2PEIA

Crystal structure of selenomethionine-labeled rbcx
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 43
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peiA00
2Z45A 2PEIA 3RG6C 2PY8A 2PEQA 3HYBA 3Q20A 4GR6A 5BS2A 2Z46A 5BS1A 2PEJA 4GR2A 2Z44A 2PENA 2PEOA 2PEMA 2PEKA
chains in the Genus database with same CATH superfamily
3CCMP 1E0HA 1UNKA 1EMVA 2LOLA 2FVFA 2KG8A 2K5XA 2L6EA 2FADA 2GZGA 3CXCO 2GZIA 1KC8Q 5EJDA 1AF8A 3G1IA 3H0DA 4NEOA 1NQ4A 4IPYA 2FQ0A 2CWOA 2GZJA 4U0FA 2K92A 2FHSC 2ERHA 1GXGA 3CCQP 2N50A 1VQMP 2FQ2A 2VLQA 1K9MQ 2PEIA 2XZ0D 3I55P 1CEIA 2LKIA 1NJIQ 2VLOA 1K73Q 2GDXA 3CCUP 4U0BA 1Q7YQ 2K0DX 2EIAA 2Z46A 4COCA 1VQKP 3DS2A 2NO8A 2K2QA 4PWVB 3OW2O 2XV6A 5HGMA 1M6NA 2Z44A 3DS1A 4XROA 1BXIA 2VLNA 2KWLA 2PEOA 2QNWA 4PXHB 5CZDB 2FVAA 2M8PA 1N8RQ 3EJBA 1M1KQ 1Q81Q 2JU2A 1Q86Q 4U0CA 2JAZA 2KOPA 2AVAA 5I4TG 3DTJA 2QEXP 2FAEA 4U0AA 2VSQA 2PENA 2ONTA 2M5RA 1FR2A 2K93A 2KGDA 1BAJA 1IUQA 3GZMA 2JO0A 3DS4A 3DS5A 1M6EX 2OARA 1OR5A 2VLPA 2KR5A 1YHQP 2LPKA 4COPA 2PY8A 3GKLC 2EHTA 2N5IA 1VHNA 1MZ8A 3CCRP 1L0IA 4HKGA 3CCLP 3CCJP 3CCEP 3GZLA 1KD1Q 3HYBA 3P05A 2DGYA 1ACPA 4U0EA 2OTJP 2K94A 1IMPA 2KOQA 5HGOA 2KOSA 2PEKA 2KG9A 1YJWP 2EFJA 1YITP 1YJ9P 4BPHA 3GJNA 2L22A 4PH1A 1JJ2O 1VQOP 1K8AQ 1VKUA 4MRTC 3EJEA 1E6JP 2JU1A 3G28A 1HQBA 2EHSA 2AFDA 2LIUA 3LMOA 1VQ5P 5JPAA 5HV8A 4IZ6A 3WBHA 1M90Q 3DS3A 4WYMA 2FACA 2KODA 4GR6A 3CD6P 2MD9A 1VQ7P 2WPTA 3CC2P 2M8LA 2KGCA 2L9FA 2JYLA 2JB0A 1RNIA 3Q20A 7CEIA 2KG6A 2DNWA 2PEJA 3CE7A 1Q82Q 1QVGO 3VRLC 3E2DA 2MR8A 2MR7A 2JBGA 1DV5A 1AYIA 5F2NA 1QVFO 5F2KA 1ZNVA 1VQ8P 3G21A 2LL8A 1L0HA 1QRJA 2MVUA 3CCSP 2N98A 4M0IA 2L4BA 3DS0A 2XT1A 2GYKA 3G71P 5DCKA 2EG5A 1YJNP 4PH0A 2KORA 1ZMBA 4GR2A 1DNYA 3G4SP 1KQSO 1KLPA 2N6ZA 1RO0A 2CGQA 2N6YA 1VQ4P 1D1DA 1AUMA 2KGEA 1RO2A 5HVCA 3CMAP 2AF8A 5F2OA 2KGAA 3B5IA 3CC7P 3RG2A 4CA3A 1GXHA 2MF4A 1YI2P 2CQ8A 2KW2A 1Z6MA 2FVEA 3CMEP 1S72P 3CC4P 5BS2A 2BUOA 5KP7B 1VQ6P 2L0QA 3NTEA 2E1MA 1HY8A 2BHVA 3MGEA 4QKOA 3CCVP 1A8OA 4BPFA 3B4QA 5EW5E 4F37A 2XXMA 2KOOA 3U43A 3H47A 2GZFA 2M8NA 3G1GA 4DG9A 1X3OA 2PEQA 1GPJA 3EJDA 2K0YA 1IMQA 3HZQA 3CPWO 4QNBA 2GDWA 5BS1A 3G26A 4XFYA 2GZEA 2N5HA 2LF4A 1VQNP 2FQ1A 2JGPA 4XFXA 1VQ9P 1EIAA 5KP8B 1YIJP 3G6EP 3DPHA 1VQLP 2MVVA 1K30A 1M74A 3H4EA 5KP6B 4R0MA 2LMLA 2OTLP 2JQ4A 1EOQA 3G29A 2X2BA 4H2YC 1F80D 4UHPB 1A43A 1VQPP 5HGLA 3LRYA 1UJZA 2LIWA 2Z45A 3G0VA 1W2BO 2ROQA 2AFEA 2QA4P 2XZ1C 3I56P 4BPGA 2P9XA 2PNGA 2JYGA 2CNRA 4XRQA 3RG6C 1T8KA 5HGNA 2CG5B 2GDYA 4H2WC 4U0DA 3NY7B 4H2XC 4XFZA 2PEMA 2MY5A 3M1MA 2K0XA 2LTEA
chains in the Genus database with same CATH topology
1QVGO 3DTJA 3VRLC 3E2DA 2QEXP 3CCMP 4U0AA 2PENA 5F2NA 2ONTA 1QVFO 2XXMA 5F2KA 3H47A 1BAJA 1IUQA 2M8NA 3G1GA 2L6EA 1VQ8P 2JO0A 2PEQA 3DS4A 3DS5A 3G21A 1QRJA 3CXCO 1KC8Q 3G1IA 1M6EX 3HZQA 3CCSP 2OARA 4M0IA 3H0DA 3CPWO 4QNBA 1YHQP 3DS0A 5BS1A 4IPYA 2XT1A 4COPA 2CWOA 2PY8A 3G26A 4XFYA 3G71P 4U0FA 2LF4A 1VQNP 5DCKA 4XFXA 2EG5A 1VQ9P 1YJNP 3CCQP 1EIAA 1YIJP 3G6EP 3DPHA 1VQLP 1VQMP 3CCRP 1K30A 1M74A 3H4EA 4PH0A 3CCLP 3CCJP 3CCEP 1ZMBA 4GR2A 1KD1Q 2OTLP 1K9MQ 3G4SP 2PEIA 3I55P 3HYBA 3P05A 2DGYA 1EOQA 4U0EA 3G29A 1NJIQ 2OTJP 1KQSO 1K73Q 1A43A 1RO0A 3CCUP 1VQPP 5HGLA 3LRYA 1VQ4P 4U0BA 5HGOA 1Q7YQ 2PEKA 1D1DA 1AUMA 2EIAA 2Z46A 1YJWP 2EFJA 1YITP 1YJ9P 4COCA 1VQKP 1RO2A 3DS2A 3CMAP 5F2OA 4PH1A 1JJ2O 3OW2O 1VQOP 1K8AQ 3B5IA 3CC7P 2Z45A 2XV6A 1E6JP 3G28A 3G0VA 1W2BO 5HGMA 1M6NA 2Z44A 3DS1A 2QA4P 4XROA 3I56P 1YI2P 1VQ5P 5JPAA 2P9XA 3WBHA 2PEOA 2JYGA 1M90Q 3DS3A 4XRQA 4WYMA 3RG6C 3CMEP 1S72P 3CC4P 2KODA 4GR6A 5BS2A 2M8PA 5HGNA 3CD6P 2BUOA 4U0DA 1VQ7P 1VQ6P 1N8RQ 3CC2P 1M1KQ 2M8LA 3NTEA 1Q81Q 2E1MA 4XFZA 2JYLA 1Q86Q 1RNIA 2PEMA 4U0CA 2BHVA 3MGEA 3M1MA 3CCVP 3Q20A 2PEJA 1Q82Q 1A8OA 5I4TG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z45 A;  2PEI A;  3RG6 C;  2PY8 A;  2PEQ A;  3HYB A;  3Q20 A;  4GR6 A;  5BS2 A;  2Z46 A;  5BS1 A;  2PEJ A;  4GR2 A;  2Z44 A;  2PEN A;  2PEO A;  2PEM A;  2PEK A; 
#chains in the Genus database with same CATH topology
 3CCM P;  1E0H A;  1UNK A;  1EMV A;  2LOL A;  2FVF A;  2KG8 A;  2K5X A;  2L6E A;  2FAD A;  2GZG A;  3CXC O;  2GZI A;  1KC8 Q;  5EJD A;  1AF8 A;  3G1I A;  3H0D A;  4NEO A;  1NQ4 A;  4IPY A;  2FQ0 A;  2CWO A;  2GZJ A;  4U0F A;  2K92 A;  2FHS C;  2ERH A;  1GXG A;  3CCQ P;  2N50 A;  1VQM P;  2FQ2 A;  2VLQ A;  1K9M Q;  2PEI A;  2XZ0 D;  3I55 P;  1CEI A;  2LKI A;  1NJI Q;  2VLO A;  1K73 Q;  2GDX A;  3CCU P;  4U0B A;  1Q7Y Q;  2K0D X;  2EIA A;  2Z46 A;  4COC A;  1VQK P;  3DS2 A;  2NO8 A;  2K2Q A;  4PWV B;  3OW2 O;  2XV6 A;  5HGM A;  1M6N A;  2Z44 A;  3DS1 A;  4XRO A;  1BXI A;  2VLN A;  2KWL A;  2PEO A;  2QNW A;  4PXH B;  5CZD B;  2FVA A;  2M8P A;  1N8R Q;  3EJB A;  1M1K Q;  1Q81 Q;  2JU2 A;  1Q86 Q;  4U0C A;  2JAZ A;  2KOP A;  2AVA A;  5I4T G;  3DTJ A;  2QEX P;  2FAE A;  4U0A A;  2VSQ A;  2PEN A;  2ONT A;  2M5R A;  1FR2 A;  2K93 A;  2KGD A;  1BAJ A;  1IUQ A;  3GZM A;  2JO0 A;  3DS4 A;  3DS5 A;  1M6E X;  2OAR A;  1OR5 A;  2VLP A;  2KR5 A;  1YHQ P;  2LPK A;  4COP A;  2PY8 A;  3GKL C;  2EHT A;  2N5I A;  1VHN A;  1MZ8 A;  3CCR P;  1L0I A;  4HKG A;  3CCL P;  3CCJ P;  3CCE P;  3GZL A;  1KD1 Q;  3HYB A;  3P05 A;  2DGY A;  1ACP A;  4U0E A;  2OTJ P;  2K94 A;  1IMP A;  2KOQ A;  5HGO A;  2KOS A;  2PEK A;  2KG9 A;  1YJW P;  2EFJ A;  1YIT P;  1YJ9 P;  4BPH A;  3GJN A;  2L22 A;  4PH1 A;  1JJ2 O;  1VQO P;  1K8A Q;  1VKU A;  4MRT C;  3EJE A;  1E6J P;  2JU1 A;  3G28 A;  1HQB A;  2EHS A;  2AFD A;  2LIU A;  3LMO A;  1VQ5 P;  5JPA A;  5HV8 A;  4IZ6 A;  3WBH A;  1M90 Q;  3DS3 A;  4WYM A;  2FAC A;  2KOD A;  4GR6 A;  3CD6 P;  2MD9 A;  1VQ7 P;  2WPT A;  3CC2 P;  2M8L A;  2KGC A;  2L9F A;  2JYL A;  2JB0 A;  1RNI A;  3Q20 A;  7CEI A;  2KG6 A;  2DNW A;  2PEJ A;  3CE7 A;  1Q82 Q;  1QVG O;  3VRL C;  3E2D A;  2MR8 A;  2MR7 A;  2JBG A;  1DV5 A;  1AYI A;  5F2N A;  1QVF O;  5F2K A;  1ZNV A;  1VQ8 P;  3G21 A;  2LL8 A;  1L0H A;  1QRJ A;  2MVU A;  3CCS P;  2N98 A;  4M0I A;  2L4B A;  3DS0 A;  2XT1 A;  2GYK A;  3G71 P;  5DCK A;  2EG5 A;  1YJN P;  4PH0 A;  2KOR A;  1ZMB A;  4GR2 A;  1DNY A;  3G4S P;  1KQS O;  1KLP A;  2N6Z A;  1RO0 A;  2CGQ A;  2N6Y A;  1VQ4 P;  1D1D A;  1AUM A;  2KGE A;  1RO2 A;  5HVC A;  3CMA P;  2AF8 A;  5F2O A;  2KGA A;  3B5I A;  3CC7 P;  3RG2 A;  4CA3 A;  1GXH A;  2MF4 A;  1YI2 P;  2CQ8 A;  2KW2 A;  1Z6M A;  2FVE A;  3CME P;  1S72 P;  3CC4 P;  5BS2 A;  2BUO A;  5KP7 B;  1VQ6 P;  2L0Q A;  3NTE A;  2E1M A;  1HY8 A;  2BHV A;  3MGE A;  4QKO A;  3CCV P;  1A8O A;  4BPF A;  3B4Q A;  5EW5 E;  4F37 A;  2XXM A;  2KOO A;  3U43 A;  3H47 A;  2GZF A;  2M8N A;  3G1G A;  4DG9 A;  1X3O A;  2PEQ A;  1GPJ A;  3EJD A;  2K0Y A;  1IMQ A;  3HZQ A;  3CPW O;  4QNB A;  2GDW A;  5BS1 A;  3G26 A;  4XFY A;  2GZE A;  2N5H A;  2LF4 A;  1VQN P;  2FQ1 A;  2JGP A;  4XFX A;  1VQ9 P;  1EIA A;  5KP8 B;  1YIJ P;  3G6E P;  3DPH A;  1VQL P;  2MVV A;  1K30 A;  1M74 A;  3H4E A;  5KP6 B;  4R0M A;  2LML A;  2OTL P;  2JQ4 A;  1EOQ A;  3G29 A;  2X2B A;  4H2Y C;  1F80 D;  4UHP B;  1A43 A;  1VQP P;  5HGL A;  3LRY A;  1UJZ A;  2LIW A;  2Z45 A;  3G0V A;  1W2B O;  2ROQ A;  2AFE A;  2QA4 P;  2XZ1 C;  3I56 P;  4BPG A;  2P9X A;  2PNG A;  2JYG A;  2CNR A;  4XRQ A;  3RG6 C;  1T8K A;  5HGN A;  2CG5 B;  2GDY A;  4H2W C;  4U0D A;  3NY7 B;  4H2X C;  4XFZ A;  2PEM A;  2MY5 A;  3M1M A;  2K0X A;  2LTE A; 
#chains in the Genus database with same CATH homology
 1QVG O;  3DTJ A;  3VRL C;  3E2D A;  2QEX P;  3CCM P;  4U0A A;  2PEN A;  5F2N A;  2ONT A;  1QVF O;  2XXM A;  5F2K A;  3H47 A;  1BAJ A;  1IUQ A;  2M8N A;  3G1G A;  2L6E A;  1VQ8 P;  2JO0 A;  2PEQ A;  3DS4 A;  3DS5 A;  3G21 A;  1QRJ A;  3CXC O;  1KC8 Q;  3G1I A;  1M6E X;  3HZQ A;  3CCS P;  2OAR A;  4M0I A;  3H0D A;  3CPW O;  4QNB A;  1YHQ P;  3DS0 A;  5BS1 A;  4IPY A;  2XT1 A;  4COP A;  2CWO A;  2PY8 A;  3G26 A;  4XFY A;  3G71 P;  4U0F A;  2LF4 A;  1VQN P;  5DCK A;  4XFX A;  2EG5 A;  1VQ9 P;  1YJN P;  3CCQ P;  1EIA A;  1YIJ P;  3G6E P;  3DPH A;  1VQL P;  1VQM P;  3CCR P;  1K30 A;  1M74 A;  3H4E A;  4PH0 A;  3CCL P;  3CCJ P;  3CCE P;  1ZMB A;  4GR2 A;  1KD1 Q;  2OTL P;  1K9M Q;  3G4S P;  2PEI A;  3I55 P;  3HYB A;  3P05 A;  2DGY A;  1EOQ A;  4U0E A;  3G29 A;  1NJI Q;  2OTJ P;  1KQS O;  1K73 Q;  1A43 A;  1RO0 A;  3CCU P;  1VQP P;  5HGL A;  3LRY A;  1VQ4 P;  4U0B A;  5HGO A;  1Q7Y Q;  2PEK A;  1D1D A;  1AUM A;  2EIA A;  2Z46 A;  1YJW P;  2EFJ A;  1YIT P;  1YJ9 P;  4COC A;  1VQK P;  1RO2 A;  3DS2 A;  3CMA P;  5F2O A;  4PH1 A;  1JJ2 O;  3OW2 O;  1VQO P;  1K8A Q;  3B5I A;  3CC7 P;  2Z45 A;  2XV6 A;  1E6J P;  3G28 A;  3G0V A;  1W2B O;  5HGM A;  1M6N A;  2Z44 A;  3DS1 A;  2QA4 P;  4XRO A;  3I56 P;  1YI2 P;  1VQ5 P;  5JPA A;  2P9X A;  3WBH A;  2PEO A;  2JYG A;  1M90 Q;  3DS3 A;  4XRQ A;  4WYM A;  3RG6 C;  3CME P;  1S72 P;  3CC4 P;  2KOD A;  4GR6 A;  5BS2 A;  2M8P A;  5HGN A;  3CD6 P;  2BUO A;  4U0D A;  1VQ7 P;  1VQ6 P;  1N8R Q;  3CC2 P;  1M1K Q;  2M8L A;  3NTE A;  1Q81 Q;  2E1M A;  4XFZ A;  2JYL A;  1Q86 Q;  1RNI A;  2PEM A;  4U0C A;  2BHV A;  3MGE A;  3M1M A;  3CCV P;  3Q20 A;  2PEJ A;  1Q82 Q;  1A8O A;  5I4T G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...