1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
1M1KQ 1VQMP 1W2BO 1VQ5P 1K73Q 1VQLP 1YJWP 2QEXP 1K9MQ 1VQKP 2OTLP 1YJNP 1Q7YQ 3G6EP 3CC4P 3CCLP 1YITP 1S72P 1Q81Q 1QVFO 1K8AQ 3CC7P 1M90Q 3I55P 3CMAP 3CCSP 1VQPP 1JJ2O 1VQ6P 3CMEP 3CCMP 1KC8Q 3OW2O 3G71P 3CCQP 1Q86Q 3CXCO 3CPWO 3CCUP 1YHQP 1VQ4P 3CD6P 1VQ8P 2OTJP 1YIJP 1KD1Q 1VQ9P 2QA4P 3G4SP 1QVGO 3CC2P 1VQOP 1YI2P 1N8RQ 1KQSO 3CCEP 3CCJP 1VQ7P 1VQNP 1YJ9P 3I56P 3CCRP 3CCVP 1Q82Q 1NJIQ
chains in the Genus database with same CATH superfamily
3IFMA 3D6YA 3HD7A 4W7ZA 1PL5A 3O6QB 3QWOC 2FAEA 4L73A 2K94A 1N7LA 2FFDB 3CX5I 4EI2A 4WB4A 1JJ2O 2BEZF 1IMQA 1LGHB 1N7SA 1FJPA 4A7PA 2L6EA 5BU8B 4H44B 2CG5B 1NWQA 2K9YA 3HUSC 4IPYA 4JF7A 4UB6E 4GR2A 2FYUD 2N9BA 1LT1A 4HJGH 3LIEA 1BSHA 1GMJA 1NTMK 5BU5A 3DPHA 5CCHA 2MVUA 1NO4A 2VLQA 2KG8A 4XA4A 1NKZB 5AVRB 2KS1B 3CD6P 1MV8A 3CXHE 2GZFA 3CE7A 5APTA 2CGQA 4UB6H 1NGMB 1KQSO 1LTBC 1SQXK 3C8VA 3LW5H 4R4LA 2KOOA 1ZXGA 1S4XA 1DIPA 1KILC 1MFZA 1JO5A 2E5YA 1URQD 5AW9B 3A0HE 2CQ8A 1AVYA 3CXHH 4RKUJ 3EJBA 2O1JA 5AVQB 5AVWB 1FC2C 1YIJP 2FXOA 2QG4A 3CCEP 4WY4D 1L0LE 1BDDA 3A0HH 2KODA 2Y0CA 3M1MA 2VRSA 2PEQA 5AVSB 1KLPA 2AEFA 1FZCC 1BE3J 2Z46A 2IDBA 4EYYQ 2ZT9C 2E42A 4HYTB 2RN0A 3AEAC 4Y28J 4BPFA 1T2KC 2Y0DA 1BXIA 1LTJB 2NPSB 2JU1A 4H2XC 1D7MA 1QGKB 4WYMA 2NO8A 3H1JG 2CNRA 1SQBJ 5F2KA 3CWBJ 3OW2O 2L4BA 2YKQA 2GZGA 4QMAA 1RF0C 3L70D 4W7YA 2QM7A 2W27A 1KZUB 2P9XA 3O8ZA 1CSBA 2M5RA 2Z44A 2WTYA 1LTJA 2E76D 2NPSA 3MHVA 3G3ZA 1GXGA 1RY3A 3RK3B 1L0LG 1VQ7P 1BDCA 3RL0C 1LWUB 1SQQJ 4PH0A 1IFNA 3CI9A 2L22A 4BWNA 1LJ2A 1HBWA 1KB9E 1OMIA 5AVVB 2FADA 2KG9A 1Y47A 1GL2D 4DT0A 2Y9ZA 2K9JB 1KQLA 2D2CC 1WRGA 2LKMA 5APWA 2OYHB 1JMBA 4U3FG 4OGQB 1KB9H 1VF5D 1URQC 1LWUA 3L71J 2WPVB 5CZDB 1QVFO 1LP1B 2OGUA 1SFCD 1BGYD 1NTKE 4YXWH 4BXLA 1N7SD 1YHQP 4JPZB 3H1JD 2EHSA 5AVZB 5H2FE 3G26A 3AE9C 1GTWA 2K9JA 4WY4C 4D6TE 1J1DC 1X8YA 2M8LA 1OIPA 3AECC 4NPFX 1EQ7A 3D6ZA 1FE6A 5KP8B 4H0LB 5CCHD 5HGLA 2YIUC 1K8AQ 4GODA 1LTAC 1MKMA 3H1LE 2P7JA 4TT3H 5H2FH 4U0FA 2IPPA 2W8ZA 5KLVJ 1HY8A 1L0NE 1SQBK 2WSEJ 3Q3DA 2M3EA 2QJYC 1LT9C 3P32A 3P8CE 1AUMA 3C9IA 2V4HA 1EZVE 4MN4C 1M1JB 1XTGB 2R44A 3DS1A 5KAFE 4IL6E 3BCCJ 1CEIA 2GA1A 2KOPA 2M3BA 1BCCE 3DTJA 1F80D 5EFWB 2FQ1A 1FR2A 7CEIA 3HTKA 4U3FD 2WZ7A 2E76C 5KAFH 1NU1E 4IL6H 3GMAA 1ZW0A 5KLIC 4N3YB 3PJSK 1SQQK 1OW8A 2JJLA 2ONTA 5AW5B 4HH2A 1M1JA 5AW6B 3EFFK 1W2EA 1HH0A 4H2WC 2QA4P 4C7NB 1USEA 3V6IA 3AEEC 1N8RQ 1P84D 2IYOA 2VLNA 1ZMBA 2IZ0A 2KZJA 2GDYA 5B5EE 1MFTA 3W67A 1SQPJ 1YYCA 3H25A 2LIUA 2MY5A 1AVOA 1ZRTE 1PEUA 1RQUA 3V2RA 1GL2C 3PP5A 3TF5A 1L0NG 2N50A 3EQ2A 1R8EA 3L74E 1RF1B 1SS1A 4C7NA 3B4SA 3NXSA 5B5EH 3MUDA 2N6ZA 3PHLA 4WBAA 2NPSD 2KSJA 1EZVG 1IK7A 3H4EA 1N7SC 1SQBD 2LIWA 2O01H 5DJTB 2JQ4A 1BCCG 1RF1A 5KLVK 2P2UA 2G8YA 3CCRP 2E75B 2K0DX 4Y99C 3R2PA 2KW2A 5APVA 3BATA 2PY8A 1NU1G 5CCHC 1PP9J 2FYNB 2AFEA 4N6JA 1CI6B 3RK3D 1KORA 2O01N 3G21A 4DZOA 1QEXA 4H44C 3IAOA 3GF7A 2BUOA 2JYLA 2PAJA 2WPRA 3RL0B 2BASA 2R5DA 1SQQD 3OJAB 3M9HA 3KXDA 4PD4E 3KDPB 3GJNA 2VLOA 1AJYA 2LOLA 3HE5B 2ZYAA 3AEBC 1LTTC 1KD1Q 3L74G 2FQ0A 3M9BA 1CI6A 4OH8B 1A8OA 3D70A 1KV4A 2D2CB 3C1LA 4OGQD 1K05A 4PD4H 5KAIE 2JR8A 3WU2E 2YNYA 2QM8A 2WSCJ 3G0VA 3EWKA 1SQPK 5AW4B 4HKZH 1KMIZ 1FOSF 2ZXEB 3VP8A 3S9OA 3D71A 2KI7B 3WU2H 1EDIA 3BRVB 1BCCD 2YMYA 2W83C 2OYOA 1VQKP 4BPHA 1FS0E 4YXDC 5HVCA 2YIUB 2N5IA 1H88A 1P84I 2Z4EA 5HV8A 3SWYA 3CCUP 1YTZI 1M6EX 5AVUB 3M06A 1ZLLA 2KG6A 2NRGA 2KB7P 2XZ0D 3LMOA 1KYOI 4U0AA 3FX0A 1LTJC 2NPSC 2Q6QA 1GZLA 2Q1KA 1ACPA 2K37A 5CHXA 2O3JA 2EHTA 2V7QH 2KUBA 2MF4A 1NTZE 2KSEA 4M3LA 3UIAA 3L75E 1KILD 2WT7A 2HR3A 1Z6MA 5KLIB 1M90Q 2LMLA 2I8DA 2XV6A 3M0DC 2JP3A 3RK3C 2A06D 1UIIA 2WITA 2N6YA 3TGUE 1GW3A 1LWUC 1GD2E 1AFOA 2XKMA 2W90A 1LTIC 1RE3C 1NAYA 1PEOA 2QJKB 2FVEA 3L72G 4EOTA 1SQPD 1QL1A 1LTGC 2SPZA 2XT1A 1UJZA 1X22A 2RH0A 3H1KG 4CPGA 1LNQA 4OGQC 3GZMA 3HD7B 1Y8AA 2BHVA 2L5GB 3VOPA 4R4MA 2KLUA 1S3JA 3H1JJ 1FZAA 3PRJA 3F89A 1S9KD 1VQ9P 3MZWB 1NTZG 4ZNCA 2K3RA 3L75G 1VDFA 4JBZA 4H0LC 1OW7A 1JY2N 1JTHB 4IZ6A 2R3CA 1SQXE 2IBZE 1PP9D 2QSIA 1KFNA 1JB0J 3BASA 1L0LJ 3TGUG 4H2YC 1K73Q 3RL0D 1LTSC 2Q5UA 1NAFA 3L37A 4IFDK 2M0BA 1M1JC 1JTHA 4PH1A 3T97B 2H8PD 3L72D 2W6BA 3H1HG 3MGEA 2WSSH 2D2CD 1IFMA 4U0BA 3VTPC 3BVHA 1A43A 1X79B 3HRNA 4U3FJ 1L0IA 2AF8A 2QNWA 3H1KD 3V4QA 3B5NA 2BCCE 1ZR4A 2R5BA 2ROQA 1ZN5A 1JNMA 1U7JA 3SWFA 2FACA 1HGVA 2Y0EA 4WWIA 4ASWA 3T97A 2BEQD 3B5IA 4K3AA 3AE2C 3MUDC 1SVFA 3TDKA 4NEOA 1G1IA 1J2JB 3U43A 4XFJA 3GG2A 1KQGB 4XFZA 3H1IE 2UWJE 2N1TB 3MP7B 1FDMA 4UHPB 4L74A 3NFQA 1RF1C 2H88C 2XNXA 1IZNB 2E74B 1YJ9P 1JY2P 2B88A 2K1AA 2KP8A 1S5LX 2GZJA 1W5CE 1YQ3C 3OA7A 5CJ0A 3A3YB 4IOIH 2YXRB 2N1TA 1SQVE 2AEJA 2WWWA 3H1HD 1GU4A 2E75C 1PFIA 1L0LK 2WVRA 4DOJA 1OXZA 2BCCG 1OW6A 4M0IA 3WUVA 1Z56A 3N7NA 2FYNC 1L2PA 1J1EB 2H89C 1PPJE 1NKNA 1VQ4P 2VSQA 1RH5B 2LL8A 2C9LY 1BE3E 3MIWA 1DH3A 3KQGA 1KYOE 1ZOYC 3H1IG 2K92A 1FAVA 1S1CX 1N2DC 1E6JP 1AV1A 3CL3D 1MZ9A 4AUWA 4LGDE 1KQFB 1YI2P 1L0NJ 4C46A 2K0XA 2LKIA 1RNIA 1FZFA 3HD7D 2EG5A 2PFXA 2JB0A 5CBNA 2WPTA 1IFJA 5GTIE 1VL2A 1KFMA 3CWBE 3V2NA 1A02J 1SQVG 2Q7CA 3CXHD 1YQ4C 2C0WA 5AVYB 1BCCJ 5GTIH 2GUVA 1H8AA 5BS2A 2P58A 1NH4A 2PRRA 1YJNP 5BVZA 2JO0A 3VMAA 1NU1J 2OTKE 2X2BA 1HVVA 3MTUE 3B4QA 4R0MA 3JCUE 1M7LA 4HB1A 4F37A 3CCJP 4H44D 3ABVC 1L0LD 1VQMP 4YPCA 3HTKB 2XU6A 3CC4P 2JGPA 3LRYA 4H13C 5KKZB 2POHA 2OARA 2E43A 2PEOA 3DS0A 1DX7A 3VRLC 3M9QA 3L74J 5KJ7A 4GDOA 2LTEA 1M57D 1QRJA 3L71E 2OYIB 1OX3A 2YMKA 5AW8B 5AW3B 1NTKG 2QVAA 3GLMA 3CX5E 1EDKA 3JSVC 4D6TG 5AVTB 4I2LC 3DS3A 1D1DA 1L0NK 1ZV8A 2QEXP 3NTEA 4PWVB 2OTLP 1NQ4A 2OYIA 3H1LG 3CX5H 2QJKC 2N1TD 2A45H 1DD4A 2FQ2A 4U0DA 1L4AB 3L36A 1GU5A 2ZFCA 1T6AA 2Z5HA 1PV3A 2FXPA 3L73E 4PJ0E 1H89A 2FVAA 3HD7C 1FOSE 3Q20A 3ZDMA 1JCDA 2W6JH 1KB9D 3BCCE 5B66E 3RK2B 1NU1K 3AE7C 1MUUA 5KTBA 4PJ0H 1JY2O 1L4AA 1PGJA 1SP4A 1EXIA 1M1KQ 1K9MQ 4BPGA 3G28A 3CCLP 1E79H 4I7ZB 1VKUA 5HGOA 3B71A 5AW0B 5B66H 3GW6A 5CCGA 2XXMA 1JUNA 3CXHI 1XTCC 2ZXXA 1BSNA 1NTKD 2JBGA 4ASVA 4PV1C 4N78E 1SLQA 4MRTC 2WPQA 2WSFH 2A45G 5EJDA 1A02F 1X9VA 2K5XA 4UB8E 2R3SA 4D6TD 3A0BE 1OR5A 5JPAA 4L76A 3RG6C 4I1LA 1IJDB 1VQ6P 3L72J 4WVZA 1Q2NA 3H6PA 3H1LD 2PNGA 4UB8H 1X0TA 1U7MA 4GKGA 3A0BH 2V7QJ 4OWFA 1L0ND 1UNKA 1IFIA 1FU1A 1AA0A 3L73G 3H1KJ 5AW7B 1GDTA 1QX8A 3P8CD 3WBHA 1EZVD 3G71P 2OTJP 2MR8A 1N73A 1R5SA 1WT6A 1GXHA 3GHGB 1NTZJ 4KT0J 5KAIH 3HE4B 2I1JA 3L75J 3AE6C 5I4TG 1ZMEC 3PLNA 1L0HA 5AW2B 1JEKA 4H0LD 1NU1D 2N1TC 4XROA 5APUA 2GM4A 2FYUE 2E74C 3GHGA 1QL2A 3G1IA 3HE4A 3TGUJ 2WT7B 2HYNA 1T8ZA 3G6EP 2Q3EA 1PZQA 4H13B 3NMDA 2AEMA 2B9BA 3AE4C 1ZP0C 1H0TA 1EC5A 3CPWO 1ZRTD 1HWTC 4RESB 1OVVA 3H1HJ 2KR5A 3NTNA 4TLFA 3Q5SA 3L74D 1NHLA 1OVRA 1KB9I 2QJPB 2KGAA 2Z5IA 2HODB 1PIXA 2LF4A 3P8MC 1Q86Q 1G2CA 5HGMA 2C0XA 1VPCA 1J1EC 1VQNP 3KPEA 2PENA 2WSCH 1LT9A 1YITP 1PGOA 1RE4A 2HODA 1DNYA 3E1RA 2KZIA 3VN0A 2DGYA 1L4AD 2XNDH 2M5AB 4N78D 2FYUG 3B8EB 3AE1C 4NPEA 2PGDA 5EW5E 1NTZK 5GTHE 3LW5J 2HPCA 4XE5B 2IZ1A 4PXHB 5E79E 4PD4D 3U1AA 2VLPA 3RK2D 2KNCA 3L70E 2XDJA 2EFJA 1NTME 2M5AA 3AE8C 2YKOA 1VF5B 2E75D 1EZVI 1HJBA 3KZIE 3P05A 5E79H 2MR7A 3SWKA 2RMZA 1E0HA 1SFCB 2K88A 2N5HA 2BCCJ 1PGQA 2M8PA 2M8NA 1IFDA 5APQA 5KJ7C 4PV1B 4BRYA 3JC22 3KZIH 2B87A 1K04A 4ZKUA 4ZKPA 5L8RJ 1WMKA 3B5NB 1Q81Q 5KKZC 1SFCA 4XRQA 2A45I 3H1IJ 3MD0A 2JWDA 4LC1A 1OWAA 1MZ8A 2JEEA 1S5LE 1KN7A 1FBMA 1TU3F 3H0DA 2ZVNB 2OYIC 1BGYE 3AE5C 3NY7B 4GOEA 3O6QA 3H1JE 1EOQA 1DV5A 2L9FA 2FFDA 1DEBA 3F5HA 3L70G 3CXCO 1S5LH 3VP9A 2J59M 1SQVJ 3W68A 1E5WA 1NTMG 3A7OA 1NTZD 2MJZA 1NJIQ 1VQLP 3L75D 2N98A 2KIKA 3FXEA 3OAKA 1GK4A 3LIDA 2AFDA 1FZBA 1SQXG 1OZHA 2IBZG 1VHNA 2KS1A 3RBXA 2IX7C 2H43A 1S2EA 3GZLA 1L4AC 1G1JA 2YXQB 1IFPA 3GF3A 2C9NY 1JM0A 1M74A 2KK7A 3TGUD 2J5UA 5CCGC 2LPKA 4H13D 3MGNA 3RL0g 1FJKA 3Q5RA 2ZJSE 1EDLA 3RK2C 4O9BA 2YO2A 2FHSC 5C39A 1EXJA 2P67A 3VMZA 2XZRA 2XZ1C 4CA3A 4U3FE 1NYHA 4PD4I 5APYA 4RJTA 1BGYG 4IFFA 3G9RA 3PH0A 1Q7YQ 4JYBA 4I6MC 1BAJA 4I7ZC 3KHUA 1JY3N 1M8OB 1NTKJ 3FGAD 1M6NA 1KC8Q 1ZNVA 3M91A 3PTZA 1P84E 2J58A 3R4YA 2H7HA 3N4XA 4IFMA 3GKLC 3I56P 3V2PA 4D6TJ 3DS5A 1NTMD 1W2BO 2KGCA 3VYIA 1P84H 1QLED 1FDOA 2RKLA 3IN6A 2MVVA 1Y9BA 3H1LJ 2IFMA 1N73C 2JAZA 3SSUA 1SQXD 2IBZD 4QKOA 4U0EA 3E2DA 1EIAA 4ZMDA 1HGZA 2ZVOB 4XFXA 2FXMA 4L75A 1KYOH 1SQVK 2O1KA 2KOQA 2JKVA 2M8RA 1YTZT 4YTPC 1SQBE 3AEFC 3M0DA 3HYBA 3HZQA 1DEEG 2IYPA 2FKWB 1PGPA 2CPBA 3GHGC 1HTLC 1EMVA 2PEMA 2KOGA 3TSIA 2E1MA 1IK9A 3SFDC 1RE3A 4W80A 5AVXB 3RK3E 2BCCD 2N9YB 3ITKA 4Z1MH 2Z45A 3I5CA 3IR9A 5F2NA 3EFGA 1QVGO 4PV1D 3AEGC 2GZEA 2LXCB 1HQBA 2ZYDA 1PPJG 2Y9YA 2OYHA 1JY3P 3EJEA 5KP6B 1SQQE 1YJWP 4B86A 1BE3G 1N86A 3B5ND 3JCUH 3TYYA 1LP1A 3S4RA 4KJMA 2JDIH 3H1ID 4JYCA 3Q1MA 4COPA 2OQQA 3L4FA 1NTKK 1K30A 1T3UA 3RG2A 4U0CA 2EIAA 3HUSB 1DD3A 2O01J 3L73J 2QJPC 3AEDC 1RE4C 1SQBG 2NZ2A 4DCKA 3CWBG 3H32B 1T8KA 2QRXA 3RBZA 2ITAA 2JWAA 3G4SP 1GK6A 2PP6A 4AQRD 3V2QA 1SQVD 5APXA 1GPJA 4XFYA 1PEMA 2HLOA 4NPDA 1KILB 2WSFJ 3HUSA 5TJHA 4EDFA 2I1KA 1CW5A 1KTMA 3SFEC 2K2QA 3G1GA 4GOFA 2CK3H 1CZQA 2FBWC 3CLQA 3CCMP 3H32A 5KLVE 1R5LA 2LR2A 2BQ1E 2KGEA 4EIJA 4RO0A 2E74D 1SQQG 1KILA 1PPJD 1VQ5P 1Q90D 5K5GB 2MD9A 1FZCB 2IBZI 2ZT9B 1BE3D 1KYOD 2WSEH 3USSA 3WUTA 2AVAA 3E1IA 1NOHA 2PEJA 3BRTB 4LLHA 4IL6X 3QH9A 2K93A 1KILE 4GT1A 3K5BA 1VF5C 1EDJA 3L71G 1HUCA 1FZCA 1SFCC 2B89A 1ZR2A 2KXPB 3I55P 1JOCA 3FWNA 3M0AA 2A06E 4OVNF 5DJUB 3CWBD 5KP7B 4COCA 2QIWA 2KYVA 5DCKA 3V4WA 3H47A 3AE3C 3U1CA 2DW3A 3S1KA 3WUUA 1FDIA 3B5NC 3RGUA 1NVOA 1SQPE 2FFDC 1FZEA 1RQVA 4C7RA 2WQYC 1HJ0A 4DJGA 5KLVG 2HFED 3A5TA 1N73B 5TISE 3E7KA 3TNUB 1RF0A 2WMMA 3U59A 2GDXA 2FYUJ 5M1BA 2GYKA 2IFNA 2L91A 2JYGA 2FY8A 1S72P 2AXCA 3FXDA 2K0YA 4GR6A 5TISH 3L35A 3VMXA 1S9KE 3BCCG 2QE7H 3CCQP 1RO0A 4U7JA 2PEKA 2W6AA 1AYIA 3TNUA 2G3AA 1AQ5A 4K35A 1URQB 3IF4A 1PEQA 3L71D 1PP9E 1H0TB 1AF8A 2GUSA 2A06G 3Q2YA 3HE5A 1VQ8P 5KJ7D 4WY4B 5CBOA 1J1DB 1IO4A 3CX5D 5BS1A 2P1JA 3II6A 2GDWA 2DNWA 1OFCX 1URQA 1SQPG 3L72E 3CMAP 2P10A 1G2CB 5APSA 2FVFA 4QNBA 1UIXA 2XV5A 5KLVD 3CC2P 3EJDA 4KHXA 2ZAEB 1JY3O 4WY4A 2QJYB 1LT9B 1Q82Q 3H1KE 1M56D 2R32A 3L73D 1T3JA 5F2OA 2E5TA 3CMEP 1IMPA 2FYZA 1IC2A 3L70J 3BCCD 4AYCA 3P7KA 5AW1B 1JMMA 1JCCA 2CPSA 1NTMJ 2L0QA 4JQ0D 1U57A 1RHZB 2E76B 2FYUK 2ZYGA 2HPCB 1X3OA 1PP9G 5CJ4A 4GIFA 2GZIA 1VQPP 3G29A 2KNCB 2ERHA 3DS4A 1SQXJ 5CMZA 2PEIA 2JO1A 1OVUA 2YO3A 1IUQA 2KORA 5HGNA 2WPSA 2AXTE 5CCGD 2ZT9D 3CC7P 3Q5PA 2LXBA 1GL2B 4HKGA 3H1HE 3TK1A 4BRYB 1FZGA 1VQOP 3VMYA 1AQTA 2B87B 3FWLA 2OYHC 3CCVP 5GTHH 3A2AA 2AXTH 2MKVA 2KWLA 1T2KD 1YBKA 1HF9A 2KOSA 1BGYJ 2YKPA 1GW4A 2CWOA 3CCSP 2Q3IA 2KGDA 1N7SB 4DG9A 2JU2A 1GL2A 3DS2A 2Q9IA 3KYQA 2KLVA 2HG5D 1RO2A 1USDA 4Y99B 3WMM0 3V5BA
chains in the Genus database with same CATH topology
3DS3A 1D1DA 3H0DA 1W2BO 1RNIA 1VQKP 2QEXP 3NTEA 2EG5A 2OTLP 2BHVA 1YITP 5HGLA 5F2OA 4WYMA 1K8AQ 3WBHA 3H4EA 4XFZA 1EOQA 5F2KA 1JJ2O 3CMEP 3OW2O 3G71P 4U0FA 3CXCO 3CCUP 2OTJP 1M6EX 1VQ9P 4U0DA 3G4SP 2DGYA 4U0EA 3E2DA 2L6EA 1EIAA 4XFXA 4XFYA 1PEMA 1YJ9P 3CCRP 4U0AA 2JYGA 1NJIQ 4IPYA 5I4TG 2P9XA 4GR2A 5BS2A 1VQLP 2Z44A 1YJNP 2PY8A 1AUMA 1S72P 2JO0A 3G1GA 3DPHA 4GR6A 3Q20A 1VQPP 3DS1A 3CCMP 3G29A 3CCQP 3DS4A 2PEIA 3CD6P 1RO0A 3HYBA 2EFJA 3HZQA 2PEKA 4XROA 3G21A 1KQSO 1IUQA 2BQ1E 3CCJP 1VQ7P 2PEMA 2JYLA 2BUOA 3G1IA 1M74A 3DTJA 1M1KQ 1VQMP 5HGNA 2E1MA 1VQ5P 1K73Q 4PH0A 1K9MQ 3G28A 3CCLP 3G6EP 3P05A 3CC4P 3LRYA 5HGOA 1PEQA 4M0IA 2OARA 3CC7P 2XXMA 1M90Q 2PEOA 2M8PA 2ONTA 2M8NA 4PH1A 2XV6A 3CPWO 2PEJA 2Z45A 1VQ8P 5F2NA 3DS0A 1YIJP 1KD1Q 2QA4P 3VRLC 1QVGO 1A8OA 1VQOP 1N8RQ 3MGEA 3CCEP 5BS1A 1ZMBA 2KODA 4U0BA 3CCVP 1VQ4P 1A43A 3M1MA 1QRJA 2PEQA 1YJWP 1Q7YQ 1BAJA 1Q81Q 5JPAA 1QVFO 2Z46A 3RG6C 2CWOA 3I55P 1PEOA 3CMAP 3CCSP 4XRQA 1VQ6P 2LF4A 1M6NA 1KC8Q 3G0VA 1Q86Q 1PEUA 1E6JP 1YHQP 5HGMA 4QNBA 4COPA 1Q82Q 4COCA 3CC2P 2XT1A 3B5IA 1K30A 3DS2A 3G26A 1YI2P 4U0CA 1VQNP 5DCKA 1RO2A 2EIAA 2M8LA 3I56P 3H47A 3DS5A 2PENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K Q;  1VQM P;  1W2B O;  1VQ5 P;  1K73 Q;  1VQL P;  1YJW P;  2QEX P;  1K9M Q;  1VQK P;  2OTL P;  1YJN P;  1Q7Y Q;  3G6E P;  3CC4 P;  3CCL P;  1YIT P;  1S72 P;  1Q81 Q;  1QVF O;  1K8A Q;  3CC7 P;  1M90 Q;  3I55 P;  3CMA P;  3CCS P;  1VQP P;  1JJ2 O;  1VQ6 P;  3CME P;  3CCM P;  1KC8 Q;  3OW2 O;  3G71 P;  3CCQ P;  1Q86 Q;  3CXC O;  3CPW O;  3CCU P;  1YHQ P;  1VQ4 P;  3CD6 P;  1VQ8 P;  2OTJ P;  1YIJ P;  1KD1 Q;  1VQ9 P;  2QA4 P;  3G4S P;  1QVG O;  3CC2 P;  1VQO P;  1YI2 P;  1N8R Q;  1KQS O;  3CCE P;  3CCJ P;  1VQ7 P;  1VQN P;  1YJ9 P;  3I56 P;  3CCR P;  3CCV P;  1Q82 Q;  1NJI Q; 
#chains in the Genus database with same CATH topology
 3IFM A;  3D6Y A;  3HD7 A;  4W7Z A;  1PL5 A;  3O6Q B;  3QWO C;  2FAE A;  4L73 A;  2K94 A;  1N7L A;  2FFD B;  3CX5 I;  4EI2 A;  4WB4 A;  1JJ2 O;  2BEZ F;  1IMQ A;  1LGH B;  1N7S A;  1FJP A;  4A7P A;  2L6E A;  5BU8 B;  4H44 B;  2CG5 B;  1NWQ A;  2K9Y A;  3HUS C;  4IPY A;  4JF7 A;  4UB6 E;  4GR2 A;  2FYU D;  2N9B A;  1LT1 A;  4HJG H;  3LIE A;  1BSH A;  1GMJ A;  1NTM K;  5BU5 A;  3DPH A;  5CCH A;  2MVU A;  1NO4 A;  2VLQ A;  2KG8 A;  4XA4 A;  1NKZ B;  5AVR B;  2KS1 B;  3CD6 P;  1MV8 A;  3CXH E;  2GZF A;  3CE7 A;  5APT A;  2CGQ A;  4UB6 H;  1NGM B;  1KQS O;  1LTB C;  1SQX K;  3C8V A;  3LW5 H;  4R4L A;  2KOO A;  1ZXG A;  1S4X A;  1DIP A;  1KIL C;  1MFZ A;  1JO5 A;  2E5Y A;  1URQ D;  5AW9 B;  3A0H E;  2CQ8 A;  1AVY A;  3CXH H;  4RKU J;  3EJB A;  2O1J A;  5AVQ B;  5AVW B;  1FC2 C;  1YIJ P;  2FXO A;  2QG4 A;  3CCE P;  4WY4 D;  1L0L E;  1BDD A;  3A0H H;  2KOD A;  2Y0C A;  3M1M A;  2VRS A;  2PEQ A;  5AVS B;  1KLP A;  2AEF A;  1FZC C;  1BE3 J;  2Z46 A;  2IDB A;  4EYY Q;  2ZT9 C;  2E42 A;  4HYT B;  2RN0 A;  3AEA C;  4Y28 J;  4BPF A;  1T2K C;  2Y0D A;  1BXI A;  1LTJ B;  2NPS B;  2JU1 A;  4H2X C;  1D7M A;  1QGK B;  4WYM A;  2NO8 A;  3H1J G;  2CNR A;  1SQB J;  5F2K A;  3CWB J;  3OW2 O;  2L4B A;  2YKQ A;  2GZG A;  4QMA A;  1RF0 C;  3L70 D;  4W7Y A;  2QM7 A;  2W27 A;  1KZU B;  2P9X A;  3O8Z A;  1CSB A;  2M5R A;  2Z44 A;  2WTY A;  1LTJ A;  2E76 D;  2NPS A;  3MHV A;  3G3Z A;  1GXG A;  1RY3 A;  3RK3 B;  1L0L G;  1VQ7 P;  1BDC A;  3RL0 C;  1LWU B;  1SQQ J;  4PH0 A;  1IFN A;  3CI9 A;  2L22 A;  4BWN A;  1LJ2 A;  1HBW A;  1KB9 E;  1OMI A;  5AVV B;  2FAD A;  2KG9 A;  1Y47 A;  1GL2 D;  4DT0 A;  2Y9Z A;  2K9J B;  1KQL A;  2D2C C;  1WRG A;  2LKM A;  5APW A;  2OYH B;  1JMB A;  4U3F G;  4OGQ B;  1KB9 H;  1VF5 D;  1URQ C;  1LWU A;  3L71 J;  2WPV B;  5CZD B;  1QVF O;  1LP1 B;  2OGU A;  1SFC D;  1BGY D;  1NTK E;  4YXW H;  4BXL A;  1N7S D;  1YHQ P;  4JPZ B;  3H1J D;  2EHS A;  5AVZ B;  5H2F E;  3G26 A;  3AE9 C;  1GTW A;  2K9J A;  4WY4 C;  4D6T E;  1J1D C;  1X8Y A;  2M8L A;  1OIP A;  3AEC C;  4NPF X;  1EQ7 A;  3D6Z A;  1FE6 A;  5KP8 B;  4H0L B;  5CCH D;  5HGL A;  2YIU C;  1K8A Q;  4GOD A;  1LTA C;  1MKM A;  3H1L E;  2P7J A;  4TT3 H;  5H2F H;  4U0F A;  2IPP A;  2W8Z A;  5KLV J;  1HY8 A;  1L0N E;  1SQB K;  2WSE J;  3Q3D A;  2M3E A;  2QJY C;  1LT9 C;  3P32 A;  3P8C E;  1AUM A;  3C9I A;  2V4H A;  1EZV E;  4MN4 C;  1M1J B;  1XTG B;  2R44 A;  3DS1 A;  5KAF E;  4IL6 E;  3BCC J;  1CEI A;  2GA1 A;  2KOP A;  2M3B A;  1BCC E;  3DTJ A;  1F80 D;  5EFW B;  2FQ1 A;  1FR2 A;  7CEI A;  3HTK A;  4U3F D;  2WZ7 A;  2E76 C;  5KAF H;  1NU1 E;  4IL6 H;  3GMA A;  1ZW0 A;  5KLI C;  4N3Y B;  3PJS K;  1SQQ K;  1OW8 A;  2JJL A;  2ONT A;  5AW5 B;  4HH2 A;  1M1J A;  5AW6 B;  3EFF K;  1W2E A;  1HH0 A;  4H2W C;  2QA4 P;  4C7N B;  1USE A;  3V6I A;  3AEE C;  1N8R Q;  1P84 D;  2IYO A;  2VLN A;  1ZMB A;  2IZ0 A;  2KZJ A;  2GDY A;  5B5E E;  1MFT A;  3W67 A;  1SQP J;  1YYC A;  3H25 A;  2LIU A;  2MY5 A;  1AVO A;  1ZRT E;  1PEU A;  1RQU A;  3V2R A;  1GL2 C;  3PP5 A;  3TF5 A;  1L0N G;  2N50 A;  3EQ2 A;  1R8E A;  3L74 E;  1RF1 B;  1SS1 A;  4C7N A;  3B4S A;  3NXS A;  5B5E H;  3MUD A;  2N6Z A;  3PHL A;  4WBA A;  2NPS D;  2KSJ A;  1EZV G;  1IK7 A;  3H4E A;  1N7S C;  1SQB D;  2LIW A;  2O01 H;  5DJT B;  2JQ4 A;  1BCC G;  1RF1 A;  5KLV K;  2P2U A;  2G8Y A;  3CCR P;  2E75 B;  2K0D X;  4Y99 C;  3R2P A;  2KW2 A;  5APV A;  3BAT A;  2PY8 A;  1NU1 G;  5CCH C;  1PP9 J;  2FYN B;  2AFE A;  4N6J A;  1CI6 B;  3RK3 D;  1KOR A;  2O01 N;  3G21 A;  4DZO A;  1QEX A;  4H44 C;  3IAO A;  3GF7 A;  2BUO A;  2JYL A;  2PAJ A;  2WPR A;  3RL0 B;  2BAS A;  2R5D A;  1SQQ D;  3OJA B;  3M9H A;  3KXD A;  4PD4 E;  3KDP B;  3GJN A;  2VLO A;  1AJY A;  2LOL A;  3HE5 B;  2ZYA A;  3AEB C;  1LTT C;  1KD1 Q;  3L74 G;  2FQ0 A;  3M9B A;  1CI6 A;  4OH8 B;  1A8O A;  3D70 A;  1KV4 A;  2D2C B;  3C1L A;  4OGQ D;  1K05 A;  4PD4 H;  5KAI E;  2JR8 A;  3WU2 E;  2YNY A;  2QM8 A;  2WSC J;  3G0V A;  3EWK A;  1SQP K;  5AW4 B;  4HKZ H;  1KMI Z;  1FOS F;  2ZXE B;  3VP8 A;  3S9O A;  3D71 A;  2KI7 B;  3WU2 H;  1EDI A;  3BRV B;  1BCC D;  2YMY A;  2W83 C;  2OYO A;  1VQK P;  4BPH A;  1FS0 E;  4YXD C;  5HVC A;  2YIU B;  2N5I A;  1H88 A;  1P84 I;  2Z4E A;  5HV8 A;  3SWY A;  3CCU P;  1YTZ I;  1M6E X;  5AVU B;  3M06 A;  1ZLL A;  2KG6 A;  2NRG A;  2KB7 P;  2XZ0 D;  3LMO A;  1KYO I;  4U0A A;  3FX0 A;  1LTJ C;  2NPS C;  2Q6Q A;  1GZL A;  2Q1K A;  1ACP A;  2K37 A;  5CHX A;  2O3J A;  2EHT A;  2V7Q H;  2KUB A;  2MF4 A;  1NTZ E;  2KSE A;  4M3L A;  3UIA A;  3L75 E;  1KIL D;  2WT7 A;  2HR3 A;  1Z6M A;  5KLI B;  1M90 Q;  2LML A;  2I8D A;  2XV6 A;  3M0D C;  2JP3 A;  3RK3 C;  2A06 D;  1UII A;  2WIT A;  2N6Y A;  3TGU E;  1GW3 A;  1LWU C;  1GD2 E;  1AFO A;  2XKM A;  2W90 A;  1LTI C;  1RE3 C;  1NAY A;  1PEO A;  2QJK B;  2FVE A;  3L72 G;  4EOT A;  1SQP D;  1QL1 A;  1LTG C;  2SPZ A;  2XT1 A;  1UJZ A;  1X22 A;  2RH0 A;  3H1K G;  4CPG A;  1LNQ A;  4OGQ C;  3GZM A;  3HD7 B;  1Y8A A;  2BHV A;  2L5G B;  3VOP A;  4R4M A;  2KLU A;  1S3J A;  3H1J J;  1FZA A;  3PRJ A;  3F89 A;  1S9K D;  1VQ9 P;  3MZW B;  1NTZ G;  4ZNC A;  2K3R A;  3L75 G;  1VDF A;  4JBZ A;  4H0L C;  1OW7 A;  1JY2 N;  1JTH B;  4IZ6 A;  2R3C A;  1SQX E;  2IBZ E;  1PP9 D;  2QSI A;  1KFN A;  1JB0 J;  3BAS A;  1L0L J;  3TGU G;  4H2Y C;  1K73 Q;  3RL0 D;  1LTS C;  2Q5U A;  1NAF A;  3L37 A;  4IFD K;  2M0B A;  1M1J C;  1JTH A;  4PH1 A;  3T97 B;  2H8P D;  3L72 D;  2W6B A;  3H1H G;  3MGE A;  2WSS H;  2D2C D;  1IFM A;  4U0B A;  3VTP C;  3BVH A;  1A43 A;  1X79 B;  3HRN A;  4U3F J;  1L0I A;  2AF8 A;  2QNW A;  3H1K D;  3V4Q A;  3B5N A;  2BCC E;  1ZR4 A;  2R5B A;  2ROQ A;  1ZN5 A;  1JNM A;  1U7J A;  3SWF A;  2FAC A;  1HGV A;  2Y0E A;  4WWI A;  4ASW A;  3T97 A;  2BEQ D;  3B5I A;  4K3A A;  3AE2 C;  3MUD C;  1SVF A;  3TDK A;  4NEO A;  1G1I A;  1J2J B;  3U43 A;  4XFJ A;  3GG2 A;  1KQG B;  4XFZ A;  3H1I E;  2UWJ E;  2N1T B;  3MP7 B;  1FDM A;  4UHP B;  4L74 A;  3NFQ A;  1RF1 C;  2H88 C;  2XNX A;  1IZN B;  2E74 B;  1YJ9 P;  1JY2 P;  2B88 A;  2K1A A;  2KP8 A;  1S5L X;  2GZJ A;  1W5C E;  1YQ3 C;  3OA7 A;  5CJ0 A;  3A3Y B;  4IOI H;  2YXR B;  2N1T A;  1SQV E;  2AEJ A;  2WWW A;  3H1H D;  1GU4 A;  2E75 C;  1PFI A;  1L0L K;  2WVR A;  4DOJ A;  1OXZ A;  2BCC G;  1OW6 A;  4M0I A;  3WUV A;  1Z56 A;  3N7N A;  2FYN C;  1L2P A;  1J1E B;  2H89 C;  1PPJ E;  1NKN A;  1VQ4 P;  2VSQ A;  1RH5 B;  2LL8 A;  2C9L Y;  1BE3 E;  3MIW A;  1DH3 A;  3KQG A;  1KYO E;  1ZOY C;  3H1I G;  2K92 A;  1FAV A;  1S1C X;  1N2D C;  1E6J P;  1AV1 A;  3CL3 D;  1MZ9 A;  4AUW A;  4LGD E;  1KQF B;  1YI2 P;  1L0N J;  4C46 A;  2K0X A;  2LKI A;  1RNI A;  1FZF A;  3HD7 D;  2EG5 A;  2PFX A;  2JB0 A;  5CBN A;  2WPT A;  1IFJ A;  5GTI E;  1VL2 A;  1KFM A;  3CWB E;  3V2N A;  1A02 J;  1SQV G;  2Q7C A;  3CXH D;  1YQ4 C;  2C0W A;  5AVY B;  1BCC J;  5GTI H;  2GUV A;  1H8A A;  5BS2 A;  2P58 A;  1NH4 A;  2PRR A;  1YJN P;  5BVZ A;  2JO0 A;  3VMA A;  1NU1 J;  2OTK E;  2X2B A;  1HVV A;  3MTU E;  3B4Q A;  4R0M A;  3JCU E;  1M7L A;  4HB1 A;  4F37 A;  3CCJ P;  4H44 D;  3ABV C;  1L0L D;  1VQM P;  4YPC A;  3HTK B;  2XU6 A;  3CC4 P;  2JGP A;  3LRY A;  4H13 C;  5KKZ B;  2POH A;  2OAR A;  2E43 A;  2PEO A;  3DS0 A;  1DX7 A;  3VRL C;  3M9Q A;  3L74 J;  5KJ7 A;  4GDO A;  2LTE A;  1M57 D;  1QRJ A;  3L71 E;  2OYI B;  1OX3 A;  2YMK A;  5AW8 B;  5AW3 B;  1NTK G;  2QVA A;  3GLM A;  3CX5 E;  1EDK A;  3JSV C;  4D6T G;  5AVT B;  4I2L C;  3DS3 A;  1D1D A;  1L0N K;  1ZV8 A;  2QEX P;  3NTE A;  4PWV B;  2OTL P;  1NQ4 A;  2OYI A;  3H1L G;  3CX5 H;  2QJK C;  2N1T D;  2A45 H;  1DD4 A;  2FQ2 A;  4U0D A;  1L4A B;  3L36 A;  1GU5 A;  2ZFC A;  1T6A A;  2Z5H A;  1PV3 A;  2FXP A;  3L73 E;  4PJ0 E;  1H89 A;  2FVA A;  3HD7 C;  1FOS E;  3Q20 A;  3ZDM A;  1JCD A;  2W6J H;  1KB9 D;  3BCC E;  5B66 E;  3RK2 B;  1NU1 K;  3AE7 C;  1MUU A;  5KTB A;  4PJ0 H;  1JY2 O;  1L4A A;  1PGJ A;  1SP4 A;  1EXI A;  1M1K Q;  1K9M Q;  4BPG A;  3G28 A;  3CCL P;  1E79 H;  4I7Z B;  1VKU A;  5HGO A;  3B71 A;  5AW0 B;  5B66 H;  3GW6 A;  5CCG A;  2XXM A;  1JUN A;  3CXH I;  1XTC C;  2ZXX A;  1BSN A;  1NTK D;  2JBG A;  4ASV A;  4PV1 C;  4N78 E;  1SLQ A;  4MRT C;  2WPQ A;  2WSF H;  2A45 G;  5EJD A;  1A02 F;  1X9V A;  2K5X A;  4UB8 E;  2R3S A;  4D6T D;  3A0B E;  1OR5 A;  5JPA A;  4L76 A;  3RG6 C;  4I1L A;  1IJD B;  1VQ6 P;  3L72 J;  4WVZ A;  1Q2N A;  3H6P A;  3H1L D;  2PNG A;  4UB8 H;  1X0T A;  1U7M A;  4GKG A;  3A0B H;  2V7Q J;  4OWF A;  1L0N D;  1UNK A;  1IFI A;  1FU1 A;  1AA0 A;  3L73 G;  3H1K J;  5AW7 B;  1GDT A;  1QX8 A;  3P8C D;  3WBH A;  1EZV D;  3G71 P;  2OTJ P;  2MR8 A;  1N73 A;  1R5S A;  1WT6 A;  1GXH A;  3GHG B;  1NTZ J;  4KT0 J;  5KAI H;  3HE4 B;  2I1J A;  3L75 J;  3AE6 C;  5I4T G;  1ZME C;  3PLN A;  1L0H A;  5AW2 B;  1JEK A;  4H0L D;  1NU1 D;  2N1T C;  4XRO A;  5APU A;  2GM4 A;  2FYU E;  2E74 C;  3GHG A;  1QL2 A;  3G1I A;  3HE4 A;  3TGU J;  2WT7 B;  2HYN A;  1T8Z A;  3G6E P;  2Q3E A;  1PZQ A;  4H13 B;  3NMD A;  2AEM A;  2B9B A;  3AE4 C;  1ZP0 C;  1H0T A;  1EC5 A;  3CPW O;  1ZRT D;  1HWT C;  4RES B;  1OVV A;  3H1H J;  2KR5 A;  3NTN A;  4TLF A;  3Q5S A;  3L74 D;  1NHL A;  1OVR A;  1KB9 I;  2QJP B;  2KGA A;  2Z5I A;  2HOD B;  1PIX A;  2LF4 A;  3P8M C;  1Q86 Q;  1G2C A;  5HGM A;  2C0X A;  1VPC A;  1J1E C;  1VQN P;  3KPE A;  2PEN A;  2WSC H;  1LT9 A;  1YIT P;  1PGO A;  1RE4 A;  2HOD A;  1DNY A;  3E1R A;  2KZI A;  3VN0 A;  2DGY A;  1L4A D;  2XND H;  2M5A B;  4N78 D;  2FYU G;  3B8E B;  3AE1 C;  4NPE A;  2PGD A;  5EW5 E;  1NTZ K;  5GTH E;  3LW5 J;  2HPC A;  4XE5 B;  2IZ1 A;  4PXH B;  5E79 E;  4PD4 D;  3U1A A;  2VLP A;  3RK2 D;  2KNC A;  3L70 E;  2XDJ A;  2EFJ A;  1NTM E;  2M5A A;  3AE8 C;  2YKO A;  1VF5 B;  2E75 D;  1EZV I;  1HJB A;  3KZI E;  3P05 A;  5E79 H;  2MR7 A;  3SWK A;  2RMZ A;  1E0H A;  1SFC B;  2K88 A;  2N5H A;  2BCC J;  1PGQ A;  2M8P A;  2M8N A;  1IFD A;  5APQ A;  5KJ7 C;  4PV1 B;  4BRY A;  3JC2 2;  3KZI H;  2B87 A;  1K04 A;  4ZKU A;  4ZKP A;  5L8R J;  1WMK A;  3B5N B;  1Q81 Q;  5KKZ C;  1SFC A;  4XRQ A;  2A45 I;  3H1I J;  3MD0 A;  2JWD A;  4LC1 A;  1OWA A;  1MZ8 A;  2JEE A;  1S5L E;  1KN7 A;  1FBM A;  1TU3 F;  3H0D A;  2ZVN B;  2OYI C;  1BGY E;  3AE5 C;  3NY7 B;  4GOE A;  3O6Q A;  3H1J E;  1EOQ A;  1DV5 A;  2L9F A;  2FFD A;  1DEB A;  3F5H A;  3L70 G;  3CXC O;  1S5L H;  3VP9 A;  2J59 M;  1SQV J;  3W68 A;  1E5W A;  1NTM G;  3A7O A;  1NTZ D;  2MJZ A;  1NJI Q;  1VQL P;  3L75 D;  2N98 A;  2KIK A;  3FXE A;  3OAK A;  1GK4 A;  3LID A;  2AFD A;  1FZB A;  1SQX G;  1OZH A;  2IBZ G;  1VHN A;  2KS1 A;  3RBX A;  2IX7 C;  2H43 A;  1S2E A;  3GZL A;  1L4A C;  1G1J A;  2YXQ B;  1IFP A;  3GF3 A;  2C9N Y;  1JM0 A;  1M74 A;  2KK7 A;  3TGU D;  2J5U A;  5CCG C;  2LPK A;  4H13 D;  3MGN A;  3RL0 g;  1FJK A;  3Q5R A;  2ZJS E;  1EDL A;  3RK2 C;  4O9B A;  2YO2 A;  2FHS C;  5C39 A;  1EXJ A;  2P67 A;  3VMZ A;  2XZR A;  2XZ1 C;  4CA3 A;  4U3F E;  1NYH A;  4PD4 I;  5APY A;  4RJT A;  1BGY G;  4IFF A;  3G9R A;  3PH0 A;  1Q7Y Q;  4JYB A;  4I6M C;  1BAJ A;  4I7Z C;  3KHU A;  1JY3 N;  1M8O B;  1NTK J;  3FGA D;  1M6N A;  1KC8 Q;  1ZNV A;  3M91 A;  3PTZ A;  1P84 E;  2J58 A;  3R4Y A;  2H7H A;  3N4X A;  4IFM A;  3GKL C;  3I56 P;  3V2P A;  4D6T J;  3DS5 A;  1NTM D;  1W2B O;  2KGC A;  3VYI A;  1P84 H;  1QLE D;  1FDO A;  2RKL A;  3IN6 A;  2MVV A;  1Y9B A;  3H1L J;  2IFM A;  1N73 C;  2JAZ A;  3SSU A;  1SQX D;  2IBZ D;  4QKO A;  4U0E A;  3E2D A;  1EIA A;  4ZMD A;  1HGZ A;  2ZVO B;  4XFX A;  2FXM A;  4L75 A;  1KYO H;  1SQV K;  2O1K A;  2KOQ A;  2JKV A;  2M8R A;  1YTZ T;  4YTP C;  1SQB E;  3AEF C;  3M0D A;  3HYB A;  3HZQ A;  1DEE G;  2IYP A;  2FKW B;  1PGP A;  2CPB A;  3GHG C;  1HTL C;  1EMV A;  2PEM A;  2KOG A;  3TSI A;  2E1M A;  1IK9 A;  3SFD C;  1RE3 A;  4W80 A;  5AVX B;  3RK3 E;  2BCC D;  2N9Y B;  3ITK A;  4Z1M H;  2Z45 A;  3I5C A;  3IR9 A;  5F2N A;  3EFG A;  1QVG O;  4PV1 D;  3AEG C;  2GZE A;  2LXC B;  1HQB A;  2ZYD A;  1PPJ G;  2Y9Y A;  2OYH A;  1JY3 P;  3EJE A;  5KP6 B;  1SQQ E;  1YJW P;  4B86 A;  1BE3 G;  1N86 A;  3B5N D;  3JCU H;  3TYY A;  1LP1 A;  3S4R A;  4KJM A;  2JDI H;  3H1I D;  4JYC A;  3Q1M A;  4COP A;  2OQQ A;  3L4F A;  1NTK K;  1K30 A;  1T3U A;  3RG2 A;  4U0C A;  2EIA A;  3HUS B;  1DD3 A;  2O01 J;  3L73 J;  2QJP C;  3AED C;  1RE4 C;  1SQB G;  2NZ2 A;  4DCK A;  3CWB G;  3H32 B;  1T8K A;  2QRX A;  3RBZ A;  2ITA A;  2JWA A;  3G4S P;  1GK6 A;  2PP6 A;  4AQR D;  3V2Q A;  1SQV D;  5APX A;  1GPJ A;  4XFY A;  1PEM A;  2HLO A;  4NPD A;  1KIL B;  2WSF J;  3HUS A;  5TJH A;  4EDF A;  2I1K A;  1CW5 A;  1KTM A;  3SFE C;  2K2Q A;  3G1G A;  4GOF A;  2CK3 H;  1CZQ A;  2FBW C;  3CLQ A;  3CCM P;  3H32 A;  5KLV E;  1R5L A;  2LR2 A;  2BQ1 E;  2KGE A;  4EIJ A;  4RO0 A;  2E74 D;  1SQQ G;  1KIL A;  1PPJ D;  1VQ5 P;  1Q90 D;  5K5G B;  2MD9 A;  1FZC B;  2IBZ I;  2ZT9 B;  1BE3 D;  1KYO D;  2WSE H;  3USS A;  3WUT A;  2AVA A;  3E1I A;  1NOH A;  2PEJ A;  3BRT B;  4LLH A;  4IL6 X;  3QH9 A;  2K93 A;  1KIL E;  4GT1 A;  3K5B A;  1VF5 C;  1EDJ A;  3L71 G;  1HUC A;  1FZC A;  1SFC C;  2B89 A;  1ZR2 A;  2KXP B;  3I55 P;  1JOC A;  3FWN A;  3M0A A;  2A06 E;  4OVN F;  5DJU B;  3CWB D;  5KP7 B;  4COC A;  2QIW A;  2KYV A;  5DCK A;  3V4W A;  3H47 A;  3AE3 C;  3U1C A;  2DW3 A;  3S1K A;  3WUU A;  1FDI A;  3B5N C;  3RGU A;  1NVO A;  1SQP E;  2FFD C;  1FZE A;  1RQV A;  4C7R A;  2WQY C;  1HJ0 A;  4DJG A;  5KLV G;  2HFE D;  3A5T A;  1N73 B;  5TIS E;  3E7K A;  3TNU B;  1RF0 A;  2WMM A;  3U59 A;  2GDX A;  2FYU J;  5M1B A;  2GYK A;  2IFN A;  2L91 A;  2JYG A;  2FY8 A;  1S72 P;  2AXC A;  3FXD A;  2K0Y A;  4GR6 A;  5TIS H;  3L35 A;  3VMX A;  1S9K E;  3BCC G;  2QE7 H;  3CCQ P;  1RO0 A;  4U7J A;  2PEK A;  2W6A A;  1AYI A;  3TNU A;  2G3A A;  1AQ5 A;  4K35 A;  1URQ B;  3IF4 A;  1PEQ A;  3L71 D;  1PP9 E;  1H0T B;  1AF8 A;  2GUS A;  2A06 G;  3Q2Y A;  3HE5 A;  1VQ8 P;  5KJ7 D;  4WY4 B;  5CBO A;  1J1D B;  1IO4 A;  3CX5 D;  5BS1 A;  2P1J A;  3II6 A;  2GDW A;  2DNW A;  1OFC X;  1URQ A;  1SQP G;  3L72 E;  3CMA P;  2P10 A;  1G2C B;  5APS A;  2FVF A;  4QNB A;  1UIX A;  2XV5 A;  5KLV D;  3CC2 P;  3EJD A;  4KHX A;  2ZAE B;  1JY3 O;  4WY4 A;  2QJY B;  1LT9 B;  1Q82 Q;  3H1K E;  1M56 D;  2R32 A;  3L73 D;  1T3J A;  5F2O A;  2E5T A;  3CME P;  1IMP A;  2FYZ A;  1IC2 A;  3L70 J;  3BCC D;  4AYC A;  3P7K A;  5AW1 B;  1JMM A;  1JCC A;  2CPS A;  1NTM J;  2L0Q A;  4JQ0 D;  1U57 A;  1RHZ B;  2E76 B;  2FYU K;  2ZYG A;  2HPC B;  1X3O A;  1PP9 G;  5CJ4 A;  4GIF A;  2GZI A;  1VQP P;  3G29 A;  2KNC B;  2ERH A;  3DS4 A;  1SQX J;  5CMZ A;  2PEI A;  2JO1 A;  1OVU A;  2YO3 A;  1IUQ A;  2KOR A;  5HGN A;  2WPS A;  2AXT E;  5CCG D;  2ZT9 D;  3CC7 P;  3Q5P A;  2LXB A;  1GL2 B;  4HKG A;  3H1H E;  3TK1 A;  4BRY B;  1FZG A;  1VQO P;  3VMY A;  1AQT A;  2B87 B;  3FWL A;  2OYH C;  3CCV P;  5GTH H;  3A2A A;  2AXT H;  2MKV A;  2KWL A;  1T2K D;  1YBK A;  1HF9 A;  2KOS A;  1BGY J;  2YKP A;  1GW4 A;  2CWO A;  3CCS P;  2Q3I A;  2KGD A;  1N7S B;  4DG9 A;  2JU2 A;  1GL2 A;  3DS2 A;  2Q9I A;  3KYQ A;  2KLV A;  2HG5 D;  1RO2 A;  1USD A;  4Y99 B;  3WMM 0;  3V5B A; 
#chains in the Genus database with same CATH homology
 3DS3 A;  1D1D A;  3H0D A;  1W2B O;  1RNI A;  1VQK P;  2QEX P;  3NTE A;  2EG5 A;  2OTL P;  2BHV A;  1YIT P;  5HGL A;  5F2O A;  4WYM A;  1K8A Q;  3WBH A;  3H4E A;  4XFZ A;  1EOQ A;  5F2K A;  1JJ2 O;  3CME P;  3OW2 O;  3G71 P;  4U0F A;  3CXC O;  3CCU P;  2OTJ P;  1M6E X;  1VQ9 P;  4U0D A;  3G4S P;  2DGY A;  4U0E A;  3E2D A;  2L6E A;  1EIA A;  4XFX A;  4XFY A;  1PEM A;  1YJ9 P;  3CCR P;  4U0A A;  2JYG A;  1NJI Q;  4IPY A;  5I4T G;  2P9X A;  4GR2 A;  5BS2 A;  1VQL P;  2Z44 A;  1YJN P;  2PY8 A;  1AUM A;  1S72 P;  2JO0 A;  3G1G A;  3DPH A;  4GR6 A;  3Q20 A;  1VQP P;  3DS1 A;  3CCM P;  3G29 A;  3CCQ P;  3DS4 A;  2PEI A;  3CD6 P;  1RO0 A;  3HYB A;  2EFJ A;  3HZQ A;  2PEK A;  4XRO A;  3G21 A;  1KQS O;  1IUQ A;  2BQ1 E;  3CCJ P;  1VQ7 P;  2PEM A;  2JYL A;  2BUO A;  3G1I A;  1M74 A;  3DTJ A;  1M1K Q;  1VQM P;  5HGN A;  2E1M A;  1VQ5 P;  1K73 Q;  4PH0 A;  1K9M Q;  3G28 A;  3CCL P;  3G6E P;  3P05 A;  3CC4 P;  3LRY A;  5HGO A;  1PEQ A;  4M0I A;  2OAR A;  3CC7 P;  2XXM A;  1M90 Q;  2PEO A;  2M8P A;  2ONT A;  2M8N A;  4PH1 A;  2XV6 A;  3CPW O;  2PEJ A;  2Z45 A;  1VQ8 P;  5F2N A;  3DS0 A;  1YIJ P;  1KD1 Q;  2QA4 P;  3VRL C;  1QVG O;  1A8O A;  1VQO P;  1N8R Q;  3MGE A;  3CCE P;  5BS1 A;  1ZMB A;  2KOD A;  4U0B A;  3CCV P;  1VQ4 P;  1A43 A;  3M1M A;  1QRJ A;  2PEQ A;  1YJW P;  1Q7Y Q;  1BAJ A;  1Q81 Q;  5JPA A;  1QVF O;  2Z46 A;  3RG6 C;  2CWO A;  3I55 P;  1PEO A;  3CMA P;  3CCS P;  4XRQ A;  1VQ6 P;  2LF4 A;  1M6N A;  1KC8 Q;  3G0V A;  1Q86 Q;  1PEU A;  1E6J P;  1YHQ P;  5HGM A;  4QNB A;  4COP A;  1Q82 Q;  4COC A;  3CC2 P;  2XT1 A;  3B5I A;  1K30 A;  3DS2 A;  3G26 A;  1YI2 P;  4U0C A;  1VQN P;  5DCK A;  1RO2 A;  2EIA A;  2M8L A;  3I56 P;  3H47 A;  3DS5 A;  2PEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...