1YITP

Crystal structure of virginiamycin m and s bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yitP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yitP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yitP02
3CCVP 3G4SP 3CC4P 3CC2P 1VQNP 1Q82Q 3CCLP 3I56P 1N8RQ 3CC7P 3G6EP 1K73Q 3CPWO 3CCMP 3CCJP 1S72P 1NJIQ 1VQMP 1Q81Q 2OTLP 1M90Q 1VQLP 2QA4P 3CMAP 3I55P 3CCUP 1QVGO 1YJNP 1VQOP 3G71P 1VQKP 3CD6P 1KC8Q 1K8AQ 1VQ9P 3CMEP 2OTJP 3CCSP 1YJWP 1YHQP 2QEXP 3OW2O 1VQPP 1Q86Q 1YITP 1M1KQ 1W2BO 1KQSO 1KD1Q 1VQ8P 3CCQP 3CXCO 1Q7YQ 1JJ2O 3CCEP 3CCRP 1VQ5P 1YIJP 1VQ4P 1VQ7P 1QVFO 1YJ9P 1K9MQ 1VQ6P 1YI2P
chains in the Genus database with same CATH superfamily
1IC2A 4F37A 1Q81Q 4KHXA 1RE3C 3M9BA 2HODB 2P2UA 2W6AA 3PRJA 3H1LJ 3C8VA 3CC2P 1NQ4A 2E76D 3IR9A 3DS0A 1AF8A 3HE5B 2B88A 4Y99C 2Z5HA 2KS1B 2GM4A 5CHXA 4WBAA 3L71E 1NTKK 4U0BA 4JYCA 2IBZE 1SQBK 4PD4E 1N7SD 3PP5A 3BRVB 1AJYA 3VN0A 1JY2O 3TGUD 1BXIA 2AEJA 2GZJA 2VLQA 2OYIB 1Z56A 3H1HD 3AEDC 2WT7A 4H2WC 2XNDH 2Q3IA 1YJNP 4EDFA 4KT0J 2NRGA 5EFWB 2WSEJ 1R8EA 2G8YA 1AVYA 3CXHI 2OYHA 2E75B 1GL2B 2L9FA 2GZFA 1JMMA 1X79B 4GOFA 2K93A 1L0NG 1BE3J 5CJ0A 1SQBE 5KJ7D 3H32B 2JP3A 1DH3A 1IFPA 2M3EA 3CCMP 1ZV8A 3U59A 1RQVA 2PP6A 2WQYC 2JWDA 3R2PA 3E1RA 2R5BA 2ZYGA 2KWLA 4B86A 1P84H 2P58A 3P8CE 3GHGA 3L73E 2J5UA 5AW5B 2E76B 2FVAA 5DJUB 3SWYA 3WUTA 1PZQA 4HH2A 1U57A 1LTAC 4DT0A 1GXHA 5KLVD 4ZMDA 4AUWA 2FYUD 1SQXG 3L70E 2ZXEB 3RBZA 3OJAB 1N7SB 1JNMA 4PXHB 5AW4B 1YTZI 5AW9B 1Y8AA 5CJ4A 1BCCJ 5B66E 2Q5UA 2YXQB 4U0AA 5AVZB 1ZLLA 1FS0E 3A5TA 2WPVB 1SQQD 1RF0C 3L75G 2A06D 3V5BA 2OYIC 5KAFH 2V7QJ 5APYA 3CCLP 4U0EA 4IFFA 4K3AA 4JF7A 1FAVA 2MD9A 5CCHA 1Y47A 2E75C 1GL2C 1UNKA 3SWFA 1PGOA 2ZAEB 4GR2A 3Q2YA 2PEOA 1UIXA 2XU6A 2ITAA 2WSEH 3GHGC 5APTA 2YXRB 1OVUA 2K37A 1RE4A 2PAJA 4W7ZA 3LW5H 1OVVA 2R3CA 2OGUA 4GOEA 5CCGA 4QKOA 2E76C 3B4QA 2VLNA 1KB9I 2FQ2A 2O1KA 3HTKA 3M0AA 3MGNA 3H1ID 1CI6A 1IMPA 2JYGA 1NU1D 2E43A 1N7SC 5BU8B 1AUMA 5B5EH 1YJWP 1RO0A 3H1LG 3L72E 1W2EA 1T3UA 4WY4A 3H1JJ 1KORA 3BCCE 3EQ2A 2Y0EA 2O01N 3VMAA 1OVRA 2FACA 1J1EB 3AEEC 2W27A 3U43A 1AA0A 4D6TD 1EZVE 2KSEA 1KD1Q 4BWNA 1FOSE 2EHTA 1JUNA 1YI2P 1K04A 1P84E 2I1KA 5KJ7C 2I1JA 2QRXA 4H0LD 1PEOA 1EDJA 1KFNA 1Q2NA 3M0DC 3CCUP 4EIJA 1KILD 3B8EB 3VP8A 3HE4B 5HV8A 2V7QH 4TT3H 1RE4C 1PIXA 4ASVA 2XDJA 3AE8C 4WWIA 2HPCA 4ASWA 2IDBA 1YQ3C 1BE3G 1EDIA 2IBZI 2KGDA 4PD4I 2LL8A 5CCGC 1NJIQ 2LXBA 2KXPB 3EJBA 2B9BA 2YMKA 1FR2A 1VQ8P 5KAIE 2PEIA 3L71J 1H88A 1JJ2O 1OIPA 2GDYA 3FX0A 3WU2H 2M8PA 2GYKA 4I2LC 5AW3B 2HLOA 3KQGA 2CGQA 2AF8A 4YXDC 2KNCA 3RK2B 1WMKA 1EQ7A 2K0YA 1QRJA 1BSHA 1UJZA 3HYBA 2JO0A 2M5AA 1DEEG 2Q7CA 1A02F 3RK3D 1L0LD 4H0LB 1BCCG 1NTKJ 3CL3D 1SQBJ 1YTZT 3LIEA 2KODA 3G21A 2DGYA 3EFGA 1KQFB 4O9BA 2YKPA 2WPSA 3L73J 2C9NY 1JY2N 4OVNF 7CEIA 1K05A 2KZJA 1KMIZ 2XKMA 4ZKPA 1JY3P 2FYNB 1RF1A 2QJKB 4COCA 2GA1A 2XZRA 4U3FJ 1VL2A 1XTCC 3TGUE 5DCKA 3QWOC 2NO8A 3L70J 1JO5A 4L76A 1FJPA 1VQ7P 1PPJD 2LIWA 3H1HE 3U1CA 1A43A 1L0ND 2Z46A 1NTZK 5AW8B 3CE7A 1NYHA 2A45I 1M57D 1JCCA 3Q20A 1HQBA 2W6JH 3FXDA 1DX7A 4YTPC 3AEBC 2FYUK 1M1KQ 1FZCB 3L37A 4GKGA 2HFED 1M7LA 3CX5E 5HGLA 1VQNP 3RK3B 4N78D 1QX8A 3I56P 2M0BA 5APUA 3MIWA 3CMAP 3RK2C 1RY3A 1IUQA 2MVUA 1CSBA 1SQXD 3TNUA 2JU2A 2CNRA 3T97A 3VMYA 3H4EA 3A2AA 2QM7A 1M6EX 1SLQA 5KLVE 4H0LC 2FYUE 1U7MA 3VMZA 3G6EP 3H1JG 1D1DA 1ACPA 4KJMA 2N1TD 2BQ1E 2M5RA 2CWOA 3QH9A 2KP8A 1KN7A 1LTJB 1SQPK 2H8PD 2O1JA 2Y0CA 1RF1C 3L75D 2JYLA 1G2CB 4IFDK 4WYMA 1VF5D 1A02J 3KZIE 2FYNC 2QJKC 2VLOA 1MZ9A 4H44D 1SQQE 3PLNA 2R32A 2A06E 3DS4A 3G1GA 1Z6MA 2WSFJ 1VQPP 3GKLC 1LGHB 3M9QA 2QJPC 3RG6C 1M1JA 1UIIA 4PJ0H 2K5XA 2K0DX 5K5GB 4HKZH 1EZVI 5TJHA 1BDCA 1BAJA 1SQPE 5EW5E 3V6IA 4R4LA 1P84I 2XZ1C 3MZWB 1FZCC 2L5GB 1LP1A 3B5IA 5DJTB 2IBZG 3RK3C 5B66H 4R0MA 1D7MA 2GDXA 2WZ7A 3USSA 1OWAA 4JQ0D 2P10A 2JWAA 5CBOA 3AE2C 5AVQB 2N1TB 4BRYB 1EDKA 1RQUA 2WSSH 1VQ9P 3NTEA 4YXWH 3MUDA 1FC2C 2LPKA 3CXCO 2M8NA 3H1LD 1PGJA 2P1JA 1S4XA 2E42A 1ZR2A 1VF5B 3RG2A 1LT9A 1NU1E 3GJNA 1NTKG 2CPSA 4XE5B 1MKMA 1SQBG 2KOPA 4H44B 3R4YA 1GDTA 2CPBA 1LTJC 3P05A 4HKGA 1W2BO 1HTLC 4EYYQ 1S5LX 3FWLA 3A0BH 3D71A 1GK4A 2JO1A 3L73G 2LTEA 4IL6X 3MGEA 4UHPB 4D6TE 2K92A 2AXCA 1VQLP 3EJDA 1M1JC 4C7NA 2FQ1A 2K9JA 5KP8B 4U3FG 3TSIA 3N4XA 2OTJP 4NPEA 1IK7A 3VP9A 1Q7YQ 3G1IA 1QEXA 1YJ9P 4COPA 1URQA 2HODA 4IOIH 1ZMBA 2WT7B 3L35A 2QNWA 1CW5A 1IFNA 2N6ZA 1USEA 1BE3D 1GW3A 1KILE 2WSFH 1JY3N 5I4TG 2OYHB 3DS1A 3CXHD 1T8ZA 1IMQA 3W68A 2QEXP 3V2RA 1RH5B 2ZFCA 3LW5J 5KTBA 1LWUA 1S3JA 1N73A 2Z45A 2A45G 5GTHE 2E5TA 2R5DA 2POHA 3PJSK 5AVYB 4XROA 4GT1A 1PP9D 3O6QA 2M8LA 2N1TC 4L75A 1L0LK 3GHGB 2XZ0D 1LTGC 4WVZA 3Q5PA 3OW2O 4MN4C 5F2KA 4RKUJ 3TGUJ 3A0HE 2CQ8A 1VF5C 2Z44A 1AQTA 1BCCD 3AEGC 4PJ0E 4H44C 3FWNA 3NFQA 3H1KE 5L8RJ 3O8ZA 5CCGD 3CX5I 5HVCA 4OGQC 2MJZA 1L0LE 1VQ4P 1QL2A 2QSIA 3DS2A 5JPAA 1ZN5A 1KLPA 4U0DA 1JY2P 3GMAA 4NEOA 1SQVD 1L0NK 3CWBD 1URQC 2IFNA 4WB4A 3P8MC 1QVGO 5KAIH 3RGUA 1NAFA 1K8AQ 2NZ2A 1Q86Q 3KHUA 1NTZJ 2R3SA 1NKNA 4WY4D 2GDWA 2KB7P 1FZBA 2QIWA 2KIKA 2RN0A 5KLVJ 3VTPC 2OYHC 2FYUJ 1K30A 4R4MA 2E1MA 1N73C 1IK9A 3Q5RA 3RL0D 1PPJE 2P67A 3H6PA 2PEKA 1HY8A 2CK3H 2KSJA 1A8OA 1L0NE 3WUUA 2GZEA 3FXEA 1U7JA 1EZVG 3H47A 1L0HA 3A0BE 5HGNA 1M8OB 1CZQA 3VYIA 5M1BA 3SFEC 3GG2A 1JB0J 1BGYG 1IO4A 1NHLA 3MHVA 1AV1A 4BPHA 4XFJA 4ZKUA 4N78E 1JOCA 3CCEP 1KB9D 2NPSA 3HTKB 1LNQA 1OW6A 4W80A 4HB1A 1CI6B 3TK1A 2IZ1A 1L4AA 1GU4A 1L0IA 1GW4A 1SQXE 3WBHA 3SFDC 3H1JD 3FGAD 2FKWB 1SQPJ 2D2CD 1X9VA 2KG9A 2AXTE 4WY4B 3CCRP 1QVFO 2B87A 2PEJA 1S2EA 3HD7A 4U0CA 2BCCD 3JC22 1Q90D 3RL0B 3PTZA 1EDLA 1KC8Q 3A3YB 1VPCA 3RK2D 2M3BA 1NTMK 2KOOA 3C1LA 3CX5H 1PGPA 1DD3A 3EWKA 4JPZB 2Y9ZA 5CCHC 3G26A 1ZP0C 3VRLC 1K73Q 4XRQA 3H25A 1NU1J 2PRRA 2MVVA 2GUVA 1DV5A 1M74A 2JU1A 1Y9BA 3DS3A 3G71P 2HPCB 1FJKA 3M06A 5AVSB 2KZIA 3L74E 3CCQP 4CA3A 1VQ5P 3S4RA 4JBZA 2IBZD 2PEQA 2L6EA 4H13B 4PD4D 1GPJA 2PGDA 1NTME 1PEQA 3PH0A 2YKOA 3ITKA 5EJDA 3UIAA 1DIPA 1GZLA 2LKMA 1GTWA 2FY8A 2WSCH 4N6JA 2KLUA 2KR5A 4D6TJ 1PEUA 4MRTC 2AEFA 2D2CB 5AW7B 2BEQD 3DS5A 4H2XC 2K1AA 3CLQA 1KYOE 3TGUG 4DG9A 2JDIH 3KZIH 1N2DC 2KNCB 1HUCA 3CCJP 3NMDA 1NTKD 3U1AA 3K5BA 1SQBD 1ZRTD 2M5AB 3H1LE 3HUSA 3M91A 4WY4C 3B5NA 3KXDA 4AYCA 5E79E 2ROQA 1JCDA 3CCVP 1OXZA 2BUOA 3P8CD 2KOSA 4IZ6A 4YPCA 1M56D 2FFDA 4QMAA 5KKZB 2L4BA 3RL0C 2XT1A 2H43A 2SPZA 4U3FD 2JB0A 4UB8E 3GW6A 1VDFA 3M9HA 2YMYA 1NTZG 1MV8A 1RF1B 1SFCA 2EFJA 2H88C 4JYBA 1DNYA 5APWA 3V4QA 2EIAA 4QNBA 1MFTA 5H2FE 1E6JP 2FYUG 5AVTB 1OR5A 3H1KJ 4HJGH 1M6NA 2FQ0A 2FXOA 2N9YB 1BE3E 4H13C 1KILA 3AEAC 4IFMA 2Z4EA 1FOSF 2WPRA 2OYOA 1L0LJ 1S5LE 2KW2A 2R44A 1H0TA 2QJPB 5BVZA 3F5HA 3CXHE 3HZQA 3AE1C 2JBGA 3CPWO 2AFEA 3AEFC 3Q3DA 1AQ5A 4IL6E 1E0HA 2HYNA 5AW2B 2GZGA 1T6AA 2D2CC 4U7JA 3RBXA 5KLVK 5KP7B 3SWKA 5AVRB 1PP9E 2AVAA 2VSQA 1H8AA 3TNUB 1HGZA 5F2NA 3T97B 4K35A 1NAYA 5AVUB 1SQVK 1SQPG 3CD6P 5GTIE 1MUUA 3M1MA 2YO2A 4M0IA 3SSUA 1BCCE 1L0NJ 1YQ4C 3I5CA 3B71A 2YO3A 3D70A 3L36A 3AE6C 1SQQK 5KKZC 1SVFA 1XTGB 2X2BA 5APVA 3CI9A 4OWFA 2XV6A 1G1IA 4C7RA 1SFCC 1S9KD 3NY7B 3N7NA 5GTHH 1IZNB 2M8RA 1E5WA 1SQVE 3CWBE 2KOGA 4BPFA 3V2NA 1KQLA 3E1IA 5AVWB 2KGAA 2O3JA 2JKVA 1BDDA 1M1JB 3GZMA 3A0HH 1VHNA 2VLPA 2Q9IA 2YIUB 4PH0A 4OGQD 1JEKA 1EZVD 2EG5A 2HG5D 1RE3A 2KYVA 2PEMA 4UB6E 2ZXXA 3V2PA 3L72J 1P84D 1LP1B 3BCCJ 1BGYD 3AECC 1URQD 2L0QA 1VKUA 5HGMA 1JTHA 2DW3A 1NU1K 3KPEA 3JCUE 1JM0A 2FVFA 2JJLA 5TISE 2YKQA 3L71G 2IX7C 2K3RA 4XFZA 2C9LY 2OTLP 3DPHA 1KB9E 4DOJA 1KTMA 3HRNA 1WT6A 4RJTA 1LT9B 3L74J 3H1JE 3H1IE 4LLHA 2OQQA 4LC1A 1N8RQ 1NTMJ 2HR3A 1GD2E 2CG5B 1KYOI 4RO0A 1VQOP 4N3YB 1J1DB 2LF4A 1LTIC 2IZ0A 1QGKB 1N7LA 2WITA 4OGQB 1HWTC 2BCCE 1LTTC 1ZOYC 3Q5SA 4C7NB 2K9JB 2Q3EA 1USDA 1R5LA 2MKVA 3L4FA 1VQMP 3II6A 1T2KD 2RH0A 1URQB 3H1KG 2YIUC 1MFZA 1F80D 1YITP 4PWVB 2FBWC 1TU3F 1X0TA 3L70G 2ZVNB 3BATA 2K0XA 1L0LG 1Q82Q 2ONTA 5F2OA 2MF4A 2WMMA 2AEMA 2G3AA 4GIFA 3G3ZA 3WMM0 4GR6A 3HE5A 2AXTH 1MZ8A 1IFMA 1LWUB 1NO4A 1W5CE 1N73B 2KS1A 3CCSP 2FXPA 1YHQP 2H7HA 3F89A 1KQGB 4PV1D 1RO2A 5AVXB 3O6QB 1AVOA 3G29A 2ZYDA 1NVOA 2IYPA 2LKIA 2XNXA 2N5HA 3OAKA 1PV3A 1PFIA 5CCHD 3MUDC 1RF0A 2QE7H 4NPDA 2W90A 2OYIA 2WPQA 1LT9C 5CBNA 1OMIA 4AQRD 4L74A 3B4SA 1PPJG 3VOPA 1NTKE 1ZRTE 3LRYA 1E79H 2YNYA 3H1HJ 3V4WA 2JAZA 4XA4A 1GL2A 2O01J 1HBWA 3CX5D 1ZW0A 4CPGA 1J1DC 4PH1A 2NPSD 2W83C 3H32A 1DD4A 1L4AD 1X8YA 3RK3E 1YYCA 1NTZD 2QM8A 2E74D 4XFXA 2Y0DA 1PP9J 5CZDB 4U3FE 5HGOA 3BASA 5AVVB 4HYTB 1HJ0A 2LR2A 1ZR4A 2L22A 3A7OA 1KYOH 3HD7D 4PV1B 1ZMEC 2FYZA 2W8ZA 2XXMA 3S9OA 2BEZF 2AFDA 1EXIA 2L91A 4TLFA 1N7SA 3KYQA 1GXGA 1IFDA 3L72G 4GDOA 1LWUC 2P9XA 2KG8A 2ERHA 2MR7A 2KGEA 1OW7A 3BCCG 2Z5IA 3DTJA 5E79H 1HH0A 2IFMA 1EOQA 1SQXK 2WSCJ 1AYIA 1PEMA 1SQVJ 3CWBJ 3BRTB 2GZIA 1ZXGA 2WWWA 1KFMA 3Q1MA 4W7YA 5APXA 4UB8H 1X22A 5C39A 2NPSB 5KJ7A 1SQPD 2ZT9D 5APSA 4Z1MH 3IF4A 1SQQJ 4C46A 1KQSO 1GMJA 1L4AB 1K9MQ 3M0DA 2E74B 5BS2A 3L74G 5H2FH 4H13D 2K88A 1PL5A 2I8DA 3H0DA 3C9IA 3MTUE 1T2KC 3TYYA 1R5SA 5AW6B 1NTMG 1FDMA 3I55P 3PHLA 2Q1KA 2B87B 2QJYB 3NXSA 3HD7B 1NOHA 1OX3A 1IFJA 1S5LH 2O01H 3MP7B 2JEEA 2PY8A 1VQ6P 3CXHH 2RKLA 2FXMA 2KLVA 4IL6H 4EI2A 1WRGA 1S9KE 3CC7P 1HVVA 2N9BA 3ZDMA 2XV5A 3B5ND 3BVHA 2FADA 4PV1C 3L75E 1EC5A 1EXJA 2BHVA 3KDPB 3P32A 2KORA 4LGDE 2P7JA 3H1IJ 2JGPA 2K9YA 5GTIH 2ZT9B 4L73A 1N86A 5KP6B 1AFOA 1SFCD 5AW1B 2MY5A 2LXCB 3L71D 1NKZB 2BCCJ 4I1LA 1BGYE 1OZHA 1S72P 2KGCA 2NPSC 3AE7C 1L4AC 2B89A 1T8KA 1L2PA 1FU1A 2E74C 3JSVC 5AW0B 1IFIA 3G4SP 2J58A 3HE4A 2QG4A 1NGMB 3RL0g 3HUSB 1JY3O 3H1HG 3G28A 1GK6A 3B5NB 2QA4P 2VRSA 2QJYC 3HD7C 3GF3A 3WUVA 2KK7A 2E5YA 2LOLA 2FFDB 4UB6H 2OTKE 4ZNCA 1CEIA 1PP9G 3L73D 4IPYA 5KAFE 2J59M 3W67A 3MD0A 2OARA 1KV4A 1EIAA 1G1JA 3JCUH 3D6ZA 5TISH 1SFCB 3H1KD 2PENA 3EJEA 2H89C 1FBMA 3L70D 3AE4C 1H89A 1X3OA 1KB9H 2FHSC 1J1EC 5KLVG 2JQ4A 2ZT9C 3LIDA 3P7KA 1HGVA 1KILB 1H0TB 5BU5A 2BASA 1SS1A 3IN6A 3TDKA 1HF9A 4U0FA 3G9RA 4A7PA 3AE9C 1SQVG 3IFMA 3CWBG 1LJ2A 2QVAA 2PNGA 1PGQA 2EHSA 4XFYA 1HJBA 2MR8A 1FZFA 1SQQG 4EOTA 2A06G 5B5EE 3EFFK 3HUSC 3AE5C 4GODA 1GU5A 4I7ZB 4DCKA 3B5NC 5APQA 3GZLA 2PFXA 3OA7A 3TF5A 2K94A 2FFDC 5KLIB 2N50A 1YIJP 1LT1A 2N5IA 4BPGA 1FDIA 1FZCA 3V2QA 4DZOA 1LTSC 2V4HA 4PD4H 1DEBA 2FVEA 1NTZE 1JMBA 1FDOA 4Y28J 3G0VA 3GF7A 2LMLA 3H1IG 3VMXA 3L72D 1KILC 3S1KA 1RHZB 1NU1G 1SQXJ 3IAOA 3BCCD 1FZEA 3CMEP 2KG6A 2ZVOB 2KUBA 2K2QA 4NPFX 3E7KA 4M3LA 2JR8A 3GLMA 3CC4P 2C0XA 2WTYA 2BCCG 3WU2E 1OFCX 1LTJA 1IJDB 1NWQA 2IPPA 1YBKA 4Y99B 1G2CA 1JTHB 1M90Q 1LTBC 4I6MC 2C0WA 1QLED 1FZGA 4D6TG 3NTNA 2WVRA 2DNWA 1FE6A 3ABVC 3L75J 1T3JA 3L74D 4I7ZC 2N6YA 4RESB 4DJGA 2FAEA 1S1CX 3AE3C 4OH8B 1NTMD 2W6BA 5KLIC 1RNIA 1ZNVA 2KI7B 2WPTA 5BS1A 2IYOA 3D6YA 2UWJE 2KOQA 5CMZA 1KYOD 2ZJSE 1QL1A 3E2DA 3LMOA 1FZAA 2N98A 1J2JB 1BGYJ 1BSNA 2Y9YA 1SP4A 2A45H 2RMZA 1VQKP 1NH4A 2LIUA 4H2YC 2ZYAA 1KZUB 1OW8A 2GUSA 4BXLA 2N1TA 2E75D 1EMVA 4BRYA 1GL2D 2Q6QA
chains in the Genus database with same CATH topology
2L6EA 2EG5A 2Z45A 5HGLA 1VQNP 2PEMA 1Q82Q 1PEQA 4XROA 2ONTA 3I56P 3H47A 3HZQA 5F2OA 3CPWO 5HGNA 2M8LA 1Q81Q 3CMAP 2P9XA 2JYGA 1PEUA 1IUQA 4GR6A 1VQ9P 3CMEP 3NTEA 5HGMA 1AUMA 3CCSP 1QRJA 3DTJA 1YJWP 1YHQP 3OW2O 3H4EA 3DS5A 1EOQA 1RO2A 5F2KA 1RO0A 2M8NA 3CXCO 3HYBA 3CCEP 2JO0A 1M6EX 4U0FA 3G29A 3CC4P 3CC2P 3DS0A 1PEMA 2Z44A 3G6EP 4XFZA 3WBHA 5F2NA 3CCJP 4U0AA 1S72P 2OTLP 1D1DA 1M90Q 3DPHA 2KODA 3G21A 2BQ1E 2DGYA 3CD6P 2CWOA 4XFYA 4U0BA 3P05A 1KQSO 1KD1Q 1W2BO 3M1MA 4M0IA 3CCRP 1QVFO 1VQ4P 1K9MQ 3DS2A 5JPAA 2JYLA 1YI2P 5BS2A 2PEJA 3CCVP 2BUOA 3G4SP 4U0CA 4U0DA 4WYMA 3LRYA 3CCLP 4U0EA 1N8RQ 1PEOA 3H0DA 3MGEA 3G28A 1VQLP 2QA4P 2XV6A 2XT1A 4PH1A 4COCA 3I55P 3CCUP 1VQOP 1YJNP 1QVGO 2LF4A 3DS4A 3G1GA 1KC8Q 1K8AQ 2OTJP 1Q86Q 5DCKA 1VQPP 1RNIA 5BS1A 1Q7YQ 3G1IA 1YIJP 1VQ7P 4COPA 1YJ9P 2PY8A 4GR2A 1VQ6P 1ZMBA 2PEOA 3RG6C 4XFXA 1A43A 2EFJA 2Z46A 3G26A 3VRLC 3CC7P 3E2DA 1BAJA 4IPYA 1K73Q 4XRQA 2EIAA 4QNBA 5HGOA 3CCMP 1E6JP 1NJIQ 1VQMP 1K30A 3Q20A 2E1MA 1M74A 5I4TG 2OARA 3DS1A 3DS3A 1EIAA 3G71P 1VQKP 2PEKA 2QEXP 1M6NA 1A8OA 1VQ8P 1YITP 1M1KQ 2PENA 3CCQP 2PEIA 3B5IA 1JJ2O 3G0VA 2XXMA 1VQ5P 2BHVA 4PH0A 2M8PA 2PEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  3G4S P;  3CC4 P;  3CC2 P;  1VQN P;  1Q82 Q;  3CCL P;  3I56 P;  1N8R Q;  3CC7 P;  3G6E P;  1K73 Q;  3CPW O;  3CCM P;  3CCJ P;  1S72 P;  1NJI Q;  1VQM P;  1Q81 Q;  2OTL P;  1M90 Q;  1VQL P;  2QA4 P;  3CMA P;  3I55 P;  3CCU P;  1QVG O;  1YJN P;  1VQO P;  3G71 P;  1VQK P;  3CD6 P;  1KC8 Q;  1K8A Q;  1VQ9 P;  3CME P;  2OTJ P;  3CCS P;  1YJW P;  1YHQ P;  2QEX P;  3OW2 O;  1VQP P;  1Q86 Q;  1YIT P;  1M1K Q;  1W2B O;  1KQS O;  1KD1 Q;  1VQ8 P;  3CCQ P;  3CXC O;  1Q7Y Q;  1JJ2 O;  3CCE P;  3CCR P;  1VQ5 P;  1YIJ P;  1VQ4 P;  1VQ7 P;  1QVF O;  1YJ9 P;  1K9M Q;  1VQ6 P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 1IC2 A;  4F37 A;  1Q81 Q;  4KHX A;  1RE3 C;  3M9B A;  2HOD B;  2P2U A;  2W6A A;  3PRJ A;  3H1L J;  3C8V A;  3CC2 P;  1NQ4 A;  2E76 D;  3IR9 A;  3DS0 A;  1AF8 A;  3HE5 B;  2B88 A;  4Y99 C;  2Z5H A;  2KS1 B;  2GM4 A;  5CHX A;  4WBA A;  3L71 E;  1NTK K;  4U0B A;  4JYC A;  2IBZ E;  1SQB K;  4PD4 E;  1N7S D;  3PP5 A;  3BRV B;  1AJY A;  3VN0 A;  1JY2 O;  3TGU D;  1BXI A;  2AEJ A;  2GZJ A;  2VLQ A;  2OYI B;  1Z56 A;  3H1H D;  3AED C;  2WT7 A;  4H2W C;  2XND H;  2Q3I A;  1YJN P;  4EDF A;  4KT0 J;  2NRG A;  5EFW B;  2WSE J;  1R8E A;  2G8Y A;  1AVY A;  3CXH I;  2OYH A;  2E75 B;  1GL2 B;  2L9F A;  2GZF A;  1JMM A;  1X79 B;  4GOF A;  2K93 A;  1L0N G;  1BE3 J;  5CJ0 A;  1SQB E;  5KJ7 D;  3H32 B;  2JP3 A;  1DH3 A;  1IFP A;  2M3E A;  3CCM P;  1ZV8 A;  3U59 A;  1RQV A;  2PP6 A;  2WQY C;  2JWD A;  3R2P A;  3E1R A;  2R5B A;  2ZYG A;  2KWL A;  4B86 A;  1P84 H;  2P58 A;  3P8C E;  3GHG A;  3L73 E;  2J5U A;  5AW5 B;  2E76 B;  2FVA A;  5DJU B;  3SWY A;  3WUT A;  1PZQ A;  4HH2 A;  1U57 A;  1LTA C;  4DT0 A;  1GXH A;  5KLV D;  4ZMD A;  4AUW A;  2FYU D;  1SQX G;  3L70 E;  2ZXE B;  3RBZ A;  3OJA B;  1N7S B;  1JNM A;  4PXH B;  5AW4 B;  1YTZ I;  5AW9 B;  1Y8A A;  5CJ4 A;  1BCC J;  5B66 E;  2Q5U A;  2YXQ B;  4U0A A;  5AVZ B;  1ZLL A;  1FS0 E;  3A5T A;  2WPV B;  1SQQ D;  1RF0 C;  3L75 G;  2A06 D;  3V5B A;  2OYI C;  5KAF H;  2V7Q J;  5APY A;  3CCL P;  4U0E A;  4IFF A;  4K3A A;  4JF7 A;  1FAV A;  2MD9 A;  5CCH A;  1Y47 A;  2E75 C;  1GL2 C;  1UNK A;  3SWF A;  1PGO A;  2ZAE B;  4GR2 A;  3Q2Y A;  2PEO A;  1UIX A;  2XU6 A;  2ITA A;  2WSE H;  3GHG C;  5APT A;  2YXR B;  1OVU A;  2K37 A;  1RE4 A;  2PAJ A;  4W7Z A;  3LW5 H;  1OVV A;  2R3C A;  2OGU A;  4GOE A;  5CCG A;  4QKO A;  2E76 C;  3B4Q A;  2VLN A;  1KB9 I;  2FQ2 A;  2O1K A;  3HTK A;  3M0A A;  3MGN A;  3H1I D;  1CI6 A;  1IMP A;  2JYG A;  1NU1 D;  2E43 A;  1N7S C;  5BU8 B;  1AUM A;  5B5E H;  1YJW P;  1RO0 A;  3H1L G;  3L72 E;  1W2E A;  1T3U A;  4WY4 A;  3H1J J;  1KOR A;  3BCC E;  3EQ2 A;  2Y0E A;  2O01 N;  3VMA A;  1OVR A;  2FAC A;  1J1E B;  3AEE C;  2W27 A;  3U43 A;  1AA0 A;  4D6T D;  1EZV E;  2KSE A;  1KD1 Q;  4BWN A;  1FOS E;  2EHT A;  1JUN A;  1YI2 P;  1K04 A;  1P84 E;  2I1K A;  5KJ7 C;  2I1J A;  2QRX A;  4H0L D;  1PEO A;  1EDJ A;  1KFN A;  1Q2N A;  3M0D C;  3CCU P;  4EIJ A;  1KIL D;  3B8E B;  3VP8 A;  3HE4 B;  5HV8 A;  2V7Q H;  4TT3 H;  1RE4 C;  1PIX A;  4ASV A;  2XDJ A;  3AE8 C;  4WWI A;  2HPC A;  4ASW A;  2IDB A;  1YQ3 C;  1BE3 G;  1EDI A;  2IBZ I;  2KGD A;  4PD4 I;  2LL8 A;  5CCG C;  1NJI Q;  2LXB A;  2KXP B;  3EJB A;  2B9B A;  2YMK A;  1FR2 A;  1VQ8 P;  5KAI E;  2PEI A;  3L71 J;  1H88 A;  1JJ2 O;  1OIP A;  2GDY A;  3FX0 A;  3WU2 H;  2M8P A;  2GYK A;  4I2L C;  5AW3 B;  2HLO A;  3KQG A;  2CGQ A;  2AF8 A;  4YXD C;  2KNC A;  3RK2 B;  1WMK A;  1EQ7 A;  2K0Y A;  1QRJ A;  1BSH A;  1UJZ A;  3HYB A;  2JO0 A;  2M5A A;  1DEE G;  2Q7C A;  1A02 F;  3RK3 D;  1L0L D;  4H0L B;  1BCC G;  1NTK J;  3CL3 D;  1SQB J;  1YTZ T;  3LIE A;  2KOD A;  3G21 A;  2DGY A;  3EFG A;  1KQF B;  4O9B A;  2YKP A;  2WPS A;  3L73 J;  2C9N Y;  1JY2 N;  4OVN F;  7CEI A;  1K05 A;  2KZJ A;  1KMI Z;  2XKM A;  4ZKP A;  1JY3 P;  2FYN B;  1RF1 A;  2QJK B;  4COC A;  2GA1 A;  2XZR A;  4U3F J;  1VL2 A;  1XTC C;  3TGU E;  5DCK A;  3QWO C;  2NO8 A;  3L70 J;  1JO5 A;  4L76 A;  1FJP A;  1VQ7 P;  1PPJ D;  2LIW A;  3H1H E;  3U1C A;  1A43 A;  1L0N D;  2Z46 A;  1NTZ K;  5AW8 B;  3CE7 A;  1NYH A;  2A45 I;  1M57 D;  1JCC A;  3Q20 A;  1HQB A;  2W6J H;  3FXD A;  1DX7 A;  4YTP C;  3AEB C;  2FYU K;  1M1K Q;  1FZC B;  3L37 A;  4GKG A;  2HFE D;  1M7L A;  3CX5 E;  5HGL A;  1VQN P;  3RK3 B;  4N78 D;  1QX8 A;  3I56 P;  2M0B A;  5APU A;  3MIW A;  3CMA P;  3RK2 C;  1RY3 A;  1IUQ A;  2MVU A;  1CSB A;  1SQX D;  3TNU A;  2JU2 A;  2CNR A;  3T97 A;  3VMY A;  3H4E A;  3A2A A;  2QM7 A;  1M6E X;  1SLQ A;  5KLV E;  4H0L C;  2FYU E;  1U7M A;  3VMZ A;  3G6E P;  3H1J G;  1D1D A;  1ACP A;  4KJM A;  2N1T D;  2BQ1 E;  2M5R A;  2CWO A;  3QH9 A;  2KP8 A;  1KN7 A;  1LTJ B;  1SQP K;  2H8P D;  2O1J A;  2Y0C A;  1RF1 C;  3L75 D;  2JYL A;  1G2C B;  4IFD K;  4WYM A;  1VF5 D;  1A02 J;  3KZI E;  2FYN C;  2QJK C;  2VLO A;  1MZ9 A;  4H44 D;  1SQQ E;  3PLN A;  2R32 A;  2A06 E;  3DS4 A;  3G1G A;  1Z6M A;  2WSF J;  1VQP P;  3GKL C;  1LGH B;  3M9Q A;  2QJP C;  3RG6 C;  1M1J A;  1UII A;  4PJ0 H;  2K5X A;  2K0D X;  5K5G B;  4HKZ H;  1EZV I;  5TJH A;  1BDC A;  1BAJ A;  1SQP E;  5EW5 E;  3V6I A;  4R4L A;  1P84 I;  2XZ1 C;  3MZW B;  1FZC C;  2L5G B;  1LP1 A;  3B5I A;  5DJT B;  2IBZ G;  3RK3 C;  5B66 H;  4R0M A;  1D7M A;  2GDX A;  2WZ7 A;  3USS A;  1OWA A;  4JQ0 D;  2P10 A;  2JWA A;  5CBO A;  3AE2 C;  5AVQ B;  2N1T B;  4BRY B;  1EDK A;  1RQU A;  2WSS H;  1VQ9 P;  3NTE A;  4YXW H;  3MUD A;  1FC2 C;  2LPK A;  3CXC O;  2M8N A;  3H1L D;  1PGJ A;  2P1J A;  1S4X A;  2E42 A;  1ZR2 A;  1VF5 B;  3RG2 A;  1LT9 A;  1NU1 E;  3GJN A;  1NTK G;  2CPS A;  4XE5 B;  1MKM A;  1SQB G;  2KOP A;  4H44 B;  3R4Y A;  1GDT A;  2CPB A;  1LTJ C;  3P05 A;  4HKG A;  1W2B O;  1HTL C;  4EYY Q;  1S5L X;  3FWL A;  3A0B H;  3D71 A;  1GK4 A;  2JO1 A;  3L73 G;  2LTE A;  4IL6 X;  3MGE A;  4UHP B;  4D6T E;  2K92 A;  2AXC A;  1VQL P;  3EJD A;  1M1J C;  4C7N A;  2FQ1 A;  2K9J A;  5KP8 B;  4U3F G;  3TSI A;  3N4X A;  2OTJ P;  4NPE A;  1IK7 A;  3VP9 A;  1Q7Y Q;  3G1I A;  1QEX A;  1YJ9 P;  4COP A;  1URQ A;  2HOD A;  4IOI H;  1ZMB A;  2WT7 B;  3L35 A;  2QNW A;  1CW5 A;  1IFN A;  2N6Z A;  1USE A;  1BE3 D;  1GW3 A;  1KIL E;  2WSF H;  1JY3 N;  5I4T G;  2OYH B;  3DS1 A;  3CXH D;  1T8Z A;  1IMQ A;  3W68 A;  2QEX P;  3V2R A;  1RH5 B;  2ZFC A;  3LW5 J;  5KTB A;  1LWU A;  1S3J A;  1N73 A;  2Z45 A;  2A45 G;  5GTH E;  2E5T A;  2R5D A;  2POH A;  3PJS K;  5AVY B;  4XRO A;  4GT1 A;  1PP9 D;  3O6Q A;  2M8L A;  2N1T C;  4L75 A;  1L0L K;  3GHG B;  2XZ0 D;  1LTG C;  4WVZ A;  3Q5P A;  3OW2 O;  4MN4 C;  5F2K A;  4RKU J;  3TGU J;  3A0H E;  2CQ8 A;  1VF5 C;  2Z44 A;  1AQT A;  1BCC D;  3AEG C;  4PJ0 E;  4H44 C;  3FWN A;  3NFQ A;  3H1K E;  5L8R J;  3O8Z A;  5CCG D;  3CX5 I;  5HVC A;  4OGQ C;  2MJZ A;  1L0L E;  1VQ4 P;  1QL2 A;  2QSI A;  3DS2 A;  5JPA A;  1ZN5 A;  1KLP A;  4U0D A;  1JY2 P;  3GMA A;  4NEO A;  1SQV D;  1L0N K;  3CWB D;  1URQ C;  2IFN A;  4WB4 A;  3P8M C;  1QVG O;  5KAI H;  3RGU A;  1NAF A;  1K8A Q;  2NZ2 A;  1Q86 Q;  3KHU A;  1NTZ J;  2R3S A;  1NKN A;  4WY4 D;  2GDW A;  2KB7 P;  1FZB A;  2QIW A;  2KIK A;  2RN0 A;  5KLV J;  3VTP C;  2OYH C;  2FYU J;  1K30 A;  4R4M A;  2E1M A;  1N73 C;  1IK9 A;  3Q5R A;  3RL0 D;  1PPJ E;  2P67 A;  3H6P A;  2PEK A;  1HY8 A;  2CK3 H;  2KSJ A;  1A8O A;  1L0N E;  3WUU A;  2GZE A;  3FXE A;  1U7J A;  1EZV G;  3H47 A;  1L0H A;  3A0B E;  5HGN A;  1M8O B;  1CZQ A;  3VYI A;  5M1B A;  3SFE C;  3GG2 A;  1JB0 J;  1BGY G;  1IO4 A;  1NHL A;  3MHV A;  1AV1 A;  4BPH A;  4XFJ A;  4ZKU A;  4N78 E;  1JOC A;  3CCE P;  1KB9 D;  2NPS A;  3HTK B;  1LNQ A;  1OW6 A;  4W80 A;  4HB1 A;  1CI6 B;  3TK1 A;  2IZ1 A;  1L4A A;  1GU4 A;  1L0I A;  1GW4 A;  1SQX E;  3WBH A;  3SFD C;  3H1J D;  3FGA D;  2FKW B;  1SQP J;  2D2C D;  1X9V A;  2KG9 A;  2AXT E;  4WY4 B;  3CCR P;  1QVF O;  2B87 A;  2PEJ A;  1S2E A;  3HD7 A;  4U0C A;  2BCC D;  3JC2 2;  1Q90 D;  3RL0 B;  3PTZ A;  1EDL A;  1KC8 Q;  3A3Y B;  1VPC A;  3RK2 D;  2M3B A;  1NTM K;  2KOO A;  3C1L A;  3CX5 H;  1PGP A;  1DD3 A;  3EWK A;  4JPZ B;  2Y9Z A;  5CCH C;  3G26 A;  1ZP0 C;  3VRL C;  1K73 Q;  4XRQ A;  3H25 A;  1NU1 J;  2PRR A;  2MVV A;  2GUV A;  1DV5 A;  1M74 A;  2JU1 A;  1Y9B A;  3DS3 A;  3G71 P;  2HPC B;  1FJK A;  3M06 A;  5AVS B;  2KZI A;  3L74 E;  3CCQ P;  4CA3 A;  1VQ5 P;  3S4R A;  4JBZ A;  2IBZ D;  2PEQ A;  2L6E A;  4H13 B;  4PD4 D;  1GPJ A;  2PGD A;  1NTM E;  1PEQ A;  3PH0 A;  2YKO A;  3ITK A;  5EJD A;  3UIA A;  1DIP A;  1GZL A;  2LKM A;  1GTW A;  2FY8 A;  2WSC H;  4N6J A;  2KLU A;  2KR5 A;  4D6T J;  1PEU A;  4MRT C;  2AEF A;  2D2C B;  5AW7 B;  2BEQ D;  3DS5 A;  4H2X C;  2K1A A;  3CLQ A;  1KYO E;  3TGU G;  4DG9 A;  2JDI H;  3KZI H;  1N2D C;  2KNC B;  1HUC A;  3CCJ P;  3NMD A;  1NTK D;  3U1A A;  3K5B A;  1SQB D;  1ZRT D;  2M5A B;  3H1L E;  3HUS A;  3M91 A;  4WY4 C;  3B5N A;  3KXD A;  4AYC A;  5E79 E;  2ROQ A;  1JCD A;  3CCV P;  1OXZ A;  2BUO A;  3P8C D;  2KOS A;  4IZ6 A;  4YPC A;  1M56 D;  2FFD A;  4QMA A;  5KKZ B;  2L4B A;  3RL0 C;  2XT1 A;  2H43 A;  2SPZ A;  4U3F D;  2JB0 A;  4UB8 E;  3GW6 A;  1VDF A;  3M9H A;  2YMY A;  1NTZ G;  1MV8 A;  1RF1 B;  1SFC A;  2EFJ A;  2H88 C;  4JYB A;  1DNY A;  5APW A;  3V4Q A;  2EIA A;  4QNB A;  1MFT A;  5H2F E;  1E6J P;  2FYU G;  5AVT B;  1OR5 A;  3H1K J;  4HJG H;  1M6N A;  2FQ0 A;  2FXO A;  2N9Y B;  1BE3 E;  4H13 C;  1KIL A;  3AEA C;  4IFM A;  2Z4E A;  1FOS F;  2WPR A;  2OYO A;  1L0L J;  1S5L E;  2KW2 A;  2R44 A;  1H0T A;  2QJP B;  5BVZ A;  3F5H A;  3CXH E;  3HZQ A;  3AE1 C;  2JBG A;  3CPW O;  2AFE A;  3AEF C;  3Q3D A;  1AQ5 A;  4IL6 E;  1E0H A;  2HYN A;  5AW2 B;  2GZG A;  1T6A A;  2D2C C;  4U7J A;  3RBX A;  5KLV K;  5KP7 B;  3SWK A;  5AVR B;  1PP9 E;  2AVA A;  2VSQ A;  1H8A A;  3TNU B;  1HGZ A;  5F2N A;  3T97 B;  4K35 A;  1NAY A;  5AVU B;  1SQV K;  1SQP G;  3CD6 P;  5GTI E;  1MUU A;  3M1M A;  2YO2 A;  4M0I A;  3SSU A;  1BCC E;  1L0N J;  1YQ4 C;  3I5C A;  3B71 A;  2YO3 A;  3D70 A;  3L36 A;  3AE6 C;  1SQQ K;  5KKZ C;  1SVF A;  1XTG B;  2X2B A;  5APV A;  3CI9 A;  4OWF A;  2XV6 A;  1G1I A;  4C7R A;  1SFC C;  1S9K D;  3NY7 B;  3N7N A;  5GTH H;  1IZN B;  2M8R A;  1E5W A;  1SQV E;  3CWB E;  2KOG A;  4BPF A;  3V2N A;  1KQL A;  3E1I A;  5AVW B;  2KGA A;  2O3J A;  2JKV A;  1BDD A;  1M1J B;  3GZM A;  3A0H H;  1VHN A;  2VLP A;  2Q9I A;  2YIU B;  4PH0 A;  4OGQ D;  1JEK A;  1EZV D;  2EG5 A;  2HG5 D;  1RE3 A;  2KYV A;  2PEM A;  4UB6 E;  2ZXX A;  3V2P A;  3L72 J;  1P84 D;  1LP1 B;  3BCC J;  1BGY D;  3AEC C;  1URQ D;  2L0Q A;  1VKU A;  5HGM A;  1JTH A;  2DW3 A;  1NU1 K;  3KPE A;  3JCU E;  1JM0 A;  2FVF A;  2JJL A;  5TIS E;  2YKQ A;  3L71 G;  2IX7 C;  2K3R A;  4XFZ A;  2C9L Y;  2OTL P;  3DPH A;  1KB9 E;  4DOJ A;  1KTM A;  3HRN A;  1WT6 A;  4RJT A;  1LT9 B;  3L74 J;  3H1J E;  3H1I E;  4LLH A;  2OQQ A;  4LC1 A;  1N8R Q;  1NTM J;  2HR3 A;  1GD2 E;  2CG5 B;  1KYO I;  4RO0 A;  1VQO P;  4N3Y B;  1J1D B;  2LF4 A;  1LTI C;  2IZ0 A;  1QGK B;  1N7L A;  2WIT A;  4OGQ B;  1HWT C;  2BCC E;  1LTT C;  1ZOY C;  3Q5S A;  4C7N B;  2K9J B;  2Q3E A;  1USD A;  1R5L A;  2MKV A;  3L4F A;  1VQM P;  3II6 A;  1T2K D;  2RH0 A;  1URQ B;  3H1K G;  2YIU C;  1MFZ A;  1F80 D;  1YIT P;  4PWV B;  2FBW C;  1TU3 F;  1X0T A;  3L70 G;  2ZVN B;  3BAT A;  2K0X A;  1L0L G;  1Q82 Q;  2ONT A;  5F2O A;  2MF4 A;  2WMM A;  2AEM A;  2G3A A;  4GIF A;  3G3Z A;  3WMM 0;  4GR6 A;  3HE5 A;  2AXT H;  1MZ8 A;  1IFM A;  1LWU B;  1NO4 A;  1W5C E;  1N73 B;  2KS1 A;  3CCS P;  2FXP A;  1YHQ P;  2H7H A;  3F89 A;  1KQG B;  4PV1 D;  1RO2 A;  5AVX B;  3O6Q B;  1AVO A;  3G29 A;  2ZYD A;  1NVO A;  2IYP A;  2LKI A;  2XNX A;  2N5H A;  3OAK A;  1PV3 A;  1PFI A;  5CCH D;  3MUD C;  1RF0 A;  2QE7 H;  4NPD A;  2W90 A;  2OYI A;  2WPQ A;  1LT9 C;  5CBN A;  1OMI A;  4AQR D;  4L74 A;  3B4S A;  1PPJ G;  3VOP A;  1NTK E;  1ZRT E;  3LRY A;  1E79 H;  2YNY A;  3H1H J;  3V4W A;  2JAZ A;  4XA4 A;  1GL2 A;  2O01 J;  1HBW A;  3CX5 D;  1ZW0 A;  4CPG A;  1J1D C;  4PH1 A;  2NPS D;  2W83 C;  3H32 A;  1DD4 A;  1L4A D;  1X8Y A;  3RK3 E;  1YYC A;  1NTZ D;  2QM8 A;  2E74 D;  4XFX A;  2Y0D A;  1PP9 J;  5CZD B;  4U3F E;  5HGO A;  3BAS A;  5AVV B;  4HYT B;  1HJ0 A;  2LR2 A;  1ZR4 A;  2L22 A;  3A7O A;  1KYO H;  3HD7 D;  4PV1 B;  1ZME C;  2FYZ A;  2W8Z A;  2XXM A;  3S9O A;  2BEZ F;  2AFD A;  1EXI A;  2L91 A;  4TLF A;  1N7S A;  3KYQ A;  1GXG A;  1IFD A;  3L72 G;  4GDO A;  1LWU C;  2P9X A;  2KG8 A;  2ERH A;  2MR7 A;  2KGE A;  1OW7 A;  3BCC G;  2Z5I A;  3DTJ A;  5E79 H;  1HH0 A;  2IFM A;  1EOQ A;  1SQX K;  2WSC J;  1AYI A;  1PEM A;  1SQV J;  3CWB J;  3BRT B;  2GZI A;  1ZXG A;  2WWW A;  1KFM A;  3Q1M A;  4W7Y A;  5APX A;  4UB8 H;  1X22 A;  5C39 A;  2NPS B;  5KJ7 A;  1SQP D;  2ZT9 D;  5APS A;  4Z1M H;  3IF4 A;  1SQQ J;  4C46 A;  1KQS O;  1GMJ A;  1L4A B;  1K9M Q;  3M0D A;  2E74 B;  5BS2 A;  3L74 G;  5H2F H;  4H13 D;  2K88 A;  1PL5 A;  2I8D A;  3H0D A;  3C9I A;  3MTU E;  1T2K C;  3TYY A;  1R5S A;  5AW6 B;  1NTM G;  1FDM A;  3I55 P;  3PHL A;  2Q1K A;  2B87 B;  2QJY B;  3NXS A;  3HD7 B;  1NOH A;  1OX3 A;  1IFJ A;  1S5L H;  2O01 H;  3MP7 B;  2JEE A;  2PY8 A;  1VQ6 P;  3CXH H;  2RKL A;  2FXM A;  2KLV A;  4IL6 H;  4EI2 A;  1WRG A;  1S9K E;  3CC7 P;  1HVV A;  2N9B A;  3ZDM A;  2XV5 A;  3B5N D;  3BVH A;  2FAD A;  4PV1 C;  3L75 E;  1EC5 A;  1EXJ A;  2BHV A;  3KDP B;  3P32 A;  2KOR A;  4LGD E;  2P7J A;  3H1I J;  2JGP A;  2K9Y A;  5GTI H;  2ZT9 B;  4L73 A;  1N86 A;  5KP6 B;  1AFO A;  1SFC D;  5AW1 B;  2MY5 A;  2LXC B;  3L71 D;  1NKZ B;  2BCC J;  4I1L A;  1BGY E;  1OZH A;  1S72 P;  2KGC A;  2NPS C;  3AE7 C;  1L4A C;  2B89 A;  1T8K A;  1L2P A;  1FU1 A;  2E74 C;  3JSV C;  5AW0 B;  1IFI A;  3G4S P;  2J58 A;  3HE4 A;  2QG4 A;  1NGM B;  3RL0 g;  3HUS B;  1JY3 O;  3H1H G;  3G28 A;  1GK6 A;  3B5N B;  2QA4 P;  2VRS A;  2QJY C;  3HD7 C;  3GF3 A;  3WUV A;  2KK7 A;  2E5Y A;  2LOL A;  2FFD B;  4UB6 H;  2OTK E;  4ZNC A;  1CEI A;  1PP9 G;  3L73 D;  4IPY A;  5KAF E;  2J59 M;  3W67 A;  3MD0 A;  2OAR A;  1KV4 A;  1EIA A;  1G1J A;  3JCU H;  3D6Z A;  5TIS H;  1SFC B;  3H1K D;  2PEN A;  3EJE A;  2H89 C;  1FBM A;  3L70 D;  3AE4 C;  1H89 A;  1X3O A;  1KB9 H;  2FHS C;  1J1E C;  5KLV G;  2JQ4 A;  2ZT9 C;  3LID A;  3P7K A;  1HGV A;  1KIL B;  1H0T B;  5BU5 A;  2BAS A;  1SS1 A;  3IN6 A;  3TDK A;  1HF9 A;  4U0F A;  3G9R A;  4A7P A;  3AE9 C;  1SQV G;  3IFM A;  3CWB G;  1LJ2 A;  2QVA A;  2PNG A;  1PGQ A;  2EHS A;  4XFY A;  1HJB A;  2MR8 A;  1FZF A;  1SQQ G;  4EOT A;  2A06 G;  5B5E E;  3EFF K;  3HUS C;  3AE5 C;  4GOD A;  1GU5 A;  4I7Z B;  4DCK A;  3B5N C;  5APQ A;  3GZL A;  2PFX A;  3OA7 A;  3TF5 A;  2K94 A;  2FFD C;  5KLI B;  2N50 A;  1YIJ P;  1LT1 A;  2N5I A;  4BPG A;  1FDI A;  1FZC A;  3V2Q A;  4DZO A;  1LTS C;  2V4H A;  4PD4 H;  1DEB A;  2FVE A;  1NTZ E;  1JMB A;  1FDO A;  4Y28 J;  3G0V A;  3GF7 A;  2LML A;  3H1I G;  3VMX A;  3L72 D;  1KIL C;  3S1K A;  1RHZ B;  1NU1 G;  1SQX J;  3IAO A;  3BCC D;  1FZE A;  3CME P;  2KG6 A;  2ZVO B;  2KUB A;  2K2Q A;  4NPF X;  3E7K A;  4M3L A;  2JR8 A;  3GLM A;  3CC4 P;  2C0X A;  2WTY A;  2BCC G;  3WU2 E;  1OFC X;  1LTJ A;  1IJD B;  1NWQ A;  2IPP A;  1YBK A;  4Y99 B;  1G2C A;  1JTH B;  1M90 Q;  1LTB C;  4I6M C;  2C0W A;  1QLE D;  1FZG A;  4D6T G;  3NTN A;  2WVR A;  2DNW A;  1FE6 A;  3ABV C;  3L75 J;  1T3J A;  3L74 D;  4I7Z C;  2N6Y A;  4RES B;  4DJG A;  2FAE A;  1S1C X;  3AE3 C;  4OH8 B;  1NTM D;  2W6B A;  5KLI C;  1RNI A;  1ZNV A;  2KI7 B;  2WPT A;  5BS1 A;  2IYO A;  3D6Y A;  2UWJ E;  2KOQ A;  5CMZ A;  1KYO D;  2ZJS E;  1QL1 A;  3E2D A;  3LMO A;  1FZA A;  2N98 A;  1J2J B;  1BGY J;  1BSN A;  2Y9Y A;  1SP4 A;  2A45 H;  2RMZ A;  1VQK P;  1NH4 A;  2LIU A;  4H2Y C;  2ZYA A;  1KZU B;  1OW8 A;  2GUS A;  4BXL A;  2N1T A;  2E75 D;  1EMV A;  4BRY A;  1GL2 D;  2Q6Q A; 
#chains in the Genus database with same CATH homology
 2L6E A;  2EG5 A;  2Z45 A;  5HGL A;  1VQN P;  2PEM A;  1Q82 Q;  1PEQ A;  4XRO A;  2ONT A;  3I56 P;  3H47 A;  3HZQ A;  5F2O A;  3CPW O;  5HGN A;  2M8L A;  1Q81 Q;  3CMA P;  2P9X A;  2JYG A;  1PEU A;  1IUQ A;  4GR6 A;  1VQ9 P;  3CME P;  3NTE A;  5HGM A;  1AUM A;  3CCS P;  1QRJ A;  3DTJ A;  1YJW P;  1YHQ P;  3OW2 O;  3H4E A;  3DS5 A;  1EOQ A;  1RO2 A;  5F2K A;  1RO0 A;  2M8N A;  3CXC O;  3HYB A;  3CCE P;  2JO0 A;  1M6E X;  4U0F A;  3G29 A;  3CC4 P;  3CC2 P;  3DS0 A;  1PEM A;  2Z44 A;  3G6E P;  4XFZ A;  3WBH A;  5F2N A;  3CCJ P;  4U0A A;  1S72 P;  2OTL P;  1D1D A;  1M90 Q;  3DPH A;  2KOD A;  3G21 A;  2BQ1 E;  2DGY A;  3CD6 P;  2CWO A;  4XFY A;  4U0B A;  3P05 A;  1KQS O;  1KD1 Q;  1W2B O;  3M1M A;  4M0I A;  3CCR P;  1QVF O;  1VQ4 P;  1K9M Q;  3DS2 A;  5JPA A;  2JYL A;  1YI2 P;  5BS2 A;  2PEJ A;  3CCV P;  2BUO A;  3G4S P;  4U0C A;  4U0D A;  4WYM A;  3LRY A;  3CCL P;  4U0E A;  1N8R Q;  1PEO A;  3H0D A;  3MGE A;  3G28 A;  1VQL P;  2QA4 P;  2XV6 A;  2XT1 A;  4PH1 A;  4COC A;  3I55 P;  3CCU P;  1VQO P;  1YJN P;  1QVG O;  2LF4 A;  3DS4 A;  3G1G A;  1KC8 Q;  1K8A Q;  2OTJ P;  1Q86 Q;  5DCK A;  1VQP P;  1RNI A;  5BS1 A;  1Q7Y Q;  3G1I A;  1YIJ P;  1VQ7 P;  4COP A;  1YJ9 P;  2PY8 A;  4GR2 A;  1VQ6 P;  1ZMB A;  2PEO A;  3RG6 C;  4XFX A;  1A43 A;  2EFJ A;  2Z46 A;  3G26 A;  3VRL C;  3CC7 P;  3E2D A;  1BAJ A;  4IPY A;  1K73 Q;  4XRQ A;  2EIA A;  4QNB A;  5HGO A;  3CCM P;  1E6J P;  1NJI Q;  1VQM P;  1K30 A;  3Q20 A;  2E1M A;  1M74 A;  5I4T G;  2OAR A;  3DS1 A;  3DS3 A;  1EIA A;  3G71 P;  1VQK P;  2PEK A;  2QEX P;  1M6N A;  1A8O A;  1VQ8 P;  1YIT P;  1M1K Q;  2PEN A;  3CCQ P;  2PEI A;  3B5I A;  1JJ2 O;  3G0V A;  2XXM A;  1VQ5 P;  2BHV A;  4PH0 A;  2M8P A;  2PEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...