1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
3CPWO 3OW2O 1YI2P 1YJWP 2OTLP 1KC8Q 1K9MQ 1VQ5P 2OTJP 1YIJP 3CCLP 1VQLP 1VQ8P 3CCVP 1YJNP 3CCEP 1W2BO 1M90Q 1QVGO 1VQ7P 1VQ6P 3CCUP 1M1KQ 3G6EP 1VQMP 1VQ9P 1Q7YQ 3G71P 1Q81Q 3CMAP 1QVFO 1YHQP 1YITP 1JJ2O 1VQ4P 1S72P 3CCQP 3CD6P 3CCRP 2QEXP 1VQOP 3I55P 3CCSP 1Q86Q 3CCMP 3CXCO 3I56P 3CMEP 1K73Q 1YJ9P 1VQPP 3CC4P 2QA4P 1KQSO 1K8AQ 3CC7P 1VQNP 1KD1Q 3G4SP 3CCJP 1N8RQ 1Q82Q 1NJIQ 1VQKP 3CC2P
chains in the Genus database with same CATH superfamily
1JEKA 5KKZC 3AE1C 4D6TE 2CG5B 3P8MC 1SQBK 1RH5B 3MP7B 1SFCD 3GG2A 3MUDA 1KMIZ 3CWBE 5KJ7D 3CMAP 1EZVE 1KILE 2WWWA 3TNUB 4PH1A 3WU2H 4XE5B 3RK3E 2FQ2A 2FAEA 1T6AA 1LTIC 1NTKK 2CK3H 1Z6MA 1EDIA 5GTIH 2H88C 2W6BA 2JBGA 1IFIA 3NTEA 2WZ7A 5CJ4A 1UIIA 1VL2A 3EFFK 7CEIA 4WVZA 1Q7YQ 3AECC 1SFCA 1ZMEC 3BCCJ 2P10A 4H0LC 2G8YA 1KQLA 1Z56A 1ZNVA 1N7SA 4KHXA 3H4EA 3H1IG 3EFGA 1RO2A 1KQFB 1RF1C 2FFDA 2Y0CA 5BU5A 3TGUG 2K9YA 1VQMP 2HG5D 2M0BA 3L72J 5AW1B 4L74A 5GTIE 5AW4B 3LIEA 1BCCE 1N86A 5CBNA 1LT9A 2EHTA 1PGPA 2W83C 2K1AA 1L0LD 4R4MA 2PP6A 3B8EB 3IN6A 4HJGH 3VP8A 1M74A 1AA0A 4COCA 1HTLC 2KS1B 5CCHA 2A06D 2E75B 2Q7CA 1FZAA 2OYIC 3F5HA 1CSBA 1BE3D 1BDCA 3PP5A 1SQQK 1A43A 4BPFA 2HODB 1K73Q 4H0LD 3RK3C 1K8AQ 1HF9A 3L71E 3M91A 2OYIA 5F2KA 3H1LJ 2O1JA 1CI6B 3L72D 2OYHA 1Q90D 3HUSC 3CCUP 4UB6H 2ZT9D 2N6ZA 3VOPA 1FAVA 5EW5E 3H1KD 1SQPE 4I2LC 2LF4A 2K0DX 3GKLC 2KOGA 1T3UA 3SFDC 4UB6E 4EI2A 2IX7C 3L70J 3N7NA 2PGDA 3BVHA 1CEIA 4WWIA 3F89A 3LW5J 3AEEC 5EJDA 3EJBA 1N7SC 3VN0A 2FYUK 3A7OA 4JF7A 3O6QA 4H44D 5KLVG 2N98A 2ZT9C 3A0BE 3GLMA 4JQ0D 2KOQA 4ZKUA 2JYLA 5GTHH 2X2BA 2JB0A 3P8CE 4JBZA 3G29A 4W80A 1S72P 5TJHA 4UB8H 1PP9E 3UIAA 3SWFA 5E79E 2GDWA 1ZLLA 2KSEA 2QRXA 4R4LA 1RE3C 2FVFA 1SQPD 2XZ1C 2XDJA 5CHXA 1AJYA 5L8RJ 1M6EX 1H8AA 4GKGA 1QL2A 2KODA 2WSFH 2O1KA 1OZHA 1DH3A 2EG5A 1MFZA 3WUTA 3T97B 3C8VA 2W8ZA 1QGKB 4IOIH 4GOEA 1IFJA 4PD4H 1F80D 3H6PA 2AEMA 3RG6C 3CXHI 2JU1A 3TGUE 3ABVC 2ZXEB 2WMMA 4AQRD 3B5IA 1KFMA 2Y9YA 2E76B 5GTHE 3TDKA 4U0CA 3CI9A 1FDMA 3LRYA 2KSJA 2KOPA 1BCCD 2KB7P 3VMZA 4LGDE 2Q9IA 3L75D 1JB0J 1LTJB 2CWOA 1SQBE 2RH0A 2KUBA 2H7HA 3ZDMA 1SS1A 2WT7B 3PHLA 2CGQA 2P1JA 1X8YA 2H43A 1E6JP 2QM7A 1GPJA 1BAJA 2IBZE 1N7LA 3AE9C 1NGMB 4D6TG 1NTKJ 3EJDA 1KQGB 5KP8B 5B5EH 1DD4A 1KB9H 3LW5H 5TISE 2ROQA 3CC2P 3B5NC 5KAIE 2B89A 4K3AA 1A02J 3CX5H 5CCGD 2N5IA 1KILD 1URQD 2IFMA 5JPAA 1QRJA 3DPHA 2KK7A 1JMBA 3DTJA 1A8OA 1VHNA 2PEQA 2GUVA 2JEEA 4H13D 3OA7A 2Z45A 1SQPG 2QJKC 1SQXG 1J1DB 3L75E 2NPSB 2L0QA 1YIJP 1BCCG 1W2EA 4RKUJ 1IFPA 2K88A 1LP1B 3NTNA 1S5LE 1AVYA 3PRJA 4MRTC 1PPJD 4K35A 1HGVA 1OFCX 1SFCC 2YO2A 1BGYD 3BRVB 1NTME 2KNCB 5DJTB 1NTZJ 1FR2A 1NJIQ 3RK2B 1VQ8P 4N3YB 3L70E 5AW5B 3R4YA 2LL8A 2GUSA 4C7NA 3PTZA 1PIXA 2Q1KA 2W6JH 2JR8A 2XV6A 1VF5C 3H1IJ 1EQ7A 1SQPK 2A06E 3V4WA 3S9OA 2FXOA 1SQBG 2KGAA 3GHGC 2KWLA 3DS1A 1S5LH 3D71A 2KZJA 2XNXA 3CWBG 2AXTH 4WYMA 1MV8A 5AVTB 1T3JA 2E75D 3BASA 5C39A 2HFED 1FZCC 4NPDA 2O3JA 1NYHA 2WPTA 1ZRTE 5BS2A 3JSVC 4IPYA 3JCUE 3L71D 4QMAA 2M8LA 2E5TA 2KOOA 2N1TC 2WSCJ 3HD7D 2AXCA 4H0LB 1QX8A 1ZP0C 3TF5A 3Q5RA 2PENA 3B4QA 2M3BA 2N1TA 5CCHD 1PEUA 5APYA 1NU1E 1AVOA 2MF4A 3AEBC 1EDKA 2AFEA 4R0MA 2YKPA 1NU1J 5AVUB 3Q20A 2ERHA 4BWNA 2QNWA 2SPZA 1M1KQ 1S1CX 3L74E 2C0XA 1RF1B 1BE3J 4XFJA 2L6EA 3MD0A 1HJBA 1U7JA 2JDIH 1M1JC 2ZJSE 1J1DC 2E74B 3QWOC 2QM8A 2D2CD 3HD7A 5AVYB 3VMAA 1SQPJ 2PEJA 2P9XA 4WY4D 3W68A 1AYIA 4EDFA 1CI6A 4IL6E 1S3JA 5AW0B 4WB4A 2R5BA 2XZ0D 3U43A 1T8ZA 1EDJA 1EZVG 4F37A 1KQSO 1XTGB 2E74C 2KLUA 2POHA 2HR3A 3CPWO 1ZN5A 4YPCA 5KP6B 3HE5B 2Q3IA 3M0DC 1M8OB 3KZIH 3AE7C 4N78E 2KS1A 4DCKA 3CD6P 2QVAA 2XKMA 3C9IA 2MD9A 2BASA 2GZEA 2ZVOB 3HZQA 2E43A 4U0FA 1OIPA 2E76D 2LKIA 3R2PA 2WQYC 1LTBC 2VLPA 2BUOA 2KR5A 2VLQA 3CCVP 4C7NB 2Z4EA 1EC5A 1LGHB 1SVFA 2QJYC 2YXRB 1X3OA 1AV1A 5KLVE 2OYHB 4I1LA 3I5CA 2BCCJ 4AYCA 3H1KJ 2QSIA 2R44A 2KGDA 3GZMA 3HE5A 1GXHA 1M56D 1L0LE 1L4AC 1L0NK 5KLVD 4I6MC 3TYYA 3CWBJ 1X9VA 1N2DC 3Q1MA 4H44B 1JTHA 1LT9C 1YYCA 3B5NA 2NRGA 1T2KC 4IL6H 1USEA 1IC2A 4ZKPA 2FFDC 3L70G 3WUUA 1DX7A 1VQLP 1GL2B 2WSEJ 2Z46A 2K0YA 2ZYGA 2VLNA 2FYNB 1DEBA 2Y0EA 2QJYB 3CX5I 3H47A 1NWQA 3H1JE 4D6TJ 2LMLA 2WPQA 2B87A 1M57D 4W7ZA 1HVVA 1NTKE 2YKOA 1RE4A 4Y99C 3V2QA 1FZCB 4H2WC 2P2UA 1JO5A 2LKMA 3GZLA 2UWJE 1MUUA 2Z5HA 1KYOH 2PAJA 1K30A 3GW6A 1DIPA 3IAOA 2XU6A 3KPEA 5CJ0A 5BS1A 3CLQA 1NHLA 1VQ5P 1USDA 4ASWA 3USSA 1ZRTD 1SQXJ 2MY5A 2MR7A 5CMZA 4N6JA 1LT1A 3GF3A 1NAYA 3H1HD 3BRTB 1EXJA 3HYBA 1VQ4P 4IFMA 3B5ND 3D6ZA 2FXMA 3H1LG 2NPSC 1GW4A 2ZFCA 1BSHA 3VRLC 5AVZB 3FGAD 4BXLA 2FVEA 1FDOA 1LNQA 2E5YA 2MVUA 1RE3A 2GZFA 2EIAA 2JQ4A 1IMPA 1VQPP 1SQQE 4U3FE 2BHVA 5AW8B 1ZXGA 2ZVNB 1KYOD 3M0AA 2LXBA 1IK9A 1KYOI 2W90A 2KLVA 5KLIB 1WT6A 1ZR4A 2OYIB 2O01H 1K04A 4HB1A 2CQ8A 4PD4I 1VPCA 2FHSC 2J58A 5KTBA 1BGYJ 4BPHA 3RK3B 2WSEH 2HPCA 3T97A 3H1IE 3AE6C 4H44C 2D2CC 3P05A 5APVA 1XTCC 1NTZK 1S5LX 4XA4A 3H32A 2FKWB 1LTGC 2KZIA 4IFDK 2NZ2A 1UJZA 1DNYA 4LLHA 3H1JJ 2KORA 4BRYB 1CZQA 1Y47A 1A02F 3DS2A 1VQ7P 4KJMA 1K05A 5KLVK 4OGQB 1Q81Q 3AEAC 1RF0A 2NO8A 2VRSA 2XV5A 2NPSD 1VQOP 3CXCO 3CMEP 4JYCA 1L0LK 2JO1A 2ZAEB 4RJTA 1CW5A 1Q82Q 2A45H 2JAZA 3NXSA 3M9BA 1SQQG 5AVWB 1KLPA 3U1AA 4Y28J 5B5EE 3G71P 2FY8A 2M3EA 3N4XA 2JP3A 1JUNA 2A45G 1RE4C 3DS3A 2KW2A 2H89C 3A0HH 1L0NJ 3EJEA 1Q2NA 3RGUA 1GW3A 2G3AA 4ASVA 2RKLA 1YTZT 3SWYA 1GU5A 5CBOA 1LWUB 5I4TG 2ZT9B 1RF1A 4L73A 5APWA 2WPVB 1KORA 1N7SB 2PRRA 2OTLP 1BXIA 2AXTE 1HUCA 3RK3D 5DCKA 3H1KE 1QVGO 3WBHA 2ONTA 2YXQB 1BDDA 2KP8A 1HWTC 1S9KD 5BVZA 3V4QA 5KJ7C 3H1HG 1FDIA 2IYPA 4GT1A 1PFIA 5K5GB 4U0AA 2L22A 4OVNF 1HJ0A 1U57A 1VKUA 1GMJA 2H8PD 3H32B 1NTMG 2OTKE 3RL0g 3G6EP 1GK4A 1SQVE 1PZQA 5AW3B 3M9HA 3RL0C 4W7YA 3L4FA 1GL2A 1Q86Q 3M06A 5APUA 1S4XA 1NTKD 3L74G 2Y0DA 2YMKA 1X79B 1FE6A 4HKZH 3H1HE 1M90Q 1PEMA 2MVVA 1FBMA 2OYOA 3L36A 4XFZA 2R3CA 4HH2A 3G28A 5F2NA 1RY3A 1L4AB 4UB8E 3L73E 4OH8B 3M0DA 4WY4B 1OW8A 2FFDB 3OAKA 2GZIA 1PEQA 1X0TA 3GHGB 4CA3A 1VQKP 1JCCA 4LC1A 3NFQA 3II6A 2BEQD 5F2OA 3CCEP 1BE3E 3Q5SA 3E1IA 1SFCB 3CXHH 2EFJA 4DG9A 1Y9BA 3U1CA 2LIWA 3FX0A 1NOHA 2KIKA 1J1EC 2LOLA 3L70D 2WSCH 1KZUB 4C7RA 3U59A 4A7PA 2FYUJ 3P32A 2CPSA 3HTKB 3L72G 1QL1A 4XROA 5KLIC 1M1JA 3L73G 1JCDA 5M1BA 1J2JB 2GA1A 4U7JA 2WTYA 3KYQA 2E1MA 3G3ZA 2LXCB 2FBWC 2N1TD 3VP9A 2GZJA 4D6TD 2K9JA 1YJ9P 1BE3G 4ZMDA 2N5HA 3AEFC 2A06G 1G1JA 1QEXA 2IBZG 2IFNA 2BEZF 3V6IA 1AUMA 1L2PA 3HE4A 2HODA 5CCGA 2C0WA 1NQ4A 3G26A 4JYBA 3I56P 4XRQA 3ITKA 3IR9A 4U3FJ 2J59M 2EHSA 3CXHD 1P84D 2IDBA 1KD1Q 1EMVA 1BGYE 1LTJC 3TGUD 1KC8Q 4GIFA 2C9LY 2BCCD 5KP7B 2AEFA 1RQUA 1JY3O 2RN0A 1NH4A 1GD2E 1FOSF 3QH9A 2QE7H 2FYNC 2HPCB 5HGNA 2YO3A 2OQQA 3RBXA 2M5AA 2Q6QA 3Q2YA 1YI2P 3RBZA 3HUSA 1EDLA 3MZWB 3GHGA 1Y8AA 1HY8A 5E79H 1MZ8A 2M8RA 2DW3A 5H2FE 4H2XC 2YIUC 4DT0A 3L75J 1IZNB 1FOSE 3K5BA 2ZYAA 1BCCJ 1VF5B 3KZIE 3LMOA 3H1JD 2PEIA 1MZ9A 1SQXK 1KFNA 4MN4C 1VQ9P 1EOQA 1H0TB 4ZNCA 4RESB 3C1LA 3TNUA 3IFMA 3Q5PA 3BATA 1HQBA 5KJ7A 4U3FD 2R32A 1NKNA 3V2NA 5KAFE 1IO4A 2KYVA 1LTSC 3CCJP 2GZGA 3H1LE 2O01J 1W2BO 1S9KE 1NTZE 1L0NE 1PGJA 1FU1A 1NTMJ 2MJZA 2JO0A 4GR2A 2PY8A 1RQVA 3MIWA 3CCSP 4Z1MH 3HE4B 1M6NA 2WPSA 2XNDH 1MFTA 1NU1D 2FYUG 1NU1K 3G21A 1PP9D 1LWUC 4U0BA 4PH0A 4PJ0E 4HKGA 1NTZD 5CZDB 1KB9E 3BCCG 3AE5C 2KGCA 4U0DA 2K3RA 1H89A 3H1LD 3EQ2A 2L91A 5CCGC 1KN7A 2V7QJ 1KB9I 1FZEA 3CC4P 1IFDA 3RG2A 1OW6A 4M3LA 3MUDC 3TGUJ 2I1KA 4DOJA 1M1JB 2M5AB 2AF8A 1FS0E 1IK7A 3L71G 4BPGA 2QEXP 1ZOYC 1L0LJ 3GMAA 1RF0C 3S1KA 4NEOA 1H88A 1YJWP 1FZGA 4TT3H 1YQ4C 3D6YA 2E42A 1YJNP 2M8PA 3RL0B 2LPKA 5KLVJ 5HGOA 2YIUB 3CWBD 1DV5A 4I7ZC 3AE2C 3HD7C 3RK2D 2KG6A 5H2FH 4PV1C 2CPBA 1IFNA 2JWAA 1JNMA 1L0HA 4NPFX 3W67A 3CE7A 1RNIA 2L9FA 3BCCD 4QNBA 1NO4A 2KG9A 3KHUA 2JU2A 1R5LA 4GR6A 2WSFJ 2VSQA 1N73B 3O8ZA 1OVVA 1OMIA 4DZOA 1HH0A 5APSA 1JOCA 2ITAA 5HGLA 1N73A 1EZVD 5AVVB 1P84I 2WSSH 3MGNA 1GL2C 2HLOA 3GF7A 2DNWA 2XT1A 1FZBA 2FXPA 2QIWA 3WU2E 2JYGA 1JMMA 3HRNA 2BCCG 3H1HJ 2GDXA 1SQVG 1OXZA 1FZCA 3SFEC 1HBWA 2PEKA 1SP4A 3MHVA 3E2DA 2FVAA 3SSUA 3A0HE 4KT0J 4AUWA 1AF8A 1KILA 1SQXD 3KQGA 4RO0A 1LTAC 2XZRA 2FYZA 4O9BA 1LWUA 1JY2P 2I1JA 2LR2A 4PV1B 1YQ3C 3CX5E 2IBZI 4XFYA 3GJNA 1URQC 1BSNA 1SQVD 1EIAA 2I8DA 1OR5A 2FYUE 1AQ5A 4TLFA 4YTPC 3I55P 2WT7A 4H13C 2KNCA 1L4AD 1K9MQ 3VMXA 1OX3A 3CL3D 1OWAA 3M9QA 3DS0A 2C9NY 3WUVA 2D2CB 3NMDA 3V5BA 1X22A 4H2YC 2GDYA 3L37A 1YBKA 1OW7A 3KXDA 1ZR2A 4H13B 2ZXXA 3FWLA 1PGOA 3VMYA 2K9JB 2YNYA 3VTPC 2FADA 3PJSK 1PPJE 2M8NA 4PXHB 1W5CE 5AW2B 2IBZD 1URQB 1ZW0A 3L72E 3H1KG 2WVRA 5HGMA 3L74J 2VLOA 1SQVJ 4OWFA 2AFDA 2QA4P 1VF5D 2KOSA 1NAFA 2IYOA 1E5WA 2P7JA 3AEDC 2FYUD 3WMM0 3H0DA 2QG4A 1L4AA 3P7KA 5AW6B 4Y99B 1NTKG 4JPZB 1N7SD 1D7MA 2WITA 4B86A 4NPEA 2P67A 3B5NB 2MKVA 2W27A 1IMQA 1LTJA 1FC2C 1RHZB 4COPA 1IUQA 4GODA 3OW2O 4IL6X 3CCLP 4M0IA 1PEOA 4YXWH 3JCUH 1YITP 5AVQB 2FQ1A 4UHPB 2Q3EA 1JM0A 2JJLA 1GXGA 2L4BA 3BCCE 3RK2C 1L0IA 1SQBD 1ZV8A 1QLED 4HYTB 1N8RQ 5HV8A 1NU1G 2JKVA 3L73J 3AEGC 3H1JG 3PH0A 1FZFA 5HVCA 1LT9B 1PP9G 4YXDC 2B9BA 3IF4A 5AVRB 1R8EA 1LJ2A 2PNGA 4C46A 1PV3A 4QKOA 3CCMP 2E76C 1DEEG 5KKZB 4PWVB 1P84E 2PEMA 4WY4A 1JY2N 1GL2D 1OVUA 2N9YB 3PLNA 5TISH 4L76A 1IJDB 1YTZI 1SQQJ 3TSIA 2FACA 3P8CD 3A3YB 1NVOA 2KG8A 4OGQC 3SWKA 4GDOA 1BGYG 2KXPB 1EXIA 1L0LG 1DD3A 1PPJG 2XXMA 1VQNP 5AW7B 2LTEA 3E7KA 1S2EA 1SQQD 2AVAA 1NTZG 2V4HA 3NY7B 1UNKA 4WY4C 4U0EA 3A5TA 1ACPA 1D1DA 5EFWB 2W6AA 1NTMK 3CCQP 3HUSB 2JGPA 3B4SA 2A45I 2E74D 3AE4C 1UIXA 3CC7P 3D70A 2IPPA 3VYIA 1J1EB 2Y9ZA 2R5DA 1HGZA 5B66E 3RL0D 1GK6A 2N1TB 1KYOE 2V7QH 3S4RA 4EIJA 3FWNA 1ZMBA 1AQTA 1PP9J 2R3SA 1PGQA 2MR8A 2IZ0A 1P84H 3A2AA 3H1ID 3EWKA 2E75C 4GOFA 3L75G 3CX5D 1OVRA 2N50A 3FXDA 1JY2O 2JWDA 2WPRA 1GDTA 2OYHC 5KAFH 1RO0A 3JC22 5APTA 1TU3F 1JY3P 2P58A 2AEJA 5AVXB 2Z44A 1E79H 3HTKA 3M1MA 3TK1A 1GU4A 3FXEA 1G2CB 3A0BH 2KGEA 2K94A 4CPGA 1T2KD 5CCHC 1SLQA 4PD4D 5AVSB 2K93A 2BCCE 1WMKA 2K5XA 1L0NG 2K0XA 2Q5UA 3V2PA 2DGYA 3B71A 1KV4A 1G1IA 2YKQA 3HD7B 4PD4E 4L75A 2HYNA 4I7ZB 3KDPB 3H25A 2K92A 2KI7B 2K37A 1E0HA 1L0ND 1YHQP 2QJKB 3G0VA 1SQVK 3G1IA 1H0TA 3G4SP 1EZVI 1MKMA 1URQA 5APQA 1KILC 5DJUB 1LP1A 3L73D 3L74D 1U7MA 5BU8B 5AW9B 4OGQD 2OARA 4PV1D 1JTHB 1IFMA 1SQBJ 4N78D 3AE3C 1QVFO 3CCRP 4DJGA 1WRGA 4BRYA 3DS4A 2PEOA 1NTMD 2QJPC 5B66H 5APXA 3Q3DA 1GZLA 2N9BA 1GTWA 1AFOA 2B88A 1JY3N 2O01N 3LIDA 2M5RA 2RMZA 1SQXE 3L35A 4EOTA 1FJKA 2YMYA 2PFXA 2LIUA 1NKZB 2Z5IA 2B87B 2QJPB 1N73C 3G9RA 2OGUA 2OTJP 2L5GB 4XFXA 1VQ6P 5KAIH 2N6YA 3V2RA 3DS5A 1KB9D 2FQ0A 3G1GA 2BQ1E 3OJAB 3MGEA 4IFFA 1PL5A 1FJPA 1KILB 1R5SA 4EYYQ 4PJ0H 1VDFA 3CXHE 2CNRA 2GYKA 2ZYDA 1LTTC 1M7LA 2NPSA 3L71J 3MTUE 2IZ1A 2K2QA 3E1RA 4IZ6A 3O6QB 3AE8C 4U3FG 1T8KA 1JJ2O 1G2CA 2J5UA 4WBAA 2GM4A 1KTMA
chains in the Genus database with same CATH topology
1RNIA 5F2KA 1VQ5P 1K9MQ 2BUOA 1YIJP 3DS2A 3CCVP 1W2BO 1AUMA 1VQ7P 3DS0A 4QNBA 3CCUP 2OARA 3G6EP 3RG6C 1Q81Q 3CMAP 3HYBA 1QVFO 2PENA 1VQ4P 4GR6A 2JO0A 4PH1A 4GR2A 2PY8A 3CCRP 3G26A 1VQOP 3CCSP 1Q86Q 3CCMP 2LF4A 3CXCO 3I56P 1PEUA 3CMEP 4XRQA 3DS4A 1M6NA 3B5IA 2PEMA 2PEOA 1KD1Q 1Q82Q 1NJIQ 3G21A 4U0CA 5HGLA 3VRLC 1KC8Q 3NTEA 3Q20A 2M8NA 4U0BA 1VQ8P 4PH0A 1M90Q 1PEMA 3LRYA 1M1KQ 4XFZA 1Q7YQ 3G71P 1RO0A 4U0DA 3G28A 5F2NA 2XT1A 5HGMA 2EIAA 2L6EA 5HGNA 2Z44A 2JYGA 3M1MA 3DS3A 1VQPP 3CC4P 3H4EA 2QA4P 2CWOA 2XXMA 1VQNP 1PEQA 2BHVA 1RO2A 2XV6A 1VQKP 1YI2P 2OTJP 1VQLP 5F2OA 2PEKA 4XFXA 4U0EA 3CCEP 1VQ6P 2JYLA 2PEJA 2Z46A 1E6JP 3E2DA 2EFJA 3H0DA 2P9XA 1D1DA 1BAJA 1VQMP 3DS5A 3G29A 5I4TG 3H47A 1S72P 3CCQP 3G1GA 2BQ1E 2QEXP 3MGEA 3DS1A 1KQSO 3CC7P 1M74A 1IUQA 2DGYA 4COPA 3CC2P 4COCA 4XFYA 3CPWO 3OW2O 1YJWP 2OTLP 2PEIA 4WYMA 4XROA 3CCLP 5DCKA 1YJNP 2M8PA 4M0IA 1QVGO 3WBHA 5HGOA 1EIAA 2ONTA 1VQ9P 1PEOA 3P05A 1EOQA 2E1MA 1YHQP 1M6EX 1YITP 1JJ2O 5JPAA 2KODA 1A43A 3CD6P 3G0VA 3I55P 1QRJA 3DPHA 5BS2A 1K30A 4IPYA 3DTJA 1ZMBA 3G1IA 1YJ9P 1K73Q 4U0AA 3HZQA 4U0FA 1A8OA 2PEQA 1K8AQ 2M8LA 3G4SP 3CCJP 2EG5A 1N8RQ 2Z45A 5BS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW O;  3OW2 O;  1YI2 P;  1YJW P;  2OTL P;  1KC8 Q;  1K9M Q;  1VQ5 P;  2OTJ P;  1YIJ P;  3CCL P;  1VQL P;  1VQ8 P;  3CCV P;  1YJN P;  3CCE P;  1W2B O;  1M90 Q;  1QVG O;  1VQ7 P;  1VQ6 P;  3CCU P;  1M1K Q;  3G6E P;  1VQM P;  1VQ9 P;  1Q7Y Q;  3G71 P;  1Q81 Q;  3CMA P;  1QVF O;  1YHQ P;  1YIT P;  1JJ2 O;  1VQ4 P;  1S72 P;  3CCQ P;  3CD6 P;  3CCR P;  2QEX P;  1VQO P;  3I55 P;  3CCS P;  1Q86 Q;  3CCM P;  3CXC O;  3I56 P;  3CME P;  1K73 Q;  1YJ9 P;  1VQP P;  3CC4 P;  2QA4 P;  1KQS O;  1K8A Q;  3CC7 P;  1VQN P;  1KD1 Q;  3G4S P;  3CCJ P;  1N8R Q;  1Q82 Q;  1NJI Q;  1VQK P;  3CC2 P; 
#chains in the Genus database with same CATH topology
 1JEK A;  5KKZ C;  3AE1 C;  4D6T E;  2CG5 B;  3P8M C;  1SQB K;  1RH5 B;  3MP7 B;  1SFC D;  3GG2 A;  3MUD A;  1KMI Z;  3CWB E;  5KJ7 D;  3CMA P;  1EZV E;  1KIL E;  2WWW A;  3TNU B;  4PH1 A;  3WU2 H;  4XE5 B;  3RK3 E;  2FQ2 A;  2FAE A;  1T6A A;  1LTI C;  1NTK K;  2CK3 H;  1Z6M A;  1EDI A;  5GTI H;  2H88 C;  2W6B A;  2JBG A;  1IFI A;  3NTE A;  2WZ7 A;  5CJ4 A;  1UII A;  1VL2 A;  3EFF K;  7CEI A;  4WVZ A;  1Q7Y Q;  3AEC C;  1SFC A;  1ZME C;  3BCC J;  2P10 A;  4H0L C;  2G8Y A;  1KQL A;  1Z56 A;  1ZNV A;  1N7S A;  4KHX A;  3H4E A;  3H1I G;  3EFG A;  1RO2 A;  1KQF B;  1RF1 C;  2FFD A;  2Y0C A;  5BU5 A;  3TGU G;  2K9Y A;  1VQM P;  2HG5 D;  2M0B A;  3L72 J;  5AW1 B;  4L74 A;  5GTI E;  5AW4 B;  3LIE A;  1BCC E;  1N86 A;  5CBN A;  1LT9 A;  2EHT A;  1PGP A;  2W83 C;  2K1A A;  1L0L D;  4R4M A;  2PP6 A;  3B8E B;  3IN6 A;  4HJG H;  3VP8 A;  1M74 A;  1AA0 A;  4COC A;  1HTL C;  2KS1 B;  5CCH A;  2A06 D;  2E75 B;  2Q7C A;  1FZA A;  2OYI C;  3F5H A;  1CSB A;  1BE3 D;  1BDC A;  3PP5 A;  1SQQ K;  1A43 A;  4BPF A;  2HOD B;  1K73 Q;  4H0L D;  3RK3 C;  1K8A Q;  1HF9 A;  3L71 E;  3M91 A;  2OYI A;  5F2K A;  3H1L J;  2O1J A;  1CI6 B;  3L72 D;  2OYH A;  1Q90 D;  3HUS C;  3CCU P;  4UB6 H;  2ZT9 D;  2N6Z A;  3VOP A;  1FAV A;  5EW5 E;  3H1K D;  1SQP E;  4I2L C;  2LF4 A;  2K0D X;  3GKL C;  2KOG A;  1T3U A;  3SFD C;  4UB6 E;  4EI2 A;  2IX7 C;  3L70 J;  3N7N A;  2PGD A;  3BVH A;  1CEI A;  4WWI A;  3F89 A;  3LW5 J;  3AEE C;  5EJD A;  3EJB A;  1N7S C;  3VN0 A;  2FYU K;  3A7O A;  4JF7 A;  3O6Q A;  4H44 D;  5KLV G;  2N98 A;  2ZT9 C;  3A0B E;  3GLM A;  4JQ0 D;  2KOQ A;  4ZKU A;  2JYL A;  5GTH H;  2X2B A;  2JB0 A;  3P8C E;  4JBZ A;  3G29 A;  4W80 A;  1S72 P;  5TJH A;  4UB8 H;  1PP9 E;  3UIA A;  3SWF A;  5E79 E;  2GDW A;  1ZLL A;  2KSE A;  2QRX A;  4R4L A;  1RE3 C;  2FVF A;  1SQP D;  2XZ1 C;  2XDJ A;  5CHX A;  1AJY A;  5L8R J;  1M6E X;  1H8A A;  4GKG A;  1QL2 A;  2KOD A;  2WSF H;  2O1K A;  1OZH A;  1DH3 A;  2EG5 A;  1MFZ A;  3WUT A;  3T97 B;  3C8V A;  2W8Z A;  1QGK B;  4IOI H;  4GOE A;  1IFJ A;  4PD4 H;  1F80 D;  3H6P A;  2AEM A;  3RG6 C;  3CXH I;  2JU1 A;  3TGU E;  3ABV C;  2ZXE B;  2WMM A;  4AQR D;  3B5I A;  1KFM A;  2Y9Y A;  2E76 B;  5GTH E;  3TDK A;  4U0C A;  3CI9 A;  1FDM A;  3LRY A;  2KSJ A;  2KOP A;  1BCC D;  2KB7 P;  3VMZ A;  4LGD E;  2Q9I A;  3L75 D;  1JB0 J;  1LTJ B;  2CWO A;  1SQB E;  2RH0 A;  2KUB A;  2H7H A;  3ZDM A;  1SS1 A;  2WT7 B;  3PHL A;  2CGQ A;  2P1J A;  1X8Y A;  2H43 A;  1E6J P;  2QM7 A;  1GPJ A;  1BAJ A;  2IBZ E;  1N7L A;  3AE9 C;  1NGM B;  4D6T G;  1NTK J;  3EJD A;  1KQG B;  5KP8 B;  5B5E H;  1DD4 A;  1KB9 H;  3LW5 H;  5TIS E;  2ROQ A;  3CC2 P;  3B5N C;  5KAI E;  2B89 A;  4K3A A;  1A02 J;  3CX5 H;  5CCG D;  2N5I A;  1KIL D;  1URQ D;  2IFM A;  5JPA A;  1QRJ A;  3DPH A;  2KK7 A;  1JMB A;  3DTJ A;  1A8O A;  1VHN A;  2PEQ A;  2GUV A;  2JEE A;  4H13 D;  3OA7 A;  2Z45 A;  1SQP G;  2QJK C;  1SQX G;  1J1D B;  3L75 E;  2NPS B;  2L0Q A;  1YIJ P;  1BCC G;  1W2E A;  4RKU J;  1IFP A;  2K88 A;  1LP1 B;  3NTN A;  1S5L E;  1AVY A;  3PRJ A;  4MRT C;  1PPJ D;  4K35 A;  1HGV A;  1OFC X;  1SFC C;  2YO2 A;  1BGY D;  3BRV B;  1NTM E;  2KNC B;  5DJT B;  1NTZ J;  1FR2 A;  1NJI Q;  3RK2 B;  1VQ8 P;  4N3Y B;  3L70 E;  5AW5 B;  3R4Y A;  2LL8 A;  2GUS A;  4C7N A;  3PTZ A;  1PIX A;  2Q1K A;  2W6J H;  2JR8 A;  2XV6 A;  1VF5 C;  3H1I J;  1EQ7 A;  1SQP K;  2A06 E;  3V4W A;  3S9O A;  2FXO A;  1SQB G;  2KGA A;  3GHG C;  2KWL A;  3DS1 A;  1S5L H;  3D71 A;  2KZJ A;  2XNX A;  3CWB G;  2AXT H;  4WYM A;  1MV8 A;  5AVT B;  1T3J A;  2E75 D;  3BAS A;  5C39 A;  2HFE D;  1FZC C;  4NPD A;  2O3J A;  1NYH A;  2WPT A;  1ZRT E;  5BS2 A;  3JSV C;  4IPY A;  3JCU E;  3L71 D;  4QMA A;  2M8L A;  2E5T A;  2KOO A;  2N1T C;  2WSC J;  3HD7 D;  2AXC A;  4H0L B;  1QX8 A;  1ZP0 C;  3TF5 A;  3Q5R A;  2PEN A;  3B4Q A;  2M3B A;  2N1T A;  5CCH D;  1PEU A;  5APY A;  1NU1 E;  1AVO A;  2MF4 A;  3AEB C;  1EDK A;  2AFE A;  4R0M A;  2YKP A;  1NU1 J;  5AVU B;  3Q20 A;  2ERH A;  4BWN A;  2QNW A;  2SPZ A;  1M1K Q;  1S1C X;  3L74 E;  2C0X A;  1RF1 B;  1BE3 J;  4XFJ A;  2L6E A;  3MD0 A;  1HJB A;  1U7J A;  2JDI H;  1M1J C;  2ZJS E;  1J1D C;  2E74 B;  3QWO C;  2QM8 A;  2D2C D;  3HD7 A;  5AVY B;  3VMA A;  1SQP J;  2PEJ A;  2P9X A;  4WY4 D;  3W68 A;  1AYI A;  4EDF A;  1CI6 A;  4IL6 E;  1S3J A;  5AW0 B;  4WB4 A;  2R5B A;  2XZ0 D;  3U43 A;  1T8Z A;  1EDJ A;  1EZV G;  4F37 A;  1KQS O;  1XTG B;  2E74 C;  2KLU A;  2POH A;  2HR3 A;  3CPW O;  1ZN5 A;  4YPC A;  5KP6 B;  3HE5 B;  2Q3I A;  3M0D C;  1M8O B;  3KZI H;  3AE7 C;  4N78 E;  2KS1 A;  4DCK A;  3CD6 P;  2QVA A;  2XKM A;  3C9I A;  2MD9 A;  2BAS A;  2GZE A;  2ZVO B;  3HZQ A;  2E43 A;  4U0F A;  1OIP A;  2E76 D;  2LKI A;  3R2P A;  2WQY C;  1LTB C;  2VLP A;  2BUO A;  2KR5 A;  2VLQ A;  3CCV P;  4C7N B;  2Z4E A;  1EC5 A;  1LGH B;  1SVF A;  2QJY C;  2YXR B;  1X3O A;  1AV1 A;  5KLV E;  2OYH B;  4I1L A;  3I5C A;  2BCC J;  4AYC A;  3H1K J;  2QSI A;  2R44 A;  2KGD A;  3GZM A;  3HE5 A;  1GXH A;  1M56 D;  1L0L E;  1L4A C;  1L0N K;  5KLV D;  4I6M C;  3TYY A;  3CWB J;  1X9V A;  1N2D C;  3Q1M A;  4H44 B;  1JTH A;  1LT9 C;  1YYC A;  3B5N A;  2NRG A;  1T2K C;  4IL6 H;  1USE A;  1IC2 A;  4ZKP A;  2FFD C;  3L70 G;  3WUU A;  1DX7 A;  1VQL P;  1GL2 B;  2WSE J;  2Z46 A;  2K0Y A;  2ZYG A;  2VLN A;  2FYN B;  1DEB A;  2Y0E A;  2QJY B;  3CX5 I;  3H47 A;  1NWQ A;  3H1J E;  4D6T J;  2LML A;  2WPQ A;  2B87 A;  1M57 D;  4W7Z A;  1HVV A;  1NTK E;  2YKO A;  1RE4 A;  4Y99 C;  3V2Q A;  1FZC B;  4H2W C;  2P2U A;  1JO5 A;  2LKM A;  3GZL A;  2UWJ E;  1MUU A;  2Z5H A;  1KYO H;  2PAJ A;  1K30 A;  3GW6 A;  1DIP A;  3IAO A;  2XU6 A;  3KPE A;  5CJ0 A;  5BS1 A;  3CLQ A;  1NHL A;  1VQ5 P;  1USD A;  4ASW A;  3USS A;  1ZRT D;  1SQX J;  2MY5 A;  2MR7 A;  5CMZ A;  4N6J A;  1LT1 A;  3GF3 A;  1NAY A;  3H1H D;  3BRT B;  1EXJ A;  3HYB A;  1VQ4 P;  4IFM A;  3B5N D;  3D6Z A;  2FXM A;  3H1L G;  2NPS C;  1GW4 A;  2ZFC A;  1BSH A;  3VRL C;  5AVZ B;  3FGA D;  4BXL A;  2FVE A;  1FDO A;  1LNQ A;  2E5Y A;  2MVU A;  1RE3 A;  2GZF A;  2EIA A;  2JQ4 A;  1IMP A;  1VQP P;  1SQQ E;  4U3F E;  2BHV A;  5AW8 B;  1ZXG A;  2ZVN B;  1KYO D;  3M0A A;  2LXB A;  1IK9 A;  1KYO I;  2W90 A;  2KLV A;  5KLI B;  1WT6 A;  1ZR4 A;  2OYI B;  2O01 H;  1K04 A;  4HB1 A;  2CQ8 A;  4PD4 I;  1VPC A;  2FHS C;  2J58 A;  5KTB A;  1BGY J;  4BPH A;  3RK3 B;  2WSE H;  2HPC A;  3T97 A;  3H1I E;  3AE6 C;  4H44 C;  2D2C C;  3P05 A;  5APV A;  1XTC C;  1NTZ K;  1S5L X;  4XA4 A;  3H32 A;  2FKW B;  1LTG C;  2KZI A;  4IFD K;  2NZ2 A;  1UJZ A;  1DNY A;  4LLH A;  3H1J J;  2KOR A;  4BRY B;  1CZQ A;  1Y47 A;  1A02 F;  3DS2 A;  1VQ7 P;  4KJM A;  1K05 A;  5KLV K;  4OGQ B;  1Q81 Q;  3AEA C;  1RF0 A;  2NO8 A;  2VRS A;  2XV5 A;  2NPS D;  1VQO P;  3CXC O;  3CME P;  4JYC A;  1L0L K;  2JO1 A;  2ZAE B;  4RJT A;  1CW5 A;  1Q82 Q;  2A45 H;  2JAZ A;  3NXS A;  3M9B A;  1SQQ G;  5AVW B;  1KLP A;  3U1A A;  4Y28 J;  5B5E E;  3G71 P;  2FY8 A;  2M3E A;  3N4X A;  2JP3 A;  1JUN A;  2A45 G;  1RE4 C;  3DS3 A;  2KW2 A;  2H89 C;  3A0H H;  1L0N J;  3EJE A;  1Q2N A;  3RGU A;  1GW3 A;  2G3A A;  4ASV A;  2RKL A;  1YTZ T;  3SWY A;  1GU5 A;  5CBO A;  1LWU B;  5I4T G;  2ZT9 B;  1RF1 A;  4L73 A;  5APW A;  2WPV B;  1KOR A;  1N7S B;  2PRR A;  2OTL P;  1BXI A;  2AXT E;  1HUC A;  3RK3 D;  5DCK A;  3H1K E;  1QVG O;  3WBH A;  2ONT A;  2YXQ B;  1BDD A;  2KP8 A;  1HWT C;  1S9K D;  5BVZ A;  3V4Q A;  5KJ7 C;  3H1H G;  1FDI A;  2IYP A;  4GT1 A;  1PFI A;  5K5G B;  4U0A A;  2L22 A;  4OVN F;  1HJ0 A;  1U57 A;  1VKU A;  1GMJ A;  2H8P D;  3H32 B;  1NTM G;  2OTK E;  3RL0 g;  3G6E P;  1GK4 A;  1SQV E;  1PZQ A;  5AW3 B;  3M9H A;  3RL0 C;  4W7Y A;  3L4F A;  1GL2 A;  1Q86 Q;  3M06 A;  5APU A;  1S4X A;  1NTK D;  3L74 G;  2Y0D A;  2YMK A;  1X79 B;  1FE6 A;  4HKZ H;  3H1H E;  1M90 Q;  1PEM A;  2MVV A;  1FBM A;  2OYO A;  3L36 A;  4XFZ A;  2R3C A;  4HH2 A;  3G28 A;  5F2N A;  1RY3 A;  1L4A B;  4UB8 E;  3L73 E;  4OH8 B;  3M0D A;  4WY4 B;  1OW8 A;  2FFD B;  3OAK A;  2GZI A;  1PEQ A;  1X0T A;  3GHG B;  4CA3 A;  1VQK P;  1JCC A;  4LC1 A;  3NFQ A;  3II6 A;  2BEQ D;  5F2O A;  3CCE P;  1BE3 E;  3Q5S A;  3E1I A;  1SFC B;  3CXH H;  2EFJ A;  4DG9 A;  1Y9B A;  3U1C A;  2LIW A;  3FX0 A;  1NOH A;  2KIK A;  1J1E C;  2LOL A;  3L70 D;  2WSC H;  1KZU B;  4C7R A;  3U59 A;  4A7P A;  2FYU J;  3P32 A;  2CPS A;  3HTK B;  3L72 G;  1QL1 A;  4XRO A;  5KLI C;  1M1J A;  3L73 G;  1JCD A;  5M1B A;  1J2J B;  2GA1 A;  4U7J A;  2WTY A;  3KYQ A;  2E1M A;  3G3Z A;  2LXC B;  2FBW C;  2N1T D;  3VP9 A;  2GZJ A;  4D6T D;  2K9J A;  1YJ9 P;  1BE3 G;  4ZMD A;  2N5H A;  3AEF C;  2A06 G;  1G1J A;  1QEX A;  2IBZ G;  2IFN A;  2BEZ F;  3V6I A;  1AUM A;  1L2P A;  3HE4 A;  2HOD A;  5CCG A;  2C0W A;  1NQ4 A;  3G26 A;  4JYB A;  3I56 P;  4XRQ A;  3ITK A;  3IR9 A;  4U3F J;  2J59 M;  2EHS A;  3CXH D;  1P84 D;  2IDB A;  1KD1 Q;  1EMV A;  1BGY E;  1LTJ C;  3TGU D;  1KC8 Q;  4GIF A;  2C9L Y;  2BCC D;  5KP7 B;  2AEF A;  1RQU A;  1JY3 O;  2RN0 A;  1NH4 A;  1GD2 E;  1FOS F;  3QH9 A;  2QE7 H;  2FYN C;  2HPC B;  5HGN A;  2YO3 A;  2OQQ A;  3RBX A;  2M5A A;  2Q6Q A;  3Q2Y A;  1YI2 P;  3RBZ A;  3HUS A;  1EDL A;  3MZW B;  3GHG A;  1Y8A A;  1HY8 A;  5E79 H;  1MZ8 A;  2M8R A;  2DW3 A;  5H2F E;  4H2X C;  2YIU C;  4DT0 A;  3L75 J;  1IZN B;  1FOS E;  3K5B A;  2ZYA A;  1BCC J;  1VF5 B;  3KZI E;  3LMO A;  3H1J D;  2PEI A;  1MZ9 A;  1SQX K;  1KFN A;  4MN4 C;  1VQ9 P;  1EOQ A;  1H0T B;  4ZNC A;  4RES B;  3C1L A;  3TNU A;  3IFM A;  3Q5P A;  3BAT A;  1HQB A;  5KJ7 A;  4U3F D;  2R32 A;  1NKN A;  3V2N A;  5KAF E;  1IO4 A;  2KYV A;  1LTS C;  3CCJ P;  2GZG A;  3H1L E;  2O01 J;  1W2B O;  1S9K E;  1NTZ E;  1L0N E;  1PGJ A;  1FU1 A;  1NTM J;  2MJZ A;  2JO0 A;  4GR2 A;  2PY8 A;  1RQV A;  3MIW A;  3CCS P;  4Z1M H;  3HE4 B;  1M6N A;  2WPS A;  2XND H;  1MFT A;  1NU1 D;  2FYU G;  1NU1 K;  3G21 A;  1PP9 D;  1LWU C;  4U0B A;  4PH0 A;  4PJ0 E;  4HKG A;  1NTZ D;  5CZD B;  1KB9 E;  3BCC G;  3AE5 C;  2KGC A;  4U0D A;  2K3R A;  1H89 A;  3H1L D;  3EQ2 A;  2L91 A;  5CCG C;  1KN7 A;  2V7Q J;  1KB9 I;  1FZE A;  3CC4 P;  1IFD A;  3RG2 A;  1OW6 A;  4M3L A;  3MUD C;  3TGU J;  2I1K A;  4DOJ A;  1M1J B;  2M5A B;  2AF8 A;  1FS0 E;  1IK7 A;  3L71 G;  4BPG A;  2QEX P;  1ZOY C;  1L0L J;  3GMA A;  1RF0 C;  3S1K A;  4NEO A;  1H88 A;  1YJW P;  1FZG A;  4TT3 H;  1YQ4 C;  3D6Y A;  2E42 A;  1YJN P;  2M8P A;  3RL0 B;  2LPK A;  5KLV J;  5HGO A;  2YIU B;  3CWB D;  1DV5 A;  4I7Z C;  3AE2 C;  3HD7 C;  3RK2 D;  2KG6 A;  5H2F H;  4PV1 C;  2CPB A;  1IFN A;  2JWA A;  1JNM A;  1L0H A;  4NPF X;  3W67 A;  3CE7 A;  1RNI A;  2L9F A;  3BCC D;  4QNB A;  1NO4 A;  2KG9 A;  3KHU A;  2JU2 A;  1R5L A;  4GR6 A;  2WSF J;  2VSQ A;  1N73 B;  3O8Z A;  1OVV A;  1OMI A;  4DZO A;  1HH0 A;  5APS A;  1JOC A;  2ITA A;  5HGL A;  1N73 A;  1EZV D;  5AVV B;  1P84 I;  2WSS H;  3MGN A;  1GL2 C;  2HLO A;  3GF7 A;  2DNW A;  2XT1 A;  1FZB A;  2FXP A;  2QIW A;  3WU2 E;  2JYG A;  1JMM A;  3HRN A;  2BCC G;  3H1H J;  2GDX A;  1SQV G;  1OXZ A;  1FZC A;  3SFE C;  1HBW A;  2PEK A;  1SP4 A;  3MHV A;  3E2D A;  2FVA A;  3SSU A;  3A0H E;  4KT0 J;  4AUW A;  1AF8 A;  1KIL A;  1SQX D;  3KQG A;  4RO0 A;  1LTA C;  2XZR A;  2FYZ A;  4O9B A;  1LWU A;  1JY2 P;  2I1J A;  2LR2 A;  4PV1 B;  1YQ3 C;  3CX5 E;  2IBZ I;  4XFY A;  3GJN A;  1URQ C;  1BSN A;  1SQV D;  1EIA A;  2I8D A;  1OR5 A;  2FYU E;  1AQ5 A;  4TLF A;  4YTP C;  3I55 P;  2WT7 A;  4H13 C;  2KNC A;  1L4A D;  1K9M Q;  3VMX A;  1OX3 A;  3CL3 D;  1OWA A;  3M9Q A;  3DS0 A;  2C9N Y;  3WUV A;  2D2C B;  3NMD A;  3V5B A;  1X22 A;  4H2Y C;  2GDY A;  3L37 A;  1YBK A;  1OW7 A;  3KXD A;  1ZR2 A;  4H13 B;  2ZXX A;  3FWL A;  1PGO A;  3VMY A;  2K9J B;  2YNY A;  3VTP C;  2FAD A;  3PJS K;  1PPJ E;  2M8N A;  4PXH B;  1W5C E;  5AW2 B;  2IBZ D;  1URQ B;  1ZW0 A;  3L72 E;  3H1K G;  2WVR A;  5HGM A;  3L74 J;  2VLO A;  1SQV J;  4OWF A;  2AFD A;  2QA4 P;  1VF5 D;  2KOS A;  1NAF A;  2IYO A;  1E5W A;  2P7J A;  3AED C;  2FYU D;  3WMM 0;  3H0D A;  2QG4 A;  1L4A A;  3P7K A;  5AW6 B;  4Y99 B;  1NTK G;  4JPZ B;  1N7S D;  1D7M A;  2WIT A;  4B86 A;  4NPE A;  2P67 A;  3B5N B;  2MKV A;  2W27 A;  1IMQ A;  1LTJ A;  1FC2 C;  1RHZ B;  4COP A;  1IUQ A;  4GOD A;  3OW2 O;  4IL6 X;  3CCL P;  4M0I A;  1PEO A;  4YXW H;  3JCU H;  1YIT P;  5AVQ B;  2FQ1 A;  4UHP B;  2Q3E A;  1JM0 A;  2JJL A;  1GXG A;  2L4B A;  3BCC E;  3RK2 C;  1L0I A;  1SQB D;  1ZV8 A;  1QLE D;  4HYT B;  1N8R Q;  5HV8 A;  1NU1 G;  2JKV A;  3L73 J;  3AEG C;  3H1J G;  3PH0 A;  1FZF A;  5HVC A;  1LT9 B;  1PP9 G;  4YXD C;  2B9B A;  3IF4 A;  5AVR B;  1R8E A;  1LJ2 A;  2PNG A;  4C46 A;  1PV3 A;  4QKO A;  3CCM P;  2E76 C;  1DEE G;  5KKZ B;  4PWV B;  1P84 E;  2PEM A;  4WY4 A;  1JY2 N;  1GL2 D;  1OVU A;  2N9Y B;  3PLN A;  5TIS H;  4L76 A;  1IJD B;  1YTZ I;  1SQQ J;  3TSI A;  2FAC A;  3P8C D;  3A3Y B;  1NVO A;  2KG8 A;  4OGQ C;  3SWK A;  4GDO A;  1BGY G;  2KXP B;  1EXI A;  1L0L G;  1DD3 A;  1PPJ G;  2XXM A;  1VQN P;  5AW7 B;  2LTE A;  3E7K A;  1S2E A;  1SQQ D;  2AVA A;  1NTZ G;  2V4H A;  3NY7 B;  1UNK A;  4WY4 C;  4U0E A;  3A5T A;  1ACP A;  1D1D A;  5EFW B;  2W6A A;  1NTM K;  3CCQ P;  3HUS B;  2JGP A;  3B4S A;  2A45 I;  2E74 D;  3AE4 C;  1UIX A;  3CC7 P;  3D70 A;  2IPP A;  3VYI A;  1J1E B;  2Y9Z A;  2R5D A;  1HGZ A;  5B66 E;  3RL0 D;  1GK6 A;  2N1T B;  1KYO E;  2V7Q H;  3S4R A;  4EIJ A;  3FWN A;  1ZMB A;  1AQT A;  1PP9 J;  2R3S A;  1PGQ A;  2MR8 A;  2IZ0 A;  1P84 H;  3A2A A;  3H1I D;  3EWK A;  2E75 C;  4GOF A;  3L75 G;  3CX5 D;  1OVR A;  2N50 A;  3FXD A;  1JY2 O;  2JWD A;  2WPR A;  1GDT A;  2OYH C;  5KAF H;  1RO0 A;  3JC2 2;  5APT A;  1TU3 F;  1JY3 P;  2P58 A;  2AEJ A;  5AVX B;  2Z44 A;  1E79 H;  3HTK A;  3M1M A;  3TK1 A;  1GU4 A;  3FXE A;  1G2C B;  3A0B H;  2KGE A;  2K94 A;  4CPG A;  1T2K D;  5CCH C;  1SLQ A;  4PD4 D;  5AVS B;  2K93 A;  2BCC E;  1WMK A;  2K5X A;  1L0N G;  2K0X A;  2Q5U A;  3V2P A;  2DGY A;  3B71 A;  1KV4 A;  1G1I A;  2YKQ A;  3HD7 B;  4PD4 E;  4L75 A;  2HYN A;  4I7Z B;  3KDP B;  3H25 A;  2K92 A;  2KI7 B;  2K37 A;  1E0H A;  1L0N D;  1YHQ P;  2QJK B;  3G0V A;  1SQV K;  3G1I A;  1H0T A;  3G4S P;  1EZV I;  1MKM A;  1URQ A;  5APQ A;  1KIL C;  5DJU B;  1LP1 A;  3L73 D;  3L74 D;  1U7M A;  5BU8 B;  5AW9 B;  4OGQ D;  2OAR A;  4PV1 D;  1JTH B;  1IFM A;  1SQB J;  4N78 D;  3AE3 C;  1QVF O;  3CCR P;  4DJG A;  1WRG A;  4BRY A;  3DS4 A;  2PEO A;  1NTM D;  2QJP C;  5B66 H;  5APX A;  3Q3D A;  1GZL A;  2N9B A;  1GTW A;  1AFO A;  2B88 A;  1JY3 N;  2O01 N;  3LID A;  2M5R A;  2RMZ A;  1SQX E;  3L35 A;  4EOT A;  1FJK A;  2YMY A;  2PFX A;  2LIU A;  1NKZ B;  2Z5I A;  2B87 B;  2QJP B;  1N73 C;  3G9R A;  2OGU A;  2OTJ P;  2L5G B;  4XFX A;  1VQ6 P;  5KAI H;  2N6Y A;  3V2R A;  3DS5 A;  1KB9 D;  2FQ0 A;  3G1G A;  2BQ1 E;  3OJA B;  3MGE A;  4IFF A;  1PL5 A;  1FJP A;  1KIL B;  1R5S A;  4EYY Q;  4PJ0 H;  1VDF A;  3CXH E;  2CNR A;  2GYK A;  2ZYD A;  1LTT C;  1M7L A;  2NPS A;  3L71 J;  3MTU E;  2IZ1 A;  2K2Q A;  3E1R A;  4IZ6 A;  3O6Q B;  3AE8 C;  4U3F G;  1T8K A;  1JJ2 O;  1G2C A;  2J5U A;  4WBA A;  2GM4 A;  1KTM A; 
#chains in the Genus database with same CATH homology
 1RNI A;  5F2K A;  1VQ5 P;  1K9M Q;  2BUO A;  1YIJ P;  3DS2 A;  3CCV P;  1W2B O;  1AUM A;  1VQ7 P;  3DS0 A;  4QNB A;  3CCU P;  2OAR A;  3G6E P;  3RG6 C;  1Q81 Q;  3CMA P;  3HYB A;  1QVF O;  2PEN A;  1VQ4 P;  4GR6 A;  2JO0 A;  4PH1 A;  4GR2 A;  2PY8 A;  3CCR P;  3G26 A;  1VQO P;  3CCS P;  1Q86 Q;  3CCM P;  2LF4 A;  3CXC O;  3I56 P;  1PEU A;  3CME P;  4XRQ A;  3DS4 A;  1M6N A;  3B5I A;  2PEM A;  2PEO A;  1KD1 Q;  1Q82 Q;  1NJI Q;  3G21 A;  4U0C A;  5HGL A;  3VRL C;  1KC8 Q;  3NTE A;  3Q20 A;  2M8N A;  4U0B A;  1VQ8 P;  4PH0 A;  1M90 Q;  1PEM A;  3LRY A;  1M1K Q;  4XFZ A;  1Q7Y Q;  3G71 P;  1RO0 A;  4U0D A;  3G28 A;  5F2N A;  2XT1 A;  5HGM A;  2EIA A;  2L6E A;  5HGN A;  2Z44 A;  2JYG A;  3M1M A;  3DS3 A;  1VQP P;  3CC4 P;  3H4E A;  2QA4 P;  2CWO A;  2XXM A;  1VQN P;  1PEQ A;  2BHV A;  1RO2 A;  2XV6 A;  1VQK P;  1YI2 P;  2OTJ P;  1VQL P;  5F2O A;  2PEK A;  4XFX A;  4U0E A;  3CCE P;  1VQ6 P;  2JYL A;  2PEJ A;  2Z46 A;  1E6J P;  3E2D A;  2EFJ A;  3H0D A;  2P9X A;  1D1D A;  1BAJ A;  1VQM P;  3DS5 A;  3G29 A;  5I4T G;  3H47 A;  1S72 P;  3CCQ P;  3G1G A;  2BQ1 E;  2QEX P;  3MGE A;  3DS1 A;  1KQS O;  3CC7 P;  1M74 A;  1IUQ A;  2DGY A;  4COP A;  3CC2 P;  4COC A;  4XFY A;  3CPW O;  3OW2 O;  1YJW P;  2OTL P;  2PEI A;  4WYM A;  4XRO A;  3CCL P;  5DCK A;  1YJN P;  2M8P A;  4M0I A;  1QVG O;  3WBH A;  5HGO A;  1EIA A;  2ONT A;  1VQ9 P;  1PEO A;  3P05 A;  1EOQ A;  2E1M A;  1YHQ P;  1M6E X;  1YIT P;  1JJ2 O;  5JPA A;  2KOD A;  1A43 A;  3CD6 P;  3G0V A;  3I55 P;  1QRJ A;  3DPH A;  5BS2 A;  1K30 A;  4IPY A;  3DTJ A;  1ZMB A;  3G1I A;  1YJ9 P;  1K73 Q;  4U0A A;  3HZQ A;  4U0F A;  1A8O A;  2PEQ A;  1K8A Q;  2M8L A;  3G4S P;  3CCJ P;  2EG5 A;  1N8R Q;  2Z45 A;  5BS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...