4MRTC

Structure of the phosphopantetheine transferase sfp in complex with coenzyme a and a peptidyl carrier protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/transferase
molecule keywords Tyrocidine synthase 3
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4mrtC00
2MY5A 2K0YA 2PNGA 2JGPA 1HY8A 2CNRA 1KLPA 2JQ4A 2JU2A 4H2YC 1F80D 2N50A 3EJBA 2AFDA 2KOSA 2MD9A 2KWLA 5HV8A 2KGEA 2CQ8A 2KOPA 4PXHB 1DNYA 2KGAA 3CE7A 2MR8A 2ROQA 2XZ0D 2FVEA 2DNWA 2LOLA 2K92A 5KP7B 2KOOA 2LKIA 4BPGA 1L0HA 5KP8B 2QNWA 5EJDA 1AF8A 3LMOA 4MRTC 1VKUA 1OR5A 2N5HA 2LMLA 2M5RA 4HKGA 4PWVB 2KORA 2FADA 5KP6B 5HVCA 2FHSC 2GDYA 4CA3A 1HQBA 2KGCA 2CG5B 2LTEA 2EHTA 2MF4A 3EJDA 2KG6A 2L22A 4H2XC 2FACA 2VSQA 3GZMA 1T8KA 2L0QA 3NY7B 2AFEA 2FQ0A 2MVVA 2K0XA 4NEOA 4BPFA 2N98A 4H2WC 2JU1A 3EJEA 2KG8A 2MVUA 2CGQA 2LIUA 2X2BA 2XZ1C 4BPHA 2L9FA 4R0MA 2FQ2A 2N6YA 2AF8A 2LPKA 2EHSA 1X3OA 4IZ6A 2FVAA 2GDXA 2L4BA 2GDWA 3RG2A 2FVFA 2K94A 2AVAA 2KOQA 1DV5A 4DG9A 1L0IA 2K2QA 2LL8A 2N6ZA 2K93A 1NQ4A 2FQ1A 2MR7A 3GZLA 2KR5A 2KW2A 2FAEA 5CZDB 1ACPA 2KGDA 2N5IA 2KG9A 2LIWA
chains in the Genus database with same CATH superfamily
2PNGA 1Q82Q 1VQ8P 2JGPA 3CCMP 2CNRA 3G0VA 2JU2A 4H2YC 1YI2P 4PH1A 2JB0A 2OTJP 1VQLP 1M6EX 2AFDA 2MD9A 2KOPA 3CE7A 1K73Q 3WBHA 4XFYA 3CCLP 3VRLC 2K92A 4GR2A 2LKIA 1L0HA 1AUMA 5F2NA 2QA4P 2N5HA 2PEJA 2LMLA 3G21A 2FADA 2XXMA 3CMAP 3Q20A 1HQBA 2KGCA 4XFZA 3B4QA 2LTEA 2M8PA 3B5IA 2LF4A 2L22A 1MZ8A 1NJIQ 2VSQA 2PEQA 2PY8A 3NY7B 3DS2A 2AFEA 3CC2P 2Z44A 1EOQA 4COCA 2FQ0A 2K0XA 4BPFA 1QRJA 4U0DA 2P9XA 3DS3A 3HZQA 1VQMP 1IUQA 2GZGA 2K5XA 2CGQA 1GPJA 5HGNA 1K9MQ 1KQSO 2N6YA 2L4BA 3RG2A 3CXCO 2K94A 2VLOA 3CCSP 1DV5A 4U0BA 1L0IA 2BHVA 3U43A 3G29A 2KR5A 3I56P 2BUOA 2FAEA 1FR2A 2MY5A 1EMVA 4XFXA 3H0DA 3DTJA 1KLPA 2JQ4A 1E6JP 2N50A 2KOSA 2KWLA 2CQ8A 1M90Q 3I55P 4QNBA 1VHNA 3G1GA 2DNWA 1YHQP 2QNWA 3LMOA 1OR5A 1ZMBA 2M5RA 2Z45A 1A8OA 4PWVB 3G4SP 4U0EA 2DGYA 5HGMA 5KP6B 4F37A 1YIJP 3CC7P 4H2XC 2FACA 4IPYA 2L0QA 2Z46A 5BS1A 2E1MA 1UJZA 3CCJP 2MVVA 1BAJA 4H2WC 5F2KA 1KD1Q 3EJEA 3G28A 1BXIA 1M1KQ 2GZIA 2X2BA 4BPHA 1VQ9P 4PH0A 4R0MA 1QVGO 2FQ2A 4QKOA 5DCKA 1VQOP 3G26A 3CCQP 2PEOA 1D1DA 2ONTA 1VQNP 4DG9A 2PENA 2LL8A 2JO0A 1NQ4A 2FQ1A 2JAZA 2MR7A 3GZLA 1VQ4P 1ACPA 2KGDA 3M1MA 2EG5A 5HGLA 5JPAA 1KC8Q 3H47A 2ERHA 2K0YA 3HYBA 1RO0A 2QEXP 1W2BO 1F80D 4WYMA 1VQ6P 3CMEP 2JBGA 5BS2A 5HV8A 2KGEA 4XROA 2KGAA 1M74A 1YJNP 3OW2O 2MR8A 2FVEA 2LOLA 2GZFA 2VLPA 1VQKP 5EJDA 3CCUP 1AF8A 4MRTC 1VKUA 5I4TG 3DPHA 5HGOA 4HKGA 1YITP 3DS4A 2PEIA 2GDYA 4CA3A 2CG5B 2EHTA 2MF4A 2PEMA 4COPA 1T8KA 1ZNVA 3DS1A 5F2OA 3LRYA 3GJNA 2N98A 3P05A 3RG6C 2KG8A 1M6NA 2LIUA 3E2DA 2XZ1C 1JJ2O 4GR6A 2L9FA 3GKLC 1VQ7P 3CCEP 1VQ5P 2LPKA 2CWOA 1Q81Q 1RO2A 2M8LA 2GDXA 3CCVP 2GYKA 2EFJA 2VLQA 2GZJA 2OARA 1Q86Q 2XV6A 3G71P 2KG9A 2LIWA 1RNIA 1UNKA 1VQPP 2WPTA 1HY8A 1S72P 3NTEA 2K0DX 4U0AA 4UHPB 1GXGA 1GXHA 3EJBA 5EW5E 2JYLA 1DNYA 4PXHB 1K30A 4M0IA 2ROQA 1Q7YQ 2XZ0D 1N8RQ 3CC4P 5KP7B 2KOOA 4U0FA 4BPGA 3DS0A 5KP8B 2L6EA 2XT1A 1EIAA 1IMQA 2KORA 5HVCA 2FHSC 3G1IA 2EIAA 1AYIA 3MGEA 3EJDA 2KG6A 2VLNA 3GZMA 1YJWP 1QVFO 2OTLP 7CEIA 1Z6MA 2KODA 4NEOA 2GZEA 2JYGA 2JU1A 2M8NA 2MVUA 1CEIA 3H4EA 3CD6P 2AF8A 2EHSA 1X3OA 1YJ9P 4IZ6A 2FVAA 1E0HA 2GDWA 4U0CA 2FVFA 2PEKA 3DS5A 2AVAA 2KOQA 3CCRP 1A43A 2K2QA 2N6ZA 2K93A 2KW2A 5CZDB 2N5IA 1IMPA 3CPWO 4XRQA 3G6EP 2NO8A 1K8AQ
chains in the Genus database with same CATH topology
2MY5A 2K0YA 2PNGA 2JGPA 1HY8A 2CNRA 1KLPA 2JQ4A 2JU2A 4H2YC 1F80D 2N50A 3EJBA 2AFDA 2KOSA 2MD9A 2KWLA 5HV8A 2KGEA 2CQ8A 2KOPA 4PXHB 1DNYA 2KGAA 3CE7A 2MR8A 2ROQA 2XZ0D 2FVEA 2DNWA 2LOLA 2K92A 5KP7B 2KOOA 2LKIA 4BPGA 1L0HA 5KP8B 2QNWA 5EJDA 1AF8A 3LMOA 4MRTC 1VKUA 1OR5A 2N5HA 2LMLA 2M5RA 4HKGA 4PWVB 2KORA 2FADA 5KP6B 5HVCA 2FHSC 2GDYA 4CA3A 1HQBA 2KGCA 2CG5B 2LTEA 2EHTA 2MF4A 3EJDA 2KG6A 2L22A 4H2XC 2FACA 2VSQA 3GZMA 1T8KA 2L0QA 3NY7B 2AFEA 2FQ0A 2MVVA 2K0XA 4NEOA 4BPFA 2N98A 4H2WC 2JU1A 3EJEA 2KG8A 2MVUA 2CGQA 2LIUA 2X2BA 2XZ1C 4BPHA 2L9FA 4R0MA 2FQ2A 2N6YA 2AF8A 2LPKA 2EHSA 1X3OA 4IZ6A 2FVAA 2GDXA 2L4BA 2GDWA 3RG2A 2FVFA 2K94A 2AVAA 2KOQA 1DV5A 4DG9A 1L0IA 2K2QA 2LL8A 2N6ZA 2K93A 1NQ4A 2FQ1A 2MR7A 3GZLA 2KR5A 2KW2A 2FAEA 5CZDB 1ACPA 2KGDA 2N5IA 2KG9A 2LIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  2K0Y A;  2PNG A;  2JGP A;  1HY8 A;  2CNR A;  1KLP A;  2JQ4 A;  2JU2 A;  4H2Y C;  1F80 D;  2N50 A;  3EJB A;  2AFD A;  2KOS A;  2MD9 A;  2KWL A;  5HV8 A;  2KGE A;  2CQ8 A;  2KOP A;  4PXH B;  1DNY A;  2KGA A;  3CE7 A;  2MR8 A;  2ROQ A;  2XZ0 D;  2FVE A;  2DNW A;  2LOL A;  2K92 A;  5KP7 B;  2KOO A;  2LKI A;  4BPG A;  1L0H A;  5KP8 B;  2QNW A;  5EJD A;  1AF8 A;  3LMO A;  4MRT C;  1VKU A;  1OR5 A;  2N5H A;  2LML A;  2M5R A;  4HKG A;  4PWV B;  2KOR A;  2FAD A;  5KP6 B;  5HVC A;  2FHS C;  2GDY A;  4CA3 A;  1HQB A;  2KGC A;  2CG5 B;  2LTE A;  2EHT A;  2MF4 A;  3EJD A;  2KG6 A;  2L22 A;  4H2X C;  2FAC A;  2VSQ A;  3GZM A;  1T8K A;  2L0Q A;  3NY7 B;  2AFE A;  2FQ0 A;  2MVV A;  2K0X A;  4NEO A;  4BPF A;  2N98 A;  4H2W C;  2JU1 A;  3EJE A;  2KG8 A;  2MVU A;  2CGQ A;  2LIU A;  2X2B A;  2XZ1 C;  4BPH A;  2L9F A;  4R0M A;  2FQ2 A;  2N6Y A;  2AF8 A;  2LPK A;  2EHS A;  1X3O A;  4IZ6 A;  2FVA A;  2GDX A;  2L4B A;  2GDW A;  3RG2 A;  2FVF A;  2K94 A;  2AVA A;  2KOQ A;  1DV5 A;  4DG9 A;  1L0I A;  2K2Q A;  2LL8 A;  2N6Z A;  2K93 A;  1NQ4 A;  2FQ1 A;  2MR7 A;  3GZL A;  2KR5 A;  2KW2 A;  2FAE A;  5CZD B;  1ACP A;  2KGD A;  2N5I A;  2KG9 A;  2LIW A; 
#chains in the Genus database with same CATH topology
 2PNG A;  1Q82 Q;  1VQ8 P;  2JGP A;  3CCM P;  2CNR A;  3G0V A;  2JU2 A;  4H2Y C;  1YI2 P;  4PH1 A;  2JB0 A;  2OTJ P;  1VQL P;  1M6E X;  2AFD A;  2MD9 A;  2KOP A;  3CE7 A;  1K73 Q;  3WBH A;  4XFY A;  3CCL P;  3VRL C;  2K92 A;  4GR2 A;  2LKI A;  1L0H A;  1AUM A;  5F2N A;  2QA4 P;  2N5H A;  2PEJ A;  2LML A;  3G21 A;  2FAD A;  2XXM A;  3CMA P;  3Q20 A;  1HQB A;  2KGC A;  4XFZ A;  3B4Q A;  2LTE A;  2M8P A;  3B5I A;  2LF4 A;  2L22 A;  1MZ8 A;  1NJI Q;  2VSQ A;  2PEQ A;  2PY8 A;  3NY7 B;  3DS2 A;  2AFE A;  3CC2 P;  2Z44 A;  1EOQ A;  4COC A;  2FQ0 A;  2K0X A;  4BPF A;  1QRJ A;  4U0D A;  2P9X A;  3DS3 A;  3HZQ A;  1VQM P;  1IUQ A;  2GZG A;  2K5X A;  2CGQ A;  1GPJ A;  5HGN A;  1K9M Q;  1KQS O;  2N6Y A;  2L4B A;  3RG2 A;  3CXC O;  2K94 A;  2VLO A;  3CCS P;  1DV5 A;  4U0B A;  1L0I A;  2BHV A;  3U43 A;  3G29 A;  2KR5 A;  3I56 P;  2BUO A;  2FAE A;  1FR2 A;  2MY5 A;  1EMV A;  4XFX A;  3H0D A;  3DTJ A;  1KLP A;  2JQ4 A;  1E6J P;  2N50 A;  2KOS A;  2KWL A;  2CQ8 A;  1M90 Q;  3I55 P;  4QNB A;  1VHN A;  3G1G A;  2DNW A;  1YHQ P;  2QNW A;  3LMO A;  1OR5 A;  1ZMB A;  2M5R A;  2Z45 A;  1A8O A;  4PWV B;  3G4S P;  4U0E A;  2DGY A;  5HGM A;  5KP6 B;  4F37 A;  1YIJ P;  3CC7 P;  4H2X C;  2FAC A;  4IPY A;  2L0Q A;  2Z46 A;  5BS1 A;  2E1M A;  1UJZ A;  3CCJ P;  2MVV A;  1BAJ A;  4H2W C;  5F2K A;  1KD1 Q;  3EJE A;  3G28 A;  1BXI A;  1M1K Q;  2GZI A;  2X2B A;  4BPH A;  1VQ9 P;  4PH0 A;  4R0M A;  1QVG O;  2FQ2 A;  4QKO A;  5DCK A;  1VQO P;  3G26 A;  3CCQ P;  2PEO A;  1D1D A;  2ONT A;  1VQN P;  4DG9 A;  2PEN A;  2LL8 A;  2JO0 A;  1NQ4 A;  2FQ1 A;  2JAZ A;  2MR7 A;  3GZL A;  1VQ4 P;  1ACP A;  2KGD A;  3M1M A;  2EG5 A;  5HGL A;  5JPA A;  1KC8 Q;  3H47 A;  2ERH A;  2K0Y A;  3HYB A;  1RO0 A;  2QEX P;  1W2B O;  1F80 D;  4WYM A;  1VQ6 P;  3CME P;  2JBG A;  5BS2 A;  5HV8 A;  2KGE A;  4XRO A;  2KGA A;  1M74 A;  1YJN P;  3OW2 O;  2MR8 A;  2FVE A;  2LOL A;  2GZF A;  2VLP A;  1VQK P;  5EJD A;  3CCU P;  1AF8 A;  4MRT C;  1VKU A;  5I4T G;  3DPH A;  5HGO A;  4HKG A;  1YIT P;  3DS4 A;  2PEI A;  2GDY A;  4CA3 A;  2CG5 B;  2EHT A;  2MF4 A;  2PEM A;  4COP A;  1T8K A;  1ZNV A;  3DS1 A;  5F2O A;  3LRY A;  3GJN A;  2N98 A;  3P05 A;  3RG6 C;  2KG8 A;  1M6N A;  2LIU A;  3E2D A;  2XZ1 C;  1JJ2 O;  4GR6 A;  2L9F A;  3GKL C;  1VQ7 P;  3CCE P;  1VQ5 P;  2LPK A;  2CWO A;  1Q81 Q;  1RO2 A;  2M8L A;  2GDX A;  3CCV P;  2GYK A;  2EFJ A;  2VLQ A;  2GZJ A;  2OAR A;  1Q86 Q;  2XV6 A;  3G71 P;  2KG9 A;  2LIW A;  1RNI A;  1UNK A;  1VQP P;  2WPT A;  1HY8 A;  1S72 P;  3NTE A;  2K0D X;  4U0A A;  4UHP B;  1GXG A;  1GXH A;  3EJB A;  5EW5 E;  2JYL A;  1DNY A;  4PXH B;  1K30 A;  4M0I A;  2ROQ A;  1Q7Y Q;  2XZ0 D;  1N8R Q;  3CC4 P;  5KP7 B;  2KOO A;  4U0F A;  4BPG A;  3DS0 A;  5KP8 B;  2L6E A;  2XT1 A;  1EIA A;  1IMQ A;  2KOR A;  5HVC A;  2FHS C;  3G1I A;  2EIA A;  1AYI A;  3MGE A;  3EJD A;  2KG6 A;  2VLN A;  3GZM A;  1YJW P;  1QVF O;  2OTL P;  7CEI A;  1Z6M A;  2KOD A;  4NEO A;  2GZE A;  2JYG A;  2JU1 A;  2M8N A;  2MVU A;  1CEI A;  3H4E A;  3CD6 P;  2AF8 A;  2EHS A;  1X3O A;  1YJ9 P;  4IZ6 A;  2FVA A;  1E0H A;  2GDW A;  4U0C A;  2FVF A;  2PEK A;  3DS5 A;  2AVA A;  2KOQ A;  3CCR P;  1A43 A;  2K2Q A;  2N6Z A;  2K93 A;  2KW2 A;  5CZD B;  2N5I A;  1IMP A;  3CPW O;  4XRQ A;  3G6E P;  2NO8 A;  1K8A Q; 
#chains in the Genus database with same CATH homology
 2MY5 A;  2K0Y A;  2PNG A;  2JGP A;  1HY8 A;  2CNR A;  1KLP A;  2JQ4 A;  2JU2 A;  4H2Y C;  1F80 D;  2N50 A;  3EJB A;  2AFD A;  2KOS A;  2MD9 A;  2KWL A;  5HV8 A;  2KGE A;  2CQ8 A;  2KOP A;  4PXH B;  1DNY A;  2KGA A;  3CE7 A;  2MR8 A;  2ROQ A;  2XZ0 D;  2FVE A;  2DNW A;  2LOL A;  2K92 A;  5KP7 B;  2KOO A;  2LKI A;  4BPG A;  1L0H A;  5KP8 B;  2QNW A;  5EJD A;  1AF8 A;  3LMO A;  4MRT C;  1VKU A;  1OR5 A;  2N5H A;  2LML A;  2M5R A;  4HKG A;  4PWV B;  2KOR A;  2FAD A;  5KP6 B;  5HVC A;  2FHS C;  2GDY A;  4CA3 A;  1HQB A;  2KGC A;  2CG5 B;  2LTE A;  2EHT A;  2MF4 A;  3EJD A;  2KG6 A;  2L22 A;  4H2X C;  2FAC A;  2VSQ A;  3GZM A;  1T8K A;  2L0Q A;  3NY7 B;  2AFE A;  2FQ0 A;  2MVV A;  2K0X A;  4NEO A;  4BPF A;  2N98 A;  4H2W C;  2JU1 A;  3EJE A;  2KG8 A;  2MVU A;  2CGQ A;  2LIU A;  2X2B A;  2XZ1 C;  4BPH A;  2L9F A;  4R0M A;  2FQ2 A;  2N6Y A;  2AF8 A;  2LPK A;  2EHS A;  1X3O A;  4IZ6 A;  2FVA A;  2GDX A;  2L4B A;  2GDW A;  3RG2 A;  2FVF A;  2K94 A;  2AVA A;  2KOQ A;  1DV5 A;  4DG9 A;  1L0I A;  2K2Q A;  2LL8 A;  2N6Z A;  2K93 A;  1NQ4 A;  2FQ1 A;  2MR7 A;  3GZL A;  2KR5 A;  2KW2 A;  2FAE A;  5CZD B;  1ACP A;  2KGD A;  2N5I A;  2KG9 A;  2LIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...