4MRTC

Structure of the phosphopantetheine transferase sfp in complex with coenzyme a and a peptidyl carrier protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Transport protein/transferase
molecule keywords Tyrocidine synthase 3
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4mrtC00
2FHSC 2MF4A 2LTEA 3EJEA 2GDWA 2AVAA 2FQ1A 2KWLA 2EHSA 2AFEA 2K0XA 2PNGA 2VSQA 2MR8A 2L22A 2KG8A 2JGPA 2KR5A 1T8KA 5KP8B 2K92A 4PXHB 1NQ4A 1ACPA 2N5IA 2KGCA 4BPHA 2MD9A 3EJBA 4R0MA 1OR5A 2L9FA 4NEOA 2XZ0D 2MVVA 2LL8A 2N5HA 4CA3A 2JQ4A 2K94A 2K0YA 2KOPA 2KGEA 4HKGA 2GDYA 3GZMA 2DNWA 2K2QA 2GDXA 2FACA 4IZ6A 1X3OA 2N6ZA 1AF8A 2FVFA 5CZDB 2X2BA 2AF8A 2FVAA 2FAEA 2FADA 2LOLA 2LIWA 2JU1A 2LMLA 3NY7B 1DV5A 2ROQA 5KP6B 2EHTA 2KOSA 4BPGA 4MRTC 2LPKA 2MY5A 3LMOA 2CNRA 2KG9A 4H2WC 1L0IA 1KLPA 2MR7A 1HQBA 2N6YA 4PWVB 2KG6A 2K93A 2FQ0A 2L0QA 3RG2A 2CG5B 1HY8A 3EJDA 2CGQA 3GZLA 2FQ2A 2M5RA 2KOQA 5EJDA 2KGAA 4DG9A 2L4BA 2KGDA 2LKIA 1L0HA 2AFDA 2FVEA 2JU2A 1VKUA 2KOOA 2MVUA 1DNYA 2CQ8A 2KORA 4BPFA 4H2XC 2KW2A 5HV8A 2N50A 2LIUA 2QNWA 2XZ1C 4H2YC 2N98A 5HVCA 3CE7A 1F80D 5KP7B
chains in the Genus database with same CATH superfamily
2FHSC 2GDWA 3Q20A 4XFXA 4QKOA 2AVAA 3G0VA 1CEIA 3CCLP 1UJZA 2OTJP 3CXCO 1GPJA 2L22A 3CCSP 2KG8A 2P9XA 4U0EA 3WBHA 2M8NA 3VRLC 4BPHA 1K8AQ 1YIJP 3G29A 2L9FA 3M1MA 3H4EA 2MVVA 2ONTA 3CCQP 2N5HA 5BS2A 1VHNA 2KOPA 2GDYA 5BS1A 2Z45A 2FVFA 5CZDB 3H0DA 2FVAA 2DGYA 3NY7B 1IUQA 1GXGA 5F2OA 4F37A 4MRTC 2VLPA 2MY5A 2MR7A 1HQBA 2CG5B 1QVFO 2M5RA 2ERHA 2EIAA 1GXHA 3G71P 1Z6MA 1Q82Q 1UNKA 4U0AA 2FVEA 3G1GA 1VKUA 4XFYA 1VQNP 2GYKA 3B4QA 3OW2O 2PEMA 2LIUA 1KC8Q 2QNWA 2N98A 3CE7A 1Q81Q 3CD6P 3DS0A 5I4TG 1EOQA 2FQ1A 2NO8A 2EHSA 2AFEA 2QEXP 1VQLP 3U43A 4PH0A 1VQOP 2QA4P 2KR5A 1T8KA 2XT1A 2PEQA 2E1MA 2M8LA 4PH1A 3CMEP 3DS2A 1YJWP 3EJBA 2KODA 4NEOA 3CCRP 2XXMA 2LL8A 5F2NA 4CA3A 3G28A 2WPTA 4HKGA 1AUMA 1QRJA 2K5XA 2DNWA 1AYIA 5HGLA 4M0IA 3GKLC 5F2KA 1FR2A 2FAEA 2PEOA 2JU1A 1DV5A 5KP6B 4COPA 4BPGA 2LPKA 2KG9A 3G26A 4H2WC 1L0IA 2N6YA 4PWVB 2KG6A 1JJ2O 2L6EA 2L0QA 2GZFA 1VQ6P 3EJDA 3GZLA 2GZIA 1BXIA 3DS4A 4QNBA 2PY8A 3I55P 1RNIA 1L0HA 1M90Q 1DNYA 2CQ8A 1Q86Q 4H2XC 2N50A 1IMQA 2XZ1C 1YI2P 1F80D 3E2DA 2PNGA 2K0XA 1QVGO 2CWOA 3DPHA 2VLNA 4XRQA 3CC2P 2JAZA 4GR2A 2JGPA 3CPWO 1YHQP 4COCA 1BAJA 2K92A 4PXHB 1NQ4A 3H47A 2N5IA 1KD1Q 1M6NA 3CCJP 5HGNA 4R0MA 2PENA 3DS3A 1VQ5P 1VQ4P 3G1IA 2JQ4A 2K0YA 2JO0A 3CMAP 2VLQA 2K2QA 1YJ9P 1VQMP 4IZ6A 4U0BA 3CCEP 2M8PA 4UHPB 1AF8A 2X2BA 2K0DX 1M74A 3CCUP 4GR6A 1RO2A 3MGEA 5HGOA 2ROQA 2VLOA 2EHTA 3DS1A 1KLPA 3RG6C 1W2BO 2PEKA 3DS5A 2Z46A 1K73Q 3CC4P 2K93A 3RG2A 1HY8A 5HGMA 4XROA 2BHVA 2KOQA 4WYMA 1NJIQ 5EJDA 2XV6A 3I56P 2KGAA 4DG9A 2GZGA 2L4BA 1RO0A 2KGDA 2PEJA 1K9MQ 2AFDA 2JU2A 2OTLP 2GZEA 3LRYA 4BPFA 2BUOA 5JPAA 2KW2A 1EIAA 2GZJA 4H2YC 2Z44A 5KP7B 2MF4A 2LTEA 3EJEA 1M6EX 2JYLA 2KWLA 2VSQA 1YJNP 1VQ8P 1A43A 2MR8A 3HYBA 1VQKP 4IPYA 3NTEA 5KP8B 1A8OA 3CC7P 1ACPA 1MZ8A 1ZMBA 1KQSO 2KGCA 2EFJA 1N8RQ 2MD9A 3DTJA 1ZNVA 1OR5A 1EMVA 2XZ0D 1M1KQ 3HZQA 2K94A 2KGEA 1E6JP 1E0HA 3GZMA 2PEIA 3B5IA 2GDXA 1IMPA 2FACA 5EW5E 3CCVP 1X3OA 2N6ZA 3G4SP 3GJNA 2OARA 1VQ9P 2AF8A 2EG5A 3G21A 2FADA 2LOLA 2LIWA 1VQPP 2LMLA 1S72P 1Q7YQ 2KOSA 3LMOA 2CNRA 5DCKA 7CEIA 1VQ7P 2FQ0A 1D1DA 2CGQA 2FQ2A 2JB0A 3P05A 4U0FA 2JYGA 2LKIA 1K30A 3G6EP 4U0CA 3CCMP 2JBGA 2KOOA 1YITP 2MVUA 4U0DA 2KORA 5HV8A 2LF4A 4XFZA 5HVCA
chains in the Genus database with same CATH topology
2FHSC 2MF4A 2LTEA 3EJEA 2GDWA 2AVAA 2FQ1A 2KWLA 2EHSA 2AFEA 2K0XA 2PNGA 2VSQA 2MR8A 2L22A 2KG8A 2JGPA 2KR5A 1T8KA 5KP8B 2K92A 4PXHB 1NQ4A 1ACPA 2N5IA 2KGCA 4BPHA 2MD9A 3EJBA 4R0MA 1OR5A 2L9FA 4NEOA 2XZ0D 2MVVA 2LL8A 2N5HA 4CA3A 2JQ4A 2K94A 2K0YA 2KOPA 2KGEA 4HKGA 2GDYA 3GZMA 2DNWA 2K2QA 2GDXA 2FACA 4IZ6A 1X3OA 2N6ZA 1AF8A 2FVFA 5CZDB 2X2BA 2AF8A 2FVAA 2FAEA 2FADA 2LOLA 2LIWA 2JU1A 2LMLA 3NY7B 1DV5A 2ROQA 5KP6B 2EHTA 2KOSA 4BPGA 4MRTC 2LPKA 2MY5A 3LMOA 2CNRA 2KG9A 4H2WC 1L0IA 1KLPA 2MR7A 1HQBA 2N6YA 4PWVB 2KG6A 2K93A 2FQ0A 2L0QA 3RG2A 2CG5B 1HY8A 3EJDA 2CGQA 3GZLA 2FQ2A 2M5RA 2KOQA 5EJDA 2KGAA 4DG9A 2L4BA 2KGDA 2LKIA 1L0HA 2AFDA 2FVEA 2JU2A 1VKUA 2KOOA 2MVUA 1DNYA 2CQ8A 2KORA 4BPFA 4H2XC 2KW2A 5HV8A 2N50A 2LIUA 2QNWA 2XZ1C 4H2YC 2N98A 5HVCA 3CE7A 1F80D 5KP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FHS C;  2MF4 A;  2LTE A;  3EJE A;  2GDW A;  2AVA A;  2FQ1 A;  2KWL A;  2EHS A;  2AFE A;  2K0X A;  2PNG A;  2VSQ A;  2MR8 A;  2L22 A;  2KG8 A;  2JGP A;  2KR5 A;  1T8K A;  5KP8 B;  2K92 A;  4PXH B;  1NQ4 A;  1ACP A;  2N5I A;  2KGC A;  4BPH A;  2MD9 A;  3EJB A;  4R0M A;  1OR5 A;  2L9F A;  4NEO A;  2XZ0 D;  2MVV A;  2LL8 A;  2N5H A;  4CA3 A;  2JQ4 A;  2K94 A;  2K0Y A;  2KOP A;  2KGE A;  4HKG A;  2GDY A;  3GZM A;  2DNW A;  2K2Q A;  2GDX A;  2FAC A;  4IZ6 A;  1X3O A;  2N6Z A;  1AF8 A;  2FVF A;  5CZD B;  2X2B A;  2AF8 A;  2FVA A;  2FAE A;  2FAD A;  2LOL A;  2LIW A;  2JU1 A;  2LML A;  3NY7 B;  1DV5 A;  2ROQ A;  5KP6 B;  2EHT A;  2KOS A;  4BPG A;  4MRT C;  2LPK A;  2MY5 A;  3LMO A;  2CNR A;  2KG9 A;  4H2W C;  1L0I A;  1KLP A;  2MR7 A;  1HQB A;  2N6Y A;  4PWV B;  2KG6 A;  2K93 A;  2FQ0 A;  2L0Q A;  3RG2 A;  2CG5 B;  1HY8 A;  3EJD A;  2CGQ A;  3GZL A;  2FQ2 A;  2M5R A;  2KOQ A;  5EJD A;  2KGA A;  4DG9 A;  2L4B A;  2KGD A;  2LKI A;  1L0H A;  2AFD A;  2FVE A;  2JU2 A;  1VKU A;  2KOO A;  2MVU A;  1DNY A;  2CQ8 A;  2KOR A;  4BPF A;  4H2X C;  2KW2 A;  5HV8 A;  2N50 A;  2LIU A;  2QNW A;  2XZ1 C;  4H2Y C;  2N98 A;  5HVC A;  3CE7 A;  1F80 D;  5KP7 B; 
#chains in the Genus database with same CATH topology
 2FHS C;  2GDW A;  3Q20 A;  4XFX A;  4QKO A;  2AVA A;  3G0V A;  1CEI A;  3CCL P;  1UJZ A;  2OTJ P;  3CXC O;  1GPJ A;  2L22 A;  3CCS P;  2KG8 A;  2P9X A;  4U0E A;  3WBH A;  2M8N A;  3VRL C;  4BPH A;  1K8A Q;  1YIJ P;  3G29 A;  2L9F A;  3M1M A;  3H4E A;  2MVV A;  2ONT A;  3CCQ P;  2N5H A;  5BS2 A;  1VHN A;  2KOP A;  2GDY A;  5BS1 A;  2Z45 A;  2FVF A;  5CZD B;  3H0D A;  2FVA A;  2DGY A;  3NY7 B;  1IUQ A;  1GXG A;  5F2O A;  4F37 A;  4MRT C;  2VLP A;  2MY5 A;  2MR7 A;  1HQB A;  2CG5 B;  1QVF O;  2M5R A;  2ERH A;  2EIA A;  1GXH A;  3G71 P;  1Z6M A;  1Q82 Q;  1UNK A;  4U0A A;  2FVE A;  3G1G A;  1VKU A;  4XFY A;  1VQN P;  2GYK A;  3B4Q A;  3OW2 O;  2PEM A;  2LIU A;  1KC8 Q;  2QNW A;  2N98 A;  3CE7 A;  1Q81 Q;  3CD6 P;  3DS0 A;  5I4T G;  1EOQ A;  2FQ1 A;  2NO8 A;  2EHS A;  2AFE A;  2QEX P;  1VQL P;  3U43 A;  4PH0 A;  1VQO P;  2QA4 P;  2KR5 A;  1T8K A;  2XT1 A;  2PEQ A;  2E1M A;  2M8L A;  4PH1 A;  3CME P;  3DS2 A;  1YJW P;  3EJB A;  2KOD A;  4NEO A;  3CCR P;  2XXM A;  2LL8 A;  5F2N A;  4CA3 A;  3G28 A;  2WPT A;  4HKG A;  1AUM A;  1QRJ A;  2K5X A;  2DNW A;  1AYI A;  5HGL A;  4M0I A;  3GKL C;  5F2K A;  1FR2 A;  2FAE A;  2PEO A;  2JU1 A;  1DV5 A;  5KP6 B;  4COP A;  4BPG A;  2LPK A;  2KG9 A;  3G26 A;  4H2W C;  1L0I A;  2N6Y A;  4PWV B;  2KG6 A;  1JJ2 O;  2L6E A;  2L0Q A;  2GZF A;  1VQ6 P;  3EJD A;  3GZL A;  2GZI A;  1BXI A;  3DS4 A;  4QNB A;  2PY8 A;  3I55 P;  1RNI A;  1L0H A;  1M90 Q;  1DNY A;  2CQ8 A;  1Q86 Q;  4H2X C;  2N50 A;  1IMQ A;  2XZ1 C;  1YI2 P;  1F80 D;  3E2D A;  2PNG A;  2K0X A;  1QVG O;  2CWO A;  3DPH A;  2VLN A;  4XRQ A;  3CC2 P;  2JAZ A;  4GR2 A;  2JGP A;  3CPW O;  1YHQ P;  4COC A;  1BAJ A;  2K92 A;  4PXH B;  1NQ4 A;  3H47 A;  2N5I A;  1KD1 Q;  1M6N A;  3CCJ P;  5HGN A;  4R0M A;  2PEN A;  3DS3 A;  1VQ5 P;  1VQ4 P;  3G1I A;  2JQ4 A;  2K0Y A;  2JO0 A;  3CMA P;  2VLQ A;  2K2Q A;  1YJ9 P;  1VQM P;  4IZ6 A;  4U0B A;  3CCE P;  2M8P A;  4UHP B;  1AF8 A;  2X2B A;  2K0D X;  1M74 A;  3CCU P;  4GR6 A;  1RO2 A;  3MGE A;  5HGO A;  2ROQ A;  2VLO A;  2EHT A;  3DS1 A;  1KLP A;  3RG6 C;  1W2B O;  2PEK A;  3DS5 A;  2Z46 A;  1K73 Q;  3CC4 P;  2K93 A;  3RG2 A;  1HY8 A;  5HGM A;  4XRO A;  2BHV A;  2KOQ A;  4WYM A;  1NJI Q;  5EJD A;  2XV6 A;  3I56 P;  2KGA A;  4DG9 A;  2GZG A;  2L4B A;  1RO0 A;  2KGD A;  2PEJ A;  1K9M Q;  2AFD A;  2JU2 A;  2OTL P;  2GZE A;  3LRY A;  4BPF A;  2BUO A;  5JPA A;  2KW2 A;  1EIA A;  2GZJ A;  4H2Y C;  2Z44 A;  5KP7 B;  2MF4 A;  2LTE A;  3EJE A;  1M6E X;  2JYL A;  2KWL A;  2VSQ A;  1YJN P;  1VQ8 P;  1A43 A;  2MR8 A;  3HYB A;  1VQK P;  4IPY A;  3NTE A;  5KP8 B;  1A8O A;  3CC7 P;  1ACP A;  1MZ8 A;  1ZMB A;  1KQS O;  2KGC A;  2EFJ A;  1N8R Q;  2MD9 A;  3DTJ A;  1ZNV A;  1OR5 A;  1EMV A;  2XZ0 D;  1M1K Q;  3HZQ A;  2K94 A;  2KGE A;  1E6J P;  1E0H A;  3GZM A;  2PEI A;  3B5I A;  2GDX A;  1IMP A;  2FAC A;  5EW5 E;  3CCV P;  1X3O A;  2N6Z A;  3G4S P;  3GJN A;  2OAR A;  1VQ9 P;  2AF8 A;  2EG5 A;  3G21 A;  2FAD A;  2LOL A;  2LIW A;  1VQP P;  2LML A;  1S72 P;  1Q7Y Q;  2KOS A;  3LMO A;  2CNR A;  5DCK A;  7CEI A;  1VQ7 P;  2FQ0 A;  1D1D A;  2CGQ A;  2FQ2 A;  2JB0 A;  3P05 A;  4U0F A;  2JYG A;  2LKI A;  1K30 A;  3G6E P;  4U0C A;  3CCM P;  2JBG A;  2KOO A;  1YIT P;  2MVU A;  4U0D A;  2KOR A;  5HV8 A;  2LF4 A;  4XFZ A;  5HVC A; 
#chains in the Genus database with same CATH homology
 2FHS C;  2MF4 A;  2LTE A;  3EJE A;  2GDW A;  2AVA A;  2FQ1 A;  2KWL A;  2EHS A;  2AFE A;  2K0X A;  2PNG A;  2VSQ A;  2MR8 A;  2L22 A;  2KG8 A;  2JGP A;  2KR5 A;  1T8K A;  5KP8 B;  2K92 A;  4PXH B;  1NQ4 A;  1ACP A;  2N5I A;  2KGC A;  4BPH A;  2MD9 A;  3EJB A;  4R0M A;  1OR5 A;  2L9F A;  4NEO A;  2XZ0 D;  2MVV A;  2LL8 A;  2N5H A;  4CA3 A;  2JQ4 A;  2K94 A;  2K0Y A;  2KOP A;  2KGE A;  4HKG A;  2GDY A;  3GZM A;  2DNW A;  2K2Q A;  2GDX A;  2FAC A;  4IZ6 A;  1X3O A;  2N6Z A;  1AF8 A;  2FVF A;  5CZD B;  2X2B A;  2AF8 A;  2FVA A;  2FAE A;  2FAD A;  2LOL A;  2LIW A;  2JU1 A;  2LML A;  3NY7 B;  1DV5 A;  2ROQ A;  5KP6 B;  2EHT A;  2KOS A;  4BPG A;  4MRT C;  2LPK A;  2MY5 A;  3LMO A;  2CNR A;  2KG9 A;  4H2W C;  1L0I A;  1KLP A;  2MR7 A;  1HQB A;  2N6Y A;  4PWV B;  2KG6 A;  2K93 A;  2FQ0 A;  2L0Q A;  3RG2 A;  2CG5 B;  1HY8 A;  3EJD A;  2CGQ A;  3GZL A;  2FQ2 A;  2M5R A;  2KOQ A;  5EJD A;  2KGA A;  4DG9 A;  2L4B A;  2KGD A;  2LKI A;  1L0H A;  2AFD A;  2FVE A;  2JU2 A;  1VKU A;  2KOO A;  2MVU A;  1DNY A;  2CQ8 A;  2KOR A;  4BPF A;  4H2X C;  2KW2 A;  5HV8 A;  2N50 A;  2LIU A;  2QNW A;  2XZ1 C;  4H2Y C;  2N98 A;  5HVC A;  3CE7 A;  1F80 D;  5KP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...