE A;  2L6E A;  3CPW O;  1PEU A;  1VQ5 P;  1D1D A;  3DS1 A;  4U0C A;  3P05 A;  1A8O A;  3DTJ A;  5HGL A;  3I56 P;  1S72 P;  1BAJ A;  2ONT A;  2Z46 A;  1Q7Y Q;  2PEN A;  1YIT P;  2XXM A;  1PEM A;  1AUM A;  3DS0 A;  3MGE A;  1KQS O;  4QNB A;  3DPH A;  2P9X A;  2XV6 A;  5HGM A;  4XFX A;  2PEM A;  4U0A A;  3G29 A;  1K9M Q;  3G1I A;  2OTJ P;  5DCK A;  2OAR A;  3CC2 P;  3G1G A;  1EOQ A;  1K30 A;  1QRJ A;  2PEO A;  3B5I A;  1VQ4 P;  3H0D A;  2PEJ A;  5F2N A;  1VQ6 P;  1M6N A;  2PEQ A;  1M90 Q;  1VQL P;  1M74 A;  3CCQ P;  1YJN P;  2Z45 A;  2JYL A;  1K8A Q;  1VQ9 P;  4PH1 A;  1EIA A;  1M1K Q;  4GR6 A;  1Q81 Q;  1YJW P;  3G4S P;  3CCV P;  3HZQ A;  1N8R Q;  4U0E A;  3H47 A;  2EG5 A;  3G71 P;  2M8L A;  1RO0 A;  4COP A;  5JPA A;  2M8N A;  3CC7 P;  4U0F A;  1VQP P;  1Q86 Q;  3Q20 A;  1QVF O;  1ZMB A;  2BUO A;  1YHQ P;  2OTL P;  5HGN A;  3G26 A;  1KC8 Q;  3I55 P;  4XRQ A;  3CCJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...