4MRTC

Structure of the phosphopantetheine transferase sfp in complex with coenzyme a and a peptidyl carrier protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Transport protein/transferase
molecule keywords Tyrocidine synthase 3
total genus 24
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4mrtC00
2GDYA 2GDWA 2JQ4A 2LOLA 2KR5A 2LL8A 3CE7A 2EHTA 2CG5B 4MRTC 4CA3A 2AFDA 2KGEA 4NEOA 3EJEA 2LMLA 2LPKA 5KP7B 3EJDA 2XZ1C 2L22A 2MD9A 2KOQA 1VKUA 2L0QA 5KP6B 1AF8A 2KGCA 2KOOA 1DNYA 5HV8A 3GZLA 2KW2A 2VSQA 5HVCA 2FAEA 1L0HA 2K0YA 3GZMA 2LTEA 2FACA 4IZ6A 3NY7B 2PNGA 1HY8A 1DV5A 2K93A 2MVUA 4PWVB 2MY5A 1ACPA 2K2QA 2CNRA 2FVFA 2N6YA 2N5IA 2KGDA 2L4BA 2CGQA 4H2WC 2LIWA 1HQBA 2DNWA 2FHSC 3RG2A 5KP8B 2L9FA 2AF8A 2MF4A 2AVAA 1F80D 2JU1A 2LIUA 2KWLA 2KOSA 1KLPA 2FQ1A 4DG9A 2KGAA 4H2YC 4HKGA 3LMOA 2FQ0A 2AFEA 5CZDB 2XZ0D 4H2XC 4BPHA 2FQ2A 1OR5A 1T8KA 4BPFA 2KG9A 2N5HA 2QNWA 2EHSA 2N98A 4PXHB 2GDXA 2MVVA 2K92A 2CQ8A 2FVEA 4BPGA 2KOPA 2MR8A 2ROQA 4R0MA 2FVAA 2JGPA 2M5RA 2N6ZA 5EJDA 2KG8A 2KORA 2LKIA 2X2BA 2K0XA 1NQ4A 3EJBA 2KG6A 2K94A 2N50A 2FADA 2MR7A 1X3OA 1L0IA 2JU2A
chains in the Genus database with same CATH superfamily
1EMVA 2XV6A 2BHVA 4WYMA 2LL8A 3CE7A 3RG6C 2Z44A 2KGEA 3DS1A 2GZJA 1BXIA 3G1GA 4M0IA 2KOQA 1VKUA 1AF8A 4PH0A 2L6EA 3H4EA 4IPYA 1Q86Q 2FACA 3CCQP 1VQ7P 2FVFA 1E6JP 2KGDA 4U0DA 4XRQA 1ZNVA 1VHNA 2EFJA 2EG5A 5KP8B 1YJNP 3B4QA 3CCEP 1CEIA 1F80D 2JU1A 3NTEA 1KLPA 2FQ1A 4DG9A 2KGAA 4HKGA 4COPA 2FQ0A 1A8OA 2AFEA 1QVGO 4H2XC 4BPHA 1T8KA 1IMQA 1M74A 2EIAA 2N5HA 2N98A 4XFZA 4U0FA 2GDXA 1K30A 2MVVA 2ONTA 1RNIA 4PH1A 2CQ8A 2FVEA 4BPGA 1RO2A 2KOPA 1GXGA 1JJ2O 1VQ8P 2JGPA 1W2BO 1VQPP 2KG8A 1N8RQ 3CCUP 1UJZA 2K0XA 2QEXP 2KG6A 2OARA 3CCRP 2N50A 1X3OA 2GDWA 3G21A 3Q20A 5JPAA 2M8PA 3CCMP 7CEIA 3EJEA 2LPKA 5KP7B 1FR2A 3E2DA 2WPTA 3G6EP 2L0QA 1DNYA 5HV8A 4U0EA 1QVFO 3CD6P 5I4TG 2K0YA 2XXMA 3G1IA 3NY7B 2PNGA 1MZ8A 3I55P 3P05A 1DV5A 2K93A 2MVUA 4COCA 2JAZA 1VQOP 4XFXA 2L4BA 3H0DA 2CGQA 4H2WC 5DCKA 1UNKA 2JYGA 3OW2O 2L9FA 1K8AQ 3LRYA 2AVAA 2GZIA 4GR6A 1IMPA 3LMOA 3I56P 3H47A 2XZ0D 2KODA 2FQ2A 1OR5A 4QKOA 2ERHA 2QNWA 2PEOA 1M1KQ 3CPWO 1NJIQ 2FVAA 3DTJA 2XT1A 3WBHA 2PEMA 4U0CA 1GPJA 2KORA 2X2BA 1NQ4A 1ZMBA 4F37A 1M6EX 2FADA 1E0HA 2GDYA 3M1MA 1D1DA 2NO8A 1VQNP 1QRJA 3CCSP 2LOLA 2KR5A 2EHTA 2AFDA 3CCVP 3CCLP 1M90Q 4NEOA 1M6NA 2GYKA 2PENA 5F2OA 3EJDA 2JBGA 3G28A 2DGYA 5KP6B 1YI2P 2KGCA 5F2KA 2KOOA 2VSQA 5HVCA 3CC7P 1Z6MA 2LTEA 1VQMP 4IZ6A 5HGOA 1RO0A 5HGNA 4PWVB 2MY5A 2K2QA 2VLOA 3DS2A 2CWOA 2N6YA 1GXHA 2JYLA 3DS3A 2LIWA 2JO0A 3DS4A 2FHSC 3DPHA 2GZEA 1Q82Q 3G26A 2MF4A 2PEQA 2GZFA 3CXCO 1AUMA 5BS1A 2GZGA 4H2YC 3MGEA 1Q7YQ 2VLQA 1EOQA 2QA4P 4BPFA 2KG9A 3CMAP 1VQ9P 3CCJP 3B5IA 1K73Q 2K0DX 5HGLA 2K92A 2PEIA 2ROQA 1VQKP 1YHQP 1VQ5P 2M5RA 5EJDA 5EW5E 2LKIA 3CC4P 3VRLC 2K94A 3DS0A 1L0IA 2JU2A 2JQ4A 2BUOA 2CG5B 4CA3A 4MRTC 3HZQA 1A43A 2Z46A 1YITP 1YJWP 2LMLA 3U43A 4XFYA 3DS5A 2XZ1C 2L22A 2MD9A 3GZLA 2KW2A 2VLNA 3GJNA 2FAEA 1KC8Q 2LF4A 1L0HA 2E1MA 2OTJP 1AYIA 3GZMA 2M8NA 3G71P 2OTLP 5HGMA 1HY8A 1BAJA 1K9MQ 1ACPA 4U0BA 2CNRA 3GKLC 4UHPB 2N5IA 4XROA 1IUQA 2P9XA 4U0AA 1HQBA 2DNWA 3HYBA 3RG2A 1YIJP 2PEJA 1VQLP 2AF8A 2PEKA 1S72P 1Q81Q 2LIUA 2KWLA 1VQ4P 2KOSA 2Z45A 2PY8A 3G29A 1YJ9P 5CZDB 1EIAA 5F2NA 2M8LA 2EHSA 4PXHB 2JB0A 3G4SP 2VLPA 4GR2A 1VQ6P 3G0VA 2K5XA 5BS2A 4QNBA 2MR8A 4R0MA 2N6ZA 1KQSO 1KD1Q 3EJBA 3CC2P 2MR7A 3CMEP
chains in the Genus database with same CATH topology
2GDYA 2GDWA 2JQ4A 2LOLA 2KR5A 2LL8A 3CE7A 2EHTA 2CG5B 4MRTC 4CA3A 2AFDA 2KGEA 4NEOA 3EJEA 2LMLA 2LPKA 5KP7B 3EJDA 2XZ1C 2L22A 2MD9A 2KOQA 1VKUA 2L0QA 5KP6B 1AF8A 2KGCA 2KOOA 1DNYA 5HV8A 3GZLA 2KW2A 2VSQA 5HVCA 2FAEA 1L0HA 2K0YA 3GZMA 2LTEA 2FACA 4IZ6A 3NY7B 2PNGA 1HY8A 1DV5A 2K93A 2MVUA 4PWVB 2MY5A 1ACPA 2K2QA 2CNRA 2FVFA 2N6YA 2N5IA 2KGDA 2L4BA 2CGQA 4H2WC 2LIWA 1HQBA 2DNWA 2FHSC 3RG2A 5KP8B 2L9FA 2AF8A 2MF4A 2AVAA 1F80D 2JU1A 2LIUA 2KWLA 2KOSA 1KLPA 2FQ1A 4DG9A 2KGAA 4H2YC 4HKGA 3LMOA 2FQ0A 2AFEA 5CZDB 2XZ0D 4H2XC 4BPHA 2FQ2A 1OR5A 1T8KA 4BPFA 2KG9A 2N5HA 2QNWA 2EHSA 2N98A 4PXHB 2GDXA 2MVVA 2K92A 2CQ8A 2FVEA 4BPGA 2KOPA 2MR8A 2ROQA 4R0MA 2FVAA 2JGPA 2M5RA 2N6ZA 5EJDA 2KG8A 2KORA 2LKIA 2X2BA 2K0XA 1NQ4A 3EJBA 2KG6A 2K94A 2N50A 2FADA 2MR7A 1X3OA 1L0IA 2JU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDY A;  2GDW A;  2JQ4 A;  2LOL A;  2KR5 A;  2LL8 A;  3CE7 A;  2EHT A;  2CG5 B;  4MRT C;  4CA3 A;  2AFD A;  2KGE A;  4NEO A;  3EJE A;  2LML A;  2LPK A;  5KP7 B;  3EJD A;  2XZ1 C;  2L22 A;  2MD9 A;  2KOQ A;  1VKU A;  2L0Q A;  5KP6 B;  1AF8 A;  2KGC A;  2KOO A;  1DNY A;  5HV8 A;  3GZL A;  2KW2 A;  2VSQ A;  5HVC A;  2FAE A;  1L0H A;  2K0Y A;  3GZM A;  2LTE A;  2FAC A;  4IZ6 A;  3NY7 B;  2PNG A;  1HY8 A;  1DV5 A;  2K93 A;  2MVU A;  4PWV B;  2MY5 A;  1ACP A;  2K2Q A;  2CNR A;  2FVF A;  2N6Y A;  2N5I A;  2KGD A;  2L4B A;  2CGQ A;  4H2W C;  2LIW A;  1HQB A;  2DNW A;  2FHS C;  3RG2 A;  5KP8 B;  2L9F A;  2AF8 A;  2MF4 A;  2AVA A;  1F80 D;  2JU1 A;  2LIU A;  2KWL A;  2KOS A;  1KLP A;  2FQ1 A;  4DG9 A;  2KGA A;  4H2Y C;  4HKG A;  3LMO A;  2FQ0 A;  2AFE A;  5CZD B;  2XZ0 D;  4H2X C;  4BPH A;  2FQ2 A;  1OR5 A;  1T8K A;  4BPF A;  2KG9 A;  2N5H A;  2QNW A;  2EHS A;  2N98 A;  4PXH B;  2GDX A;  2MVV A;  2K92 A;  2CQ8 A;  2FVE A;  4BPG A;  2KOP A;  2MR8 A;  2ROQ A;  4R0M A;  2FVA A;  2JGP A;  2M5R A;  2N6Z A;  5EJD A;  2KG8 A;  2KOR A;  2LKI A;  2X2B A;  2K0X A;  1NQ4 A;  3EJB A;  2KG6 A;  2K94 A;  2N50 A;  2FAD A;  2MR7 A;  1X3O A;  1L0I A;  2JU2 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  2XV6 A;  2BHV A;  4WYM A;  2LL8 A;  3CE7 A;  3RG6 C;  2Z44 A;  2KGE A;  3DS1 A;  2GZJ A;  1BXI A;  3G1G A;  4M0I A;  2KOQ A;  1VKU A;  1AF8 A;  4PH0 A;  2L6E A;  3H4E A;  4IPY A;  1Q86 Q;  2FAC A;  3CCQ P;  1VQ7 P;  2FVF A;  1E6J P;  2KGD A;  4U0D A;  4XRQ A;  1ZNV A;  1VHN A;  2EFJ A;  2EG5 A;  5KP8 B;  1YJN P;  3B4Q A;  3CCE P;  1CEI A;  1F80 D;  2JU1 A;  3NTE A;  1KLP A;  2FQ1 A;  4DG9 A;  2KGA A;  4HKG A;  4COP A;  2FQ0 A;  1A8O A;  2AFE A;  1QVG O;  4H2X C;  4BPH A;  1T8K A;  1IMQ A;  1M74 A;  2EIA A;  2N5H A;  2N98 A;  4XFZ A;  4U0F A;  2GDX A;  1K30 A;  2MVV A;  2ONT A;  1RNI A;  4PH1 A;  2CQ8 A;  2FVE A;  4BPG A;  1RO2 A;  2KOP A;  1GXG A;  1JJ2 O;  1VQ8 P;  2JGP A;  1W2B O;  1VQP P;  2KG8 A;  1N8R Q;  3CCU P;  1UJZ A;  2K0X A;  2QEX P;  2KG6 A;  2OAR A;  3CCR P;  2N50 A;  1X3O A;  2GDW A;  3G21 A;  3Q20 A;  5JPA A;  2M8P A;  3CCM P;  7CEI A;  3EJE A;  2LPK A;  5KP7 B;  1FR2 A;  3E2D A;  2WPT A;  3G6E P;  2L0Q A;  1DNY A;  5HV8 A;  4U0E A;  1QVF O;  3CD6 P;  5I4T G;  2K0Y A;  2XXM A;  3G1I A;  3NY7 B;  2PNG A;  1MZ8 A;  3I55 P;  3P05 A;  1DV5 A;  2K93 A;  2MVU A;  4COC A;  2JAZ A;  1VQO P;  4XFX A;  2L4B A;  3H0D A;  2CGQ A;  4H2W C;  5DCK A;  1UNK A;  2JYG A;  3OW2 O;  2L9F A;  1K8A Q;  3LRY A;  2AVA A;  2GZI A;  4GR6 A;  1IMP A;  3LMO A;  3I56 P;  3H47 A;  2XZ0 D;  2KOD A;  2FQ2 A;  1OR5 A;  4QKO A;  2ERH A;  2QNW A;  2PEO A;  1M1K Q;  3CPW O;  1NJI Q;  2FVA A;  3DTJ A;  2XT1 A;  3WBH A;  2PEM A;  4U0C A;  1GPJ A;  2KOR A;  2X2B A;  1NQ4 A;  1ZMB A;  4F37 A;  1M6E X;  2FAD A;  1E0H A;  2GDY A;  3M1M A;  1D1D A;  2NO8 A;  1VQN P;  1QRJ A;  3CCS P;  2LOL A;  2KR5 A;  2EHT A;  2AFD A;  3CCV P;  3CCL P;  1M90 Q;  4NEO A;  1M6N A;  2GYK A;  2PEN A;  5F2O A;  3EJD A;  2JBG A;  3G28 A;  2DGY A;  5KP6 B;  1YI2 P;  2KGC A;  5F2K A;  2KOO A;  2VSQ A;  5HVC A;  3CC7 P;  1Z6M A;  2LTE A;  1VQM P;  4IZ6 A;  5HGO A;  1RO0 A;  5HGN A;  4PWV B;  2MY5 A;  2K2Q A;  2VLO A;  3DS2 A;  2CWO A;  2N6Y A;  1GXH A;  2JYL A;  3DS3 A;  2LIW A;  2JO0 A;  3DS4 A;  2FHS C;  3DPH A;  2GZE A;  1Q82 Q;  3G26 A;  2MF4 A;  2PEQ A;  2GZF A;  3CXC O;  1AUM A;  5BS1 A;  2GZG A;  4H2Y C;  3MGE A;  1Q7Y Q;  2VLQ A;  1EOQ A;  2QA4 P;  4BPF A;  2KG9 A;  3CMA P;  1VQ9 P;  3CCJ P;  3B5I A;  1K73 Q;  2K0D X;  5HGL A;  2K92 A;  2PEI A;  2ROQ A;  1VQK P;  1YHQ P;  1VQ5 P;  2M5R A;  5EJD A;  5EW5 E;  2LKI A;  3CC4 P;  3VRL C;  2K94 A;  3DS0 A;  1L0I A;  2JU2 A;  2JQ4 A;  2BUO A;  2CG5 B;  4CA3 A;  4MRT C;  3HZQ A;  1A43 A;  2Z46 A;  1YIT P;  1YJW P;  2LML A;  3U43 A;  4XFY A;  3DS5 A;  2XZ1 C;  2L22 A;  2MD9 A;  3GZL A;  2KW2 A;  2VLN A;  3GJN A;  2FAE A;  1KC8 Q;  2LF4 A;  1L0H A;  2E1M A;  2OTJ P;  1AYI A;  3GZM A;  2M8N A;  3G71 P;  2OTL P;  5HGM A;  1HY8 A;  1BAJ A;  1K9M Q;  1ACP A;  4U0B A;  2CNR A;  3GKL C;  4UHP B;  2N5I A;  4XRO A;  1IUQ A;  2P9X A;  4U0A A;  1HQB A;  2DNW A;  3HYB A;  3RG2 A;  1YIJ P;  2PEJ A;  1VQL P;  2AF8 A;  2PEK A;  1S72 P;  1Q81 Q;  2LIU A;  2KWL A;  1VQ4 P;  2KOS A;  2Z45 A;  2PY8 A;  3G29 A;  1YJ9 P;  5CZD B;  1EIA A;  5F2N A;  2M8L A;  2EHS A;  4PXH B;  2JB0 A;  3G4S P;  2VLP A;  4GR2 A;  1VQ6 P;  3G0V A;  2K5X A;  5BS2 A;  4QNB A;  2MR8 A;  4R0M A;  2N6Z A;  1KQS O;  1KD1 Q;  3EJB A;  3CC2 P;  2MR7 A;  3CME P; 
#chains in the Genus database with same CATH homology
 2GDY A;  2GDW A;  2JQ4 A;  2LOL A;  2KR5 A;  2LL8 A;  3CE7 A;  2EHT A;  2CG5 B;  4MRT C;  4CA3 A;  2AFD A;  2KGE A;  4NEO A;  3EJE A;  2LML A;  2LPK A;  5KP7 B;  3EJD A;  2XZ1 C;  2L22 A;  2MD9 A;  2KOQ A;  1VKU A;  2L0Q A;  5KP6 B;  1AF8 A;  2KGC A;  2KOO A;  1DNY A;  5HV8 A;  3GZL A;  2KW2 A;  2VSQ A;  5HVC A;  2FAE A;  1L0H A;  2K0Y A;  3GZM A;  2LTE A;  2FAC A;  4IZ6 A;  3NY7 B;  2PNG A;  1HY8 A;  1DV5 A;  2K93 A;  2MVU A;  4PWV B;  2MY5 A;  1ACP A;  2K2Q A;  2CNR A;  2FVF A;  2N6Y A;  2N5I A;  2KGD A;  2L4B A;  2CGQ A;  4H2W C;  2LIW A;  1HQB A;  2DNW A;  2FHS C;  3RG2 A;  5KP8 B;  2L9F A;  2AF8 A;  2MF4 A;  2AVA A;  1F80 D;  2JU1 A;  2LIU A;  2KWL A;  2KOS A;  1KLP A;  2FQ1 A;  4DG9 A;  2KGA A;  4H2Y C;  4HKG A;  3LMO A;  2FQ0 A;  2AFE A;  5CZD B;  2XZ0 D;  4H2X C;  4BPH A;  2FQ2 A;  1OR5 A;  1T8K A;  4BPF A;  2KG9 A;  2N5H A;  2QNW A;  2EHS A;  2N98 A;  4PXH B;  2GDX A;  2MVV A;  2K92 A;  2CQ8 A;  2FVE A;  4BPG A;  2KOP A;  2MR8 A;  2ROQ A;  4R0M A;  2FVA A;  2JGP A;  2M5R A;  2N6Z A;  5EJD A;  2KG8 A;  2KOR A;  2LKI A;  2X2B A;  2K0X A;  1NQ4 A;  3EJB A;  2KG6 A;  2K94 A;  2N50 A;  2FAD A;  2MR7 A;  1X3O A;  1L0I A;  2JU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...