2PEIA

Crystal structure of selenomethionine-labeled rbcx
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 43
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peiA00
2PENA 2PEJA 3RG6C 4GR6A 3HYBA 2PEQA 5BS1A 5BS2A 2Z45A 4GR2A 2PY8A 2Z44A 2PEIA 2PEMA 2PEOA 3Q20A 2PEKA 2Z46A
chains in the Genus database with same CATH superfamily
2WPTA 4IZ6A 1K73Q 2M5RA 2MD9A 3CMEP 2GZFA 2EIAA 2MR8A 2KOSA 2N5IA 2PEQA 2MY5A 2JQ4A 1M6EX 1L0HA 2EHSA 1NQ4A 2KORA 2Z46A 4BPGA 4PH1A 1YI2P 1E6JP 1YJWP 3H0DA 1A43A 1QVGO 1DV5A 1Q7YQ 2E1MA 2N50A 3I55P 2ONTA 1VQ6P 2PENA 1L0IA 1HY8A 2EHTA 1CEIA 2LPKA 2AFDA 2K93A 5HGMA 3CCEP 2KGDA 4BPHA 1RNIA 1BAJA 4BPFA 1FR2A 3G21A 4H2WC 5BS1A 2K94A 3HZQA 1A8OA 1OR5A 2FQ1A 2LOLA 3DS1A 1E0HA 2VLQA 5DCKA 1BXIA 2LMLA 1VQNP 1VQ4P 1KLPA 3CC7P 2EFJA 3G4SP 5HGOA 4MRTC 3U43A 1IUQA 1VQ7P 5KP7B 1NJIQ 1JJ2O 4COCA 2LKIA 1VQ9P 3HYBA 3G6EP 2VLPA 1EOQA 4UHPB 1QVFO 2PEJA 1YIJP 2XZ1C 1AUMA 2LIWA 1RO2A 2L22A 2Z44A 3H47A 4CA3A 5I4TG 4U0CA 1VQKP 2L0QA 3CCSP 4HKGA 2OTLP 1M74A 2CGQA 2KG6A 2KGCA 2LTEA 2M8NA 3LMOA 2JU1A 4GR2A 4PH0A 3CC2P 1QRJA 4IPYA 4WYMA 5HVCA 1ACPA 1RO0A 3G0VA 2JAZA 2XT1A 4H2XC 3RG2A 3CCMP 2FACA 1DNYA 2FVAA 5F2KA 2M8LA 1K8AQ 1HQBA 2M8PA 3EJEA 2OTJP 3H4EA 1N8RQ 2FQ0A 3G1GA 2VLOA 1T8KA 5KP6B 2XV6A 3B4QA 2LF4A 2DNWA 2PEIA 2FVFA 3G71P 3DS3A 2LIUA 2LL8A 2KOQA 1K30A 4QNBA 5CZDB 3CCRP 2ERHA 3DS5A 1GXGA 4U0AA 1VQMP 2FQ2A 2L6EA 1K9MQ 2CWOA 4F37A 2GZGA 3G28A 4R0MA 2OARA 2K0DX 5F2OA 4XFZA 2AVAA 4COPA 2GDWA 1IMQA 3WBHA 1KD1Q 5EW5E 2N98A 1UNKA 3CCVP 3DS4A 3DTJA 1Z6MA 2DGYA 1MZ8A 1EMVA 2N5HA 3I56P 1VQ8P 2K92A 2N6ZA 2JBGA 2KGAA 1S72P 3G29A 1VQPP 4DG9A 2JYLA 3B5IA 5HGLA 1KQSO 2P9XA 3CE7A 3P05A 3E2DA 2KODA 2PEOA 2QEXP 2GZJA 2KW2A 2GYKA 1YJNP 1YHQP 2NO8A 4GR6A 3MGEA 1Q81Q 2FHSC 2PEKA 4XFYA 4NEOA 2EG5A 3CCJP 3CCUP 3VRLC 1W2BO 1VQOP 2K0XA 4U0FA 2FAEA 2PEMA 3NY7B 1KC8Q 1M6NA 1Q86Q 5KP8B 4U0BA 2AFEA 4U0DA 3G26A 2JB0A 2VLNA 1ZMBA 2BUOA 2CG5B 1F80D 3EJDA 1M1KQ 2QNWA 3CXCO 2CNRA 4QKOA 3CCQP 7CEIA 2CQ8A 4M0IA 2KG8A 3CD6P 1VKUA 2KGEA 3DPHA 5JPAA 1YITP 2K2QA 2PY8A 1X3OA 2BHVA 3CC4P 5EJDA 1D1DA 5HV8A 2KWLA 1M90Q 3GJNA 2KOOA 1EIAA 1UJZA 2L9FA 3DS0A 2JO0A 1YJ9P 3DS2A 2XZ0D 2L4BA 3CPWO 2GZEA 1VQLP 2K5XA 2X2BA 1AF8A 2VSQA 2ROQA 2N6YA 3Q20A 3CCLP 4PXHB 1VQ5P 4XROA 3RG6C 2FADA 3OW2O 2XXMA 2QA4P 5HGNA 2PNGA 4XRQA 2KOPA 2Z45A 3G1IA 3NTEA 2GZIA 2JGPA 4U0EA 1ZNVA 1Q82Q 2KG9A 1GPJA 2JU2A 1AYIA 3CMAP 4PWVB 3GZLA 2MF4A 5BS2A 5F2NA 2MVVA 3EJBA 2GDXA 2GDYA 3GZMA 2KR5A 2MVUA 1GXHA 2K0YA 1VHNA 2MR7A 2FVEA 3LRYA 3GKLC 4XFXA 2JYGA 3M1MA 4H2YC 1IMPA 2AF8A
chains in the Genus database with same CATH topology
3DPHA 5JPAA 1KD1Q 1YITP 3CCVP 3DS4A 3CCSP 2PY8A 3DTJA 1K73Q 2DGYA 3CMEP 3I56P 2OTLP 1M74A 2BHVA 3CC4P 1D1DA 2EIAA 1VQ8P 1M90Q 1EIAA 2PEQA 3DS0A 2JO0A 1YJ9P 1S72P 3G29A 1M6EX 1VQPP 3DS2A 2M8NA 2JYLA 3B5IA 3CPWO 4GR2A 4PH0A 5HGLA 1KQSO 3CC2P 2P9XA 1VQLP 2Z46A 1QRJA 4IPYA 4WYMA 4PH1A 1YI2P 1E6JP 1VQKP 1YJWP 1RO0A 3E2DA 3G0VA 2KODA 3P05A 2PEOA 2XT1A 3H0DA 2QEXP 1A43A 3Q20A 3CCMP 1QVGO 1YJNP 1YHQP 1Q7YQ 3CCLP 2E1MA 1VQ5P 3I55P 2ONTA 4XROA 4GR6A 1VQ6P 3MGEA 2PENA 3RG6C 5F2KA 2M8LA 3OW2O 2XXMA 1Q81Q 1K8AQ 2PEKA 2M8PA 2QA4P 5HGNA 2OTJP 5HGMA 4XRQA 3CCEP 4XFYA 3H4EA 2EG5A 1RNIA 1N8RQ 2Z45A 1BAJA 3G1GA 3G1IA 3CCJP 3NTEA 3CCUP 3G21A 2XV6A 5BS1A 3VRLC 2LF4A 3HZQA 2PEIA 1W2BO 1A8OA 1VQOP 3G71P 4U0EA 3DS1A 4U0FA 3DS3A 2PEMA 5DCKA 1KC8Q 1Q82Q 1VQNP 1VQ4P 1M6NA 1Q86Q 1K30A 3CC7P 2EFJA 4U0BA 3G4SP 3CMAP 4QNBA 4U0DA 3CCRP 5HGOA 3G26A 3DS5A 4U0AA 1VQMP 2L6EA 1IUQA 5BS2A 5F2NA 1K9MQ 1VQ7P 2CWOA 3G28A 1NJIQ 1JJ2O 1ZMBA 2BUOA 4COCA 2OARA 1VQ9P 3HYBA 3G6EP 1M1KQ 1EOQA 5F2OA 4XFZA 3CXCO 3LRYA 4COPA 2PEJA 2JYGA 4XFXA 3CCQP 1YIJP 1QVFO 1AUMA 3M1MA 1RO2A 2Z44A 3H47A 4M0IA 3CD6P 5I4TG 4U0CA 3WBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEN A;  2PEJ A;  3RG6 C;  4GR6 A;  3HYB A;  2PEQ A;  5BS1 A;  5BS2 A;  2Z45 A;  4GR2 A;  2PY8 A;  2Z44 A;  2PEI A;  2PEM A;  2PEO A;  3Q20 A;  2PEK A;  2Z46 A; 
#chains in the Genus database with same CATH topology
 2WPT A;  4IZ6 A;  1K73 Q;  2M5R A;  2MD9 A;  3CME P;  2GZF A;  2EIA A;  2MR8 A;  2KOS A;  2N5I A;  2PEQ A;  2MY5 A;  2JQ4 A;  1M6E X;  1L0H A;  2EHS A;  1NQ4 A;  2KOR A;  2Z46 A;  4BPG A;  4PH1 A;  1YI2 P;  1E6J P;  1YJW P;  3H0D A;  1A43 A;  1QVG O;  1DV5 A;  1Q7Y Q;  2E1M A;  2N50 A;  3I55 P;  2ONT A;  1VQ6 P;  2PEN A;  1L0I A;  1HY8 A;  2EHT A;  1CEI A;  2LPK A;  2AFD A;  2K93 A;  5HGM A;  3CCE P;  2KGD A;  4BPH A;  1RNI A;  1BAJ A;  4BPF A;  1FR2 A;  3G21 A;  4H2W C;  5BS1 A;  2K94 A;  3HZQ A;  1A8O A;  1OR5 A;  2FQ1 A;  2LOL A;  3DS1 A;  1E0H A;  2VLQ A;  5DCK A;  1BXI A;  2LML A;  1VQN P;  1VQ4 P;  1KLP A;  3CC7 P;  2EFJ A;  3G4S P;  5HGO A;  4MRT C;  3U43 A;  1IUQ A;  1VQ7 P;  5KP7 B;  1NJI Q;  1JJ2 O;  4COC A;  2LKI A;  1VQ9 P;  3HYB A;  3G6E P;  2VLP A;  1EOQ A;  4UHP B;  1QVF O;  2PEJ A;  1YIJ P;  2XZ1 C;  1AUM A;  2LIW A;  1RO2 A;  2L22 A;  2Z44 A;  3H47 A;  4CA3 A;  5I4T G;  4U0C A;  1VQK P;  2L0Q A;  3CCS P;  4HKG A;  2OTL P;  1M74 A;  2CGQ A;  2KG6 A;  2KGC A;  2LTE A;  2M8N A;  3LMO A;  2JU1 A;  4GR2 A;  4PH0 A;  3CC2 P;  1QRJ A;  4IPY A;  4WYM A;  5HVC A;  1ACP A;  1RO0 A;  3G0V A;  2JAZ A;  2XT1 A;  4H2X C;  3RG2 A;  3CCM P;  2FAC A;  1DNY A;  2FVA A;  5F2K A;  2M8L A;  1K8A Q;  1HQB A;  2M8P A;  3EJE A;  2OTJ P;  3H4E A;  1N8R Q;  2FQ0 A;  3G1G A;  2VLO A;  1T8K A;  5KP6 B;  2XV6 A;  3B4Q A;  2LF4 A;  2DNW A;  2PEI A;  2FVF A;  3G71 P;  3DS3 A;  2LIU A;  2LL8 A;  2KOQ A;  1K30 A;  4QNB A;  5CZD B;  3CCR P;  2ERH A;  3DS5 A;  1GXG A;  4U0A A;  1VQM P;  2FQ2 A;  2L6E A;  1K9M Q;  2CWO A;  4F37 A;  2GZG A;  3G28 A;  4R0M A;  2OAR A;  2K0D X;  5F2O A;  4XFZ A;  2AVA A;  4COP A;  2GDW A;  1IMQ A;  3WBH A;  1KD1 Q;  5EW5 E;  2N98 A;  1UNK A;  3CCV P;  3DS4 A;  3DTJ A;  1Z6M A;  2DGY A;  1MZ8 A;  1EMV A;  2N5H A;  3I56 P;  1VQ8 P;  2K92 A;  2N6Z A;  2JBG A;  2KGA A;  1S72 P;  3G29 A;  1VQP P;  4DG9 A;  2JYL A;  3B5I A;  5HGL A;  1KQS O;  2P9X A;  3CE7 A;  3P05 A;  3E2D A;  2KOD A;  2PEO A;  2QEX P;  2GZJ A;  2KW2 A;  2GYK A;  1YJN P;  1YHQ P;  2NO8 A;  4GR6 A;  3MGE A;  1Q81 Q;  2FHS C;  2PEK A;  4XFY A;  4NEO A;  2EG5 A;  3CCJ P;  3CCU P;  3VRL C;  1W2B O;  1VQO P;  2K0X A;  4U0F A;  2FAE A;  2PEM A;  3NY7 B;  1KC8 Q;  1M6N A;  1Q86 Q;  5KP8 B;  4U0B A;  2AFE A;  4U0D A;  3G26 A;  2JB0 A;  2VLN A;  1ZMB A;  2BUO A;  2CG5 B;  1F80 D;  3EJD A;  1M1K Q;  2QNW A;  3CXC O;  2CNR A;  4QKO A;  3CCQ P;  7CEI A;  2CQ8 A;  4M0I A;  2KG8 A;  3CD6 P;  1VKU A;  2KGE A;  3DPH A;  5JPA A;  1YIT P;  2K2Q A;  2PY8 A;  1X3O A;  2BHV A;  3CC4 P;  5EJD A;  1D1D A;  5HV8 A;  2KWL A;  1M90 Q;  3GJN A;  2KOO A;  1EIA A;  1UJZ A;  2L9F A;  3DS0 A;  2JO0 A;  1YJ9 P;  3DS2 A;  2XZ0 D;  2L4B A;  3CPW O;  2GZE A;  1VQL P;  2K5X A;  2X2B A;  1AF8 A;  2VSQ A;  2ROQ A;  2N6Y A;  3Q20 A;  3CCL P;  4PXH B;  1VQ5 P;  4XRO A;  3RG6 C;  2FAD A;  3OW2 O;  2XXM A;  2QA4 P;  5HGN A;  2PNG A;  4XRQ A;  2KOP A;  2Z45 A;  3G1I A;  3NTE A;  2GZI A;  2JGP A;  4U0E A;  1ZNV A;  1Q82 Q;  2KG9 A;  1GPJ A;  2JU2 A;  1AYI A;  3CMA P;  4PWV B;  3GZL A;  2MF4 A;  5BS2 A;  5F2N A;  2MVV A;  3EJB A;  2GDX A;  2GDY A;  3GZM A;  2KR5 A;  2MVU A;  1GXH A;  2K0Y A;  1VHN A;  2MR7 A;  2FVE A;  3LRY A;  3GKL C;  4XFX A;  2JYG A;  3M1M A;  4H2Y C;  1IMP A;  2AF8 A; 
#chains in the Genus database with same CATH homology
 3DPH A;  5JPA A;  1KD1 Q;  1YIT P;  3CCV P;  3DS4 A;  3CCS P;  2PY8 A;  3DTJ A;  1K73 Q;  2DGY A;  3CME P;  3I56 P;  2OTL P;  1M74 A;  2BHV A;  3CC4 P;  1D1D A;  2EIA A;  1VQ8 P;  1M90 Q;  1EIA A;  2PEQ A;  3DS0 A;  2JO0 A;  1YJ9 P;  1S72 P;  3G29 A;  1M6E X;  1VQP P;  3DS2 A;  2M8N A;  2JYL A;  3B5I A;  3CPW O;  4GR2 A;  4PH0 A;  5HGL A;  1KQS O;  3CC2 P;  2P9X A;  1VQL P;  2Z46 A;  1QRJ A;  4IPY A;  4WYM A;  4PH1 A;  1YI2 P;  1E6J P;  1VQK P;  1YJW P;  1RO0 A;  3E2D A;  3G0V A;  2KOD A;  3P05 A;  2PEO A;  2XT1 A;  3H0D A;  2QEX P;  1A43 A;  3Q20 A;  3CCM P;  1QVG O;  1YJN P;  1YHQ P;  1Q7Y Q;  3CCL P;  2E1M A;  1VQ5 P;  3I55 P;  2ONT A;  4XRO A;  4GR6 A;  1VQ6 P;  3MGE A;  2PEN A;  3RG6 C;  5F2K A;  2M8L A;  3OW2 O;  2XXM A;  1Q81 Q;  1K8A Q;  2PEK A;  2M8P A;  2QA4 P;  5HGN A;  2OTJ P;  5HGM A;  4XRQ A;  3CCE P;  4XFY A;  3H4E A;  2EG5 A;  1RNI A;  1N8R Q;  2Z45 A;  1BAJ A;  3G1G A;  3G1I A;  3CCJ P;  3NTE A;  3CCU P;  3G21 A;  2XV6 A;  5BS1 A;  3VRL C;  2LF4 A;  3HZQ A;  2PEI A;  1W2B O;  1A8O A;  1VQO P;  3G71 P;  4U0E A;  3DS1 A;  4U0F A;  3DS3 A;  2PEM A;  5DCK A;  1KC8 Q;  1Q82 Q;  1VQN P;  1VQ4 P;  1M6N A;  1Q86 Q;  1K30 A;  3CC7 P;  2EFJ A;  4U0B A;  3G4S P;  3CMA P;  4QNB A;  4U0D A;  3CCR P;  5HGO A;  3G26 A;  3DS5 A;  4U0A A;  1VQM P;  2L6E A;  1IUQ A;  5BS2 A;  5F2N A;  1K9M Q;  1VQ7 P;  2CWO A;  3G28 A;  1NJI Q;  1JJ2 O;  1ZMB A;  2BUO A;  4COC A;  2OAR A;  1VQ9 P;  3HYB A;  3G6E P;  1M1K Q;  1EOQ A;  5F2O A;  4XFZ A;  3CXC O;  3LRY A;  4COP A;  2PEJ A;  2JYG A;  4XFX A;  3CCQ P;  1YIJ P;  1QVF O;  1AUM A;  3M1M A;  1RO2 A;  2Z44 A;  3H47 A;  4M0I A;  3CD6 P;  5I4T G;  4U0C A;  3WBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...