4MRTC

Structure of the phosphopantetheine transferase sfp in complex with coenzyme a and a peptidyl carrier protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
b'YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthase 3
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Transport protein/transferase
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4mrtC00
4R0MA 2QNWA 2FHSC 2GDWA 5CZDB 2K94A 2CQ8A 2N50A 4IZ6A 2K93A 2KOSA 3EJDA 1T8KA 2LOLA 2KG9A 2KGAA 2CNRA 2LPKA 4NEOA 2LL8A 2MD9A 4BPGA 2FADA 2DNWA 2KG8A 4H2WC 1HQBA 3EJEA 2FAEA 2MY5A 2JGPA 2LMLA 2ROQA 2XZ0D 4BPHA 1DNYA 2K0XA 3GZMA 2L9FA 2N6ZA 3LMOA 2KORA 5HVCA 2AF8A 1X3OA 3RG2A 1L0IA 5EJDA 2MR7A 1NQ4A 4PXHB 2FVAA 2JQ4A 2FACA 2KGCA 5KP8B 2L0QA 2N6YA 4H2XC 1KLPA 2FVEA 2M5RA 2LIWA 1ACPA 2GDYA 2KOQA 2AFDA 1L0HA 2K2QA 1HY8A 2LIUA 2N5IA 2FQ1A 2FVFA 2K0YA 4DG9A 2KGEA 2KW2A 2CGQA 2X2BA 3EJBA 5HV8A 1AF8A 2MF4A 2FQ2A 2MVUA 2CG5B 5KP7B 2PNGA 2JU2A 2GDXA 2XZ1C 2EHSA 4MRTC 4H2YC 2KR5A 2LTEA 2MR8A 2KOOA 2VSQA 2AFEA 2EHTA 1F80D 1DV5A 2KWLA 3NY7B 2L22A 3GZLA 2LKIA 2KGDA 1OR5A 2FQ0A 2JU1A 2AVAA 4PWVB 2N98A 2K92A 2L4BA 2MVVA 4HKGA 2KG6A 4CA3A 5KP6B 4BPFA 2N5HA 2KOPA 3CE7A 1VKUA
chains in the Genus database with same CATH superfamily
4GR2A 3DPHA 2PEKA 3DS4A 4XROA 2L6EA 2Z46A 3CMEP 1N8RQ 4U0EA 2P9XA 3GJNA 1GXHA 1IUQA 3DTJA 1K73Q 2N50A 5JPAA 2K93A 1T8KA 2KG9A 4WYMA 2LPKA 2MD9A 2GZJA 1S72P 4XFXA 4H2WC 3EJEA 2LMLA 2EG5A 2XZ0D 1YIJP 3CXCO 3P05A 3CPWO 1DNYA 3G1IA 2GZGA 2AF8A 3CCEP 1X3OA 1EIAA 2JAZA 3G28A 3CC4P 2K0DX 4PXHB 2QEXP 2FACA 4F37A 2KGCA 5EW5E 5KP8B 4U0CA 1YHQP 5HGMA 1GXGA 2LIWA 3CC7P 2GDYA 1QVGO 1L0HA 3LRYA 1HY8A 4DG9A 2KW2A 2CGQA 2EIAA 2VLOA 2M8NA 3G0VA 2PNGA 2GDXA 2GZFA 1M6NA 2PEJA 2LTEA 3E2DA 1Q82Q 3CCSP 3CCLP 1DV5A 3VRLC 2KWLA 1K9MQ 3CCQP 2PY8A 1OR5A 1VQNP 2JU1A 1IMPA 3GKLC 2PEOA 1VQ8P 2K92A 4HKGA 3H47A 3HZQA 1YJNP 2GDWA 2OTLP 1Q81Q 5HGOA 1VHNA 3I55P 1NJIQ 2LF4A 2JBGA 2GZIA 4IZ6A 2KOSA 3EJDA 2KGAA 4NEOA 4M0IA 4BPGA 5F2KA 2KG8A 1HQBA 2ROQA 2OARA 2L9FA 3LMOA 1VQLP 1RNIA 2QA4P 5HVCA 3G21A 1UJZA 2BHVA 1L0IA 4QKOA 1W2BO 3DS2A 2M8PA 2JQ4A 2L0QA 3MGEA 1ACPA 3CCMP 2PEMA 4XFYA 2FQ1A 2GYKA 2FVFA 3Q20A 2K0YA 1KD1Q 2KGEA 2PEIA 5I4TG 1EOQA 1JJ2O 2FQ2A 3WBHA 1Q86Q 1YJ9P 2Z45A 4COCA 2XZ1C 2KR5A 3I56P 1VQOP 2AFEA 2ERHA 2L22A 2PEQA 3GZLA 2KGDA 2FQ0A 2WPTA 1VQMP 4PWVB 2DGYA 4U0FA 2N98A 4GR6A 1UNKA 2MVVA 4XRQA 1YJWP 5KP6B 3CE7A 1RO0A 1K8AQ 1VQKP 5F2OA 2FHSC 3G1GA 5CZDB 2PENA 3G71P 2K94A 4PH1A 1M74A 1CEIA 2LOLA 2CNRA 3U43A 7CEIA 2LL8A 1D1DA 3CCVP 3NTEA 1QVFO 2VLNA 4COPA 1KC8Q 2FAEA 1VQPP 3B5IA 1AYIA 4U0BA 3GZMA 2N6ZA 2M8LA 2KORA 5F2NA 2VLPA 1QRJA 1Q7YQ 1NQ4A 2FVAA 4IPYA 1Z6MA 3CCRP 1K30A 2N6YA 2FVEA 2M5RA 1M1KQ 2KOQA 4PH0A 2N5IA 3DS3A 5HGNA 2BUOA 3DS5A 3B4QA 2X2BA 5HV8A 1YITP 3DS0A 1AF8A 2MF4A 3RG6C 2MVUA 2CG5B 1FR2A 2K5XA 5KP7B 2JU2A 4MRTC 2MR8A 2KOOA 2EFJA 1VQ7P 1F80D 3NY7B 3G6EP 2LKIA 2JO0A 2L4BA 3M1MA 2KG6A 1BAJA 4CA3A 3HYBA 1MZ8A 2N5HA 2KOPA 4QNBA 3G4SP 4R0MA 2QNWA 1EMVA 1AUMA 5DCKA 2VLQA 2CQ8A 2XV6A 4XFZA 3G29A 1YI2P 1A8OA 2FADA 2DNWA 1M6EX 2MY5A 2JGPA 4BPHA 1GPJA 2K0XA 2XXMA 3CC2P 2KODA 2NO8A 2XT1A 1RO2A 3DS1A 3RG2A 1E6JP 1E0HA 2E1MA 5EJDA 2MR7A 5HGLA 3G26A 2JB0A 2ONTA 4H2XC 1KLPA 1VQ5P 1KQSO 3H4EA 1IMQA 2AFDA 2K2QA 2LIUA 5BS1A 3CMAP 2OTJP 3CCUP 3CD6P 1BXIA 1VQ9P 2GZEA 1VQ4P 3EJBA 5BS2A 1ZMBA 3OW2O 2JYLA 3CCJP 2EHSA 4H2YC 2VSQA 2JYGA 4U0DA 1M90Q 2EHTA 1ZNVA 1A43A 2AVAA 3H0DA 1VQ6P 2CWOA 2Z44A 4U0AA 4BPFA 4UHPB 1VKUA
chains in the Genus database with same CATH topology
4R0MA 2QNWA 2FHSC 2GDWA 5CZDB 2K94A 2CQ8A 2N50A 4IZ6A 2K93A 2KOSA 3EJDA 1T8KA 2LOLA 2KG9A 2KGAA 2CNRA 2LPKA 4NEOA 2LL8A 2MD9A 4BPGA 2FADA 2DNWA 2KG8A 4H2WC 1HQBA 3EJEA 2FAEA 2MY5A 2JGPA 2LMLA 2ROQA 2XZ0D 4BPHA 1DNYA 2K0XA 3GZMA 2L9FA 2N6ZA 3LMOA 2KORA 5HVCA 2AF8A 1X3OA 3RG2A 1L0IA 5EJDA 2MR7A 1NQ4A 4PXHB 2FVAA 2JQ4A 2FACA 2KGCA 5KP8B 2L0QA 2N6YA 4H2XC 1KLPA 2FVEA 2M5RA 2LIWA 1ACPA 2GDYA 2KOQA 2AFDA 1L0HA 2K2QA 1HY8A 2LIUA 2N5IA 2FQ1A 2FVFA 2K0YA 4DG9A 2KGEA 2KW2A 2CGQA 2X2BA 3EJBA 5HV8A 1AF8A 2MF4A 2FQ2A 2MVUA 2CG5B 5KP7B 2PNGA 2JU2A 2GDXA 2XZ1C 2EHSA 4MRTC 4H2YC 2KR5A 2LTEA 2MR8A 2KOOA 2VSQA 2AFEA 2EHTA 1F80D 1DV5A 2KWLA 3NY7B 2L22A 3GZLA 2LKIA 2KGDA 1OR5A 2FQ0A 2JU1A 2AVAA 4PWVB 2N98A 2K92A 2L4BA 2MVVA 4HKGA 2KG6A 4CA3A 5KP6B 4BPFA 2N5HA 2KOPA 3CE7A 1VKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R0M A;  2QNW A;  2FHS C;  2GDW A;  5CZD B;  2K94 A;  2CQ8 A;  2N50 A;  4IZ6 A;  2K93 A;  2KOS A;  3EJD A;  1T8K A;  2LOL A;  2KG9 A;  2KGA A;  2CNR A;  2LPK A;  4NEO A;  2LL8 A;  2MD9 A;  4BPG A;  2FAD A;  2DNW A;  2KG8 A;  4H2W C;  1HQB A;  3EJE A;  2FAE A;  2MY5 A;  2JGP A;  2LML A;  2ROQ A;  2XZ0 D;  4BPH A;  1DNY A;  2K0X A;  3GZM A;  2L9F A;  2N6Z A;  3LMO A;  2KOR A;  5HVC A;  2AF8 A;  1X3O A;  3RG2 A;  1L0I A;  5EJD A;  2MR7 A;  1NQ4 A;  4PXH B;  2FVA A;  2JQ4 A;  2FAC A;  2KGC A;  5KP8 B;  2L0Q A;  2N6Y A;  4H2X C;  1KLP A;  2FVE A;  2M5R A;  2LIW A;  1ACP A;  2GDY A;  2KOQ A;  2AFD A;  1L0H A;  2K2Q A;  1HY8 A;  2LIU A;  2N5I A;  2FQ1 A;  2FVF A;  2K0Y A;  4DG9 A;  2KGE A;  2KW2 A;  2CGQ A;  2X2B A;  3EJB A;  5HV8 A;  1AF8 A;  2MF4 A;  2FQ2 A;  2MVU A;  2CG5 B;  5KP7 B;  2PNG A;  2JU2 A;  2GDX A;  2XZ1 C;  2EHS A;  4MRT C;  4H2Y C;  2KR5 A;  2LTE A;  2MR8 A;  2KOO A;  2VSQ A;  2AFE A;  2EHT A;  1F80 D;  1DV5 A;  2KWL A;  3NY7 B;  2L22 A;  3GZL A;  2LKI A;  2KGD A;  1OR5 A;  2FQ0 A;  2JU1 A;  2AVA A;  4PWV B;  2N98 A;  2K92 A;  2L4B A;  2MVV A;  4HKG A;  2KG6 A;  4CA3 A;  5KP6 B;  4BPF A;  2N5H A;  2KOP A;  3CE7 A;  1VKU A; 
#chains in the Genus database with same CATH topology
 4GR2 A;  3DPH A;  2PEK A;  3DS4 A;  4XRO A;  2L6E A;  2Z46 A;  3CME P;  1N8R Q;  4U0E A;  2P9X A;  3GJN A;  1GXH A;  1IUQ A;  3DTJ A;  1K73 Q;  2N50 A;  5JPA A;  2K93 A;  1T8K A;  2KG9 A;  4WYM A;  2LPK A;  2MD9 A;  2GZJ A;  1S72 P;  4XFX A;  4H2W C;  3EJE A;  2LML A;  2EG5 A;  2XZ0 D;  1YIJ P;  3CXC O;  3P05 A;  3CPW O;  1DNY A;  3G1I A;  2GZG A;  2AF8 A;  3CCE P;  1X3O A;  1EIA A;  2JAZ A;  3G28 A;  3CC4 P;  2K0D X;  4PXH B;  2QEX P;  2FAC A;  4F37 A;  2KGC A;  5EW5 E;  5KP8 B;  4U0C A;  1YHQ P;  5HGM A;  1GXG A;  2LIW A;  3CC7 P;  2GDY A;  1QVG O;  1L0H A;  3LRY A;  1HY8 A;  4DG9 A;  2KW2 A;  2CGQ A;  2EIA A;  2VLO A;  2M8N A;  3G0V A;  2PNG A;  2GDX A;  2GZF A;  1M6N A;  2PEJ A;  2LTE A;  3E2D A;  1Q82 Q;  3CCS P;  3CCL P;  1DV5 A;  3VRL C;  2KWL A;  1K9M Q;  3CCQ P;  2PY8 A;  1OR5 A;  1VQN P;  2JU1 A;  1IMP A;  3GKL C;  2PEO A;  1VQ8 P;  2K92 A;  4HKG A;  3H47 A;  3HZQ A;  1YJN P;  2GDW A;  2OTL P;  1Q81 Q;  5HGO A;  1VHN A;  3I55 P;  1NJI Q;  2LF4 A;  2JBG A;  2GZI A;  4IZ6 A;  2KOS A;  3EJD A;  2KGA A;  4NEO A;  4M0I A;  4BPG A;  5F2K A;  2KG8 A;  1HQB A;  2ROQ A;  2OAR A;  2L9F A;  3LMO A;  1VQL P;  1RNI A;  2QA4 P;  5HVC A;  3G21 A;  1UJZ A;  2BHV A;  1L0I A;  4QKO A;  1W2B O;  3DS2 A;  2M8P A;  2JQ4 A;  2L0Q A;  3MGE A;  1ACP A;  3CCM P;  2PEM A;  4XFY A;  2FQ1 A;  2GYK A;  2FVF A;  3Q20 A;  2K0Y A;  1KD1 Q;  2KGE A;  2PEI A;  5I4T G;  1EOQ A;  1JJ2 O;  2FQ2 A;  3WBH A;  1Q86 Q;  1YJ9 P;  2Z45 A;  4COC A;  2XZ1 C;  2KR5 A;  3I56 P;  1VQO P;  2AFE A;  2ERH A;  2L22 A;  2PEQ A;  3GZL A;  2KGD A;  2FQ0 A;  2WPT A;  1VQM P;  4PWV B;  2DGY A;  4U0F A;  2N98 A;  4GR6 A;  1UNK A;  2MVV A;  4XRQ A;  1YJW P;  5KP6 B;  3CE7 A;  1RO0 A;  1K8A Q;  1VQK P;  5F2O A;  2FHS C;  3G1G A;  5CZD B;  2PEN A;  3G71 P;  2K94 A;  4PH1 A;  1M74 A;  1CEI A;  2LOL A;  2CNR A;  3U43 A;  7CEI A;  2LL8 A;  1D1D A;  3CCV P;  3NTE A;  1QVF O;  2VLN A;  4COP A;  1KC8 Q;  2FAE A;  1VQP P;  3B5I A;  1AYI A;  4U0B A;  3GZM A;  2N6Z A;  2M8L A;  2KOR A;  5F2N A;  2VLP A;  1QRJ A;  1Q7Y Q;  1NQ4 A;  2FVA A;  4IPY A;  1Z6M A;  3CCR P;  1K30 A;  2N6Y A;  2FVE A;  2M5R A;  1M1K Q;  2KOQ A;  4PH0 A;  2N5I A;  3DS3 A;  5HGN A;  2BUO A;  3DS5 A;  3B4Q A;  2X2B A;  5HV8 A;  1YIT P;  3DS0 A;  1AF8 A;  2MF4 A;  3RG6 C;  2MVU A;  2CG5 B;  1FR2 A;  2K5X A;  5KP7 B;  2JU2 A;  4MRT C;  2MR8 A;  2KOO A;  2EFJ A;  1VQ7 P;  1F80 D;  3NY7 B;  3G6E P;  2LKI A;  2JO0 A;  2L4B A;  3M1M A;  2KG6 A;  1BAJ A;  4CA3 A;  3HYB A;  1MZ8 A;  2N5H A;  2KOP A;  4QNB A;  3G4S P;  4R0M A;  2QNW A;  1EMV A;  1AUM A;  5DCK A;  2VLQ A;  2CQ8 A;  2XV6 A;  4XFZ A;  3G29 A;  1YI2 P;  1A8O A;  2FAD A;  2DNW A;  1M6E X;  2MY5 A;  2JGP A;  4BPH A;  1GPJ A;  2K0X A;  2XXM A;  3CC2 P;  2KOD A;  2NO8 A;  2XT1 A;  1RO2 A;  3DS1 A;  3RG2 A;  1E6J P;  1E0H A;  2E1M A;  5EJD A;  2MR7 A;  5HGL A;  3G26 A;  2JB0 A;  2ONT A;  4H2X C;  1KLP A;  1VQ5 P;  1KQS O;  3H4E A;  1IMQ A;  2AFD A;  2K2Q A;  2LIU A;  5BS1 A;  3CMA P;  2OTJ P;  3CCU P;  3CD6 P;  1BXI A;  1VQ9 P;  2GZE A;  1VQ4 P;  3EJB A;  5BS2 A;  1ZMB A;  3OW2 O;  2JYL A;  3CCJ P;  2EHS A;  4H2Y C;  2VSQ A;  2JYG A;  4U0D A;  1M90 Q;  2EHT A;  1ZNV A;  1A43 A;  2AVA A;  3H0D A;  1VQ6 P;  2CWO A;  2Z44 A;  4U0A A;  4BPF A;  4UHP B;  1VKU A; 
#chains in the Genus database with same CATH homology
 4R0M A;  2QNW A;  2FHS C;  2GDW A;  5CZD B;  2K94 A;  2CQ8 A;  2N50 A;  4IZ6 A;  2K93 A;  2KOS A;  3EJD A;  1T8K A;  2LOL A;  2KG9 A;  2KGA A;  2CNR A;  2LPK A;  4NEO A;  2LL8 A;  2MD9 A;  4BPG A;  2FAD A;  2DNW A;  2KG8 A;  4H2W C;  1HQB A;  3EJE A;  2FAE A;  2MY5 A;  2JGP A;  2LML A;  2ROQ A;  2XZ0 D;  4BPH A;  1DNY A;  2K0X A;  3GZM A;  2L9F A;  2N6Z A;  3LMO A;  2KOR A;  5HVC A;  2AF8 A;  1X3O A;  3RG2 A;  1L0I A;  5EJD A;  2MR7 A;  1NQ4 A;  4PXH B;  2FVA A;  2JQ4 A;  2FAC A;  2KGC A;  5KP8 B;  2L0Q A;  2N6Y A;  4H2X C;  1KLP A;  2FVE A;  2M5R A;  2LIW A;  1ACP A;  2GDY A;  2KOQ A;  2AFD A;  1L0H A;  2K2Q A;  1HY8 A;  2LIU A;  2N5I A;  2FQ1 A;  2FVF A;  2K0Y A;  4DG9 A;  2KGE A;  2KW2 A;  2CGQ A;  2X2B A;  3EJB A;  5HV8 A;  1AF8 A;  2MF4 A;  2FQ2 A;  2MVU A;  2CG5 B;  5KP7 B;  2PNG A;  2JU2 A;  2GDX A;  2XZ1 C;  2EHS A;  4MRT C;  4H2Y C;  2KR5 A;  2LTE A;  2MR8 A;  2KOO A;  2VSQ A;  2AFE A;  2EHT A;  1F80 D;  1DV5 A;  2KWL A;  3NY7 B;  2L22 A;  3GZL A;  2LKI A;  2KGD A;  1OR5 A;  2FQ0 A;  2JU1 A;  2AVA A;  4PWV B;  2N98 A;  2K92 A;  2L4B A;  2MVV A;  4HKG A;  2KG6 A;  4CA3 A;  5KP6 B;  4BPF A;  2N5H A;  2KOP A;  3CE7 A;  1VKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...