2PEIA

Crystal structure of selenomethionine-labeled rbcx
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
107
structure length
107
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Structure and Function of RbcX, an Assembly Chaperone for Hexadecameric Rubisco.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 43
structure length 107
sequence length 107
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2007-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2peiA00
2PEKA 4GR2A 2PENA 2PEIA 2PY8A 2PEQA 3Q20A 3RG6C 5BS1A 2Z44A 5BS2A 2PEOA 2Z45A 2Z46A 3HYBA 4GR6A 2PEMA 2PEJA
chains in the Genus database with same CATH superfamily
1E0HA 2MR8A 2BUOA 2CNRA 2CQ8A 1KD1Q 3Q20A 5EJDA 2CWOA 2JQ4A 5BS2A 2FACA 2PEJA 5HVCA 4U0EA 3CCQP 2N6ZA 2XV6A 2EIAA 1RO0A 1D1DA 3DS1A 5BS1A 1VQMP 5F2NA 3CXCO 4U0FA 3EJEA 2VLQA 3HYBA 3WBHA 1BXIA 4H2YC 2ONTA 2N5IA 3CCSP 2Z46A 2JBGA 1AF8A 1ZMBA 2JAZA 2JYGA 2N50A 3DS2A 2KWLA 2CGQA 3G1GA 3H47A 5EW5E 1VQNP 1EMVA 1VQPP 2KOPA 1IMPA 2EG5A 4XROA 5HV8A 3GJNA 3G71P 1UJZA 2GZIA 1ACPA 2LIUA 2VLPA 2GZFA 4QNBA 3CC7P 3B4QA 1E6JP 1QVGO 4BPFA 3NTEA 2ROQA 3EJDA 2LF4A 4GR6A 2XXMA 1M74A 2PEIA 1EIAA 3CCMP 4QKOA 1OR5A 2L22A 3NY7B 2KGAA 2GZEA 7CEIA 1MZ8A 3G29A 2OTJP 3DS4A 1YITP 3CMEP 2L6EA 2M8NA 2Z44A 3HZQA 3OW2O 3G1IA 2PNGA 2KG9A 4HKGA 1GPJA 2XZ0D 4H2XC 3G4SP 2L9FA 2AFEA 2KODA 4DG9A 2FADA 1YJNP 3B5IA 2OARA 5CZDB 2KOSA 1T8KA 1VQKP 1YJWP 4MRTC 2KOQA 4XFYA 1JJ2O 5HGNA 2KGEA 4IPYA 2JYLA 5DCKA 2GYKA 2QNWA 3G21A 2PENA 1N8RQ 2VLNA 1F80D 1M90Q 1K73Q 1RNIA 1AYIA 3P05A 3G0VA 2JB0A 4IZ6A 3E2DA 2GDYA 4M0IA 5HGOA 2MD9A 4BPHA 4U0CA 2GZJA 2BHVA 2LIWA 2DGYA 5KP8B 2EHSA 1VHNA 2M8PA 2KR5A 1YIJP 1W2BO 2KGDA 2QA4P 3I56P 2PEQA 1Z6MA 2FAEA 1K30A 3CCLP 5F2KA 1VQLP 1VQ8P 2E1MA 4UHPB 2KORA 3CCEP 1VKUA 2K94A 2KG8A 2M8LA 4WYMA 1IUQA 1Q7YQ 2LOLA 2PEOA 4PH1A 1IMQA 4U0DA 2LTEA 1DV5A 2K92A 3CMAP 2N6YA 3RG2A 3CCJP 2OTLP 4U0AA 3GZLA 3LRYA 2KG6A 2PY8A 1A43A 2AFDA 2K5XA 2MR7A 1M6EX 2K93A 3CCUP 3DS5A 2MVUA 2GZGA 2K0XA 1NQ4A 3U43A 2K0YA 2K0DX 3CC2P 1X3OA 3DTJA 3G28A 1Q82Q 4XFZA 3DS0A 2L0QA 2JO0A 2JU1A 1QVFO 2VSQA 4BPGA 5KP6B 2WPTA 2LPKA 4PXHB 3G26A 1VQ6P 5HGMA 1KLPA 4R0MA 4PWVB 2NO8A 2PEMA 2KOOA 3H0DA 2GDXA 3DS3A 3LMOA 4COCA 1VQ4P 1YJ9P 5KP7B 1GXGA 1UNKA 1YI2P 2LKIA 4PH0A 1AUMA 2P9XA 1L0HA 2XT1A 1S72P 1GXHA 2VLOA 5F2OA 2AF8A 4GR2A 1VQ7P 2AVAA 1K8AQ 2JGPA 2EHTA 1HQBA 1EOQA 1KC8Q 2LL8A 1DNYA 2FVFA 1RO2A 1KQSO 2X2BA 2JU2A 3CCVP 5HGLA 1VQ9P 3CC4P 2M5RA 3H4EA 2MY5A 1FR2A 1YHQP 5I4TG 2MVVA 2XZ1C 2L4BA 1BAJA 1ZNVA 2EFJA 2GDWA 2CG5B 4F37A 4U0BA 3CPWO 2QEXP 1Q86Q 2FHSC 4XFXA 2KGCA 1Q81Q 1K9MQ 3G6EP 4CA3A 2FQ0A 1VQ5P 1M6NA 1L0IA 3M1MA 2PEKA 4NEOA 2N5HA 1QRJA 3CE7A 2FVAA 3I55P 3EJBA 2N98A 2MF4A 5JPAA 3CD6P 2DNWA 4COPA 1NJIQ 2ERHA 3GZMA 4H2WC 3RG6C 1HY8A 4XRQA 3GKLC 3CCRP 3MGEA 3DPHA 2K2QA 1CEIA 1M1KQ 1VQOP 2Z45A 2FVEA 2FQ1A 3VRLC 2KW2A 2LMLA 2FQ2A 1A8OA
chains in the Genus database with same CATH topology
3G29A 2BUOA 4GR2A 1KD1Q 2OTJP 2E1MA 3Q20A 1VQ7P 1K8AQ 3DS4A 2CWOA 1YITP 5BS2A 3CCEP 2M8LA 3CMEP 2L6EA 2M8NA 2Z44A 3HZQA 3OW2O 4WYMA 1IUQA 2PEJA 1EOQA 1Q7YQ 3G1IA 1KC8Q 2PEOA 4PH1A 4U0DA 4U0EA 3G4SP 3CCQP 1RO2A 1KQSO 2KODA 3CMAP 3CCJP 2OTLP 1YJNP 3B5IA 2XV6A 4U0AA 2OARA 2EIAA 5HGLA 3CCVP 1VQ9P 3CC4P 1RO0A 1D1DA 3H4EA 3DS1A 3LRYA 5BS1A 1VQMP 5F2NA 3CXCO 4U0FA 1VQKP 2PY8A 1YJWP 1YHQP 1A43A 5I4TG 4XFYA 1JJ2O 3HYBA 3WBHA 1BAJA 5HGNA 2EFJA 2ONTA 4IPYA 1M6EX 2JYLA 4U0BA 5DCKA 3CPWO 3CCUP 2QEXP 3G21A 3CCSP 1Q86Q 2Z46A 3DS5A 2PENA 1N8RQ 1ZMBA 1M90Q 4XFXA 2JYGA 1K73Q 1RNIA 3DS2A 3CC2P 1Q81Q 1K9MQ 3DTJA 3P05A 3G6EP 3G0VA 3G28A 3G1GA 4XFZA 1VQ5P 3H47A 1M6NA 1Q82Q 3DS0A 1VQNP 3M1MA 2JO0A 2PEKA 3E2DA 1QRJA 1VQPP 4M0IA 5HGOA 2EG5A 4XROA 1QVFO 3I55P 3G71P 4U0CA 2BHVA 2DGYA 5JPAA 3CD6P 4QNBA 3CC7P 3G26A 1VQ6P 4COPA 1NJIQ 2M8PA 5HGMA 1E6JP 3RG6C 1YIJP 4XRQA 1W2BO 1QVGO 3NTEA 3CCRP 2LF4A 3MGEA 2XXMA 2PEMA 4GR6A 2QA4P 3I56P 3H0DA 3DS3A 1M74A 2PEIA 2PEQA 3DPHA 4COCA 1M1KQ 1VQ4P 1YJ9P 1VQOP 1EIAA 2Z45A 1YI2P 3CCMP 4PH0A 1AUMA 3VRLC 1K30A 2P9XA 3CCLP 2XT1A 5F2KA 1S72P 5F2OA 1VQLP 1A8OA 1VQ8P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEK A;  4GR2 A;  2PEN A;  2PEI A;  2PY8 A;  2PEQ A;  3Q20 A;  3RG6 C;  5BS1 A;  2Z44 A;  5BS2 A;  2PEO A;  2Z45 A;  2Z46 A;  3HYB A;  4GR6 A;  2PEM A;  2PEJ A; 
#chains in the Genus database with same CATH topology
 1E0H A;  2MR8 A;  2BUO A;  2CNR A;  2CQ8 A;  1KD1 Q;  3Q20 A;  5EJD A;  2CWO A;  2JQ4 A;  5BS2 A;  2FAC A;  2PEJ A;  5HVC A;  4U0E A;  3CCQ P;  2N6Z A;  2XV6 A;  2EIA A;  1RO0 A;  1D1D A;  3DS1 A;  5BS1 A;  1VQM P;  5F2N A;  3CXC O;  4U0F A;  3EJE A;  2VLQ A;  3HYB A;  3WBH A;  1BXI A;  4H2Y C;  2ONT A;  2N5I A;  3CCS P;  2Z46 A;  2JBG A;  1AF8 A;  1ZMB A;  2JAZ A;  2JYG A;  2N50 A;  3DS2 A;  2KWL A;  2CGQ A;  3G1G A;  3H47 A;  5EW5 E;  1VQN P;  1EMV A;  1VQP P;  2KOP A;  1IMP A;  2EG5 A;  4XRO A;  5HV8 A;  3GJN A;  3G71 P;  1UJZ A;  2GZI A;  1ACP A;  2LIU A;  2VLP A;  2GZF A;  4QNB A;  3CC7 P;  3B4Q A;  1E6J P;  1QVG O;  4BPF A;  3NTE A;  2ROQ A;  3EJD A;  2LF4 A;  4GR6 A;  2XXM A;  1M74 A;  2PEI A;  1EIA A;  3CCM P;  4QKO A;  1OR5 A;  2L22 A;  3NY7 B;  2KGA A;  2GZE A;  7CEI A;  1MZ8 A;  3G29 A;  2OTJ P;  3DS4 A;  1YIT P;  3CME P;  2L6E A;  2M8N A;  2Z44 A;  3HZQ A;  3OW2 O;  3G1I A;  2PNG A;  2KG9 A;  4HKG A;  1GPJ A;  2XZ0 D;  4H2X C;  3G4S P;  2L9F A;  2AFE A;  2KOD A;  4DG9 A;  2FAD A;  1YJN P;  3B5I A;  2OAR A;  5CZD B;  2KOS A;  1T8K A;  1VQK P;  1YJW P;  4MRT C;  2KOQ A;  4XFY A;  1JJ2 O;  5HGN A;  2KGE A;  4IPY A;  2JYL A;  5DCK A;  2GYK A;  2QNW A;  3G21 A;  2PEN A;  1N8R Q;  2VLN A;  1F80 D;  1M90 Q;  1K73 Q;  1RNI A;  1AYI A;  3P05 A;  3G0V A;  2JB0 A;  4IZ6 A;  3E2D A;  2GDY A;  4M0I A;  5HGO A;  2MD9 A;  4BPH A;  4U0C A;  2GZJ A;  2BHV A;  2LIW A;  2DGY A;  5KP8 B;  2EHS A;  1VHN A;  2M8P A;  2KR5 A;  1YIJ P;  1W2B O;  2KGD A;  2QA4 P;  3I56 P;  2PEQ A;  1Z6M A;  2FAE A;  1K30 A;  3CCL P;  5F2K A;  1VQL P;  1VQ8 P;  2E1M A;  4UHP B;  2KOR A;  3CCE P;  1VKU A;  2K94 A;  2KG8 A;  2M8L A;  4WYM A;  1IUQ A;  1Q7Y Q;  2LOL A;  2PEO A;  4PH1 A;  1IMQ A;  4U0D A;  2LTE A;  1DV5 A;  2K92 A;  3CMA P;  2N6Y A;  3RG2 A;  3CCJ P;  2OTL P;  4U0A A;  3GZL A;  3LRY A;  2KG6 A;  2PY8 A;  1A43 A;  2AFD A;  2K5X A;  2MR7 A;  1M6E X;  2K93 A;  3CCU P;  3DS5 A;  2MVU A;  2GZG A;  2K0X A;  1NQ4 A;  3U43 A;  2K0Y A;  2K0D X;  3CC2 P;  1X3O A;  3DTJ A;  3G28 A;  1Q82 Q;  4XFZ A;  3DS0 A;  2L0Q A;  2JO0 A;  2JU1 A;  1QVF O;  2VSQ A;  4BPG A;  5KP6 B;  2WPT A;  2LPK A;  4PXH B;  3G26 A;  1VQ6 P;  5HGM A;  1KLP A;  4R0M A;  4PWV B;  2NO8 A;  2PEM A;  2KOO A;  3H0D A;  2GDX A;  3DS3 A;  3LMO A;  4COC A;  1VQ4 P;  1YJ9 P;  5KP7 B;  1GXG A;  1UNK A;  1YI2 P;  2LKI A;  4PH0 A;  1AUM A;  2P9X A;  1L0H A;  2XT1 A;  1S72 P;  1GXH A;  2VLO A;  5F2O A;  2AF8 A;  4GR2 A;  1VQ7 P;  2AVA A;  1K8A Q;  2JGP A;  2EHT A;  1HQB A;  1EOQ A;  1KC8 Q;  2LL8 A;  1DNY A;  2FVF A;  1RO2 A;  1KQS O;  2X2B A;  2JU2 A;  3CCV P;  5HGL A;  1VQ9 P;  3CC4 P;  2M5R A;  3H4E A;  2MY5 A;  1FR2 A;  1YHQ P;  5I4T G;  2MVV A;  2XZ1 C;  2L4B A;  1BAJ A;  1ZNV A;  2EFJ A;  2GDW A;  2CG5 B;  4F37 A;  4U0B A;  3CPW O;  2QEX P;  1Q86 Q;  2FHS C;  4XFX A;  2KGC A;  1Q81 Q;  1K9M Q;  3G6E P;  4CA3 A;  2FQ0 A;  1VQ5 P;  1M6N A;  1L0I A;  3M1M A;  2PEK A;  4NEO A;  2N5H A;  1QRJ A;  3CE7 A;  2FVA A;  3I55 P;  3EJB A;  2N98 A;  2MF4 A;  5JPA A;  3CD6 P;  2DNW A;  4COP A;  1NJI Q;  2ERH A;  3GZM A;  4H2W C;  3RG6 C;  1HY8 A;  4XRQ A;  3GKL C;  3CCR P;  3MGE A;  3DPH A;  2K2Q A;  1CEI A;  1M1K Q;  1VQO P;  2Z45 A;  2FVE A;  2FQ1 A;  3VRL C;  2KW2 A;  2LML A;  2FQ2 A;  1A8O A; 
#chains in the Genus database with same CATH homology
 3G29 A;  2BUO A;  4GR2 A;  1KD1 Q;  2OTJ P;  2E1M A;  3Q20 A;  1VQ7 P;  1K8A Q;  3DS4 A;  2CWO A;  1YIT P;  5BS2 A;  3CCE P;  2M8L A;  3CME P;  2L6E A;  2M8N A;  2Z44 A;  3HZQ A;  3OW2 O;  4WYM A;  1IUQ A;  2PEJ A;  1EOQ A;  1Q7Y Q;  3G1I A;  1KC8 Q;  2PEO A;  4PH1 A;  4U0D A;  4U0E A;  3G4S P;  3CCQ P;  1RO2 A;  1KQS O;  2KOD A;  3CMA P;  3CCJ P;  2OTL P;  1YJN P;  3B5I A;  2XV6 A;  4U0A A;  2OAR A;  2EIA A;  5HGL A;  3CCV P;  1VQ9 P;  3CC4 P;  1RO0 A;  1D1D A;  3H4E A;  3DS1 A;  3LRY A;  5BS1 A;  1VQM P;  5F2N A;  3CXC O;  4U0F A;  1VQK P;  2PY8 A;  1YJW P;  1YHQ P;  1A43 A;  5I4T G;  4XFY A;  1JJ2 O;  3HYB A;  3WBH A;  1BAJ A;  5HGN A;  2EFJ A;  2ONT A;  4IPY A;  1M6E X;  2JYL A;  4U0B A;  5DCK A;  3CPW O;  3CCU P;  2QEX P;  3G21 A;  3CCS P;  1Q86 Q;  2Z46 A;  3DS5 A;  2PEN A;  1N8R Q;  1ZMB A;  1M90 Q;  4XFX A;  2JYG A;  1K73 Q;  1RNI A;  3DS2 A;  3CC2 P;  1Q81 Q;  1K9M Q;  3DTJ A;  3P05 A;  3G6E P;  3G0V A;  3G28 A;  3G1G A;  4XFZ A;  1VQ5 P;  3H47 A;  1M6N A;  1Q82 Q;  3DS0 A;  1VQN P;  3M1M A;  2JO0 A;  2PEK A;  3E2D A;  1QRJ A;  1VQP P;  4M0I A;  5HGO A;  2EG5 A;  4XRO A;  1QVF O;  3I55 P;  3G71 P;  4U0C A;  2BHV A;  2DGY A;  5JPA A;  3CD6 P;  4QNB A;  3CC7 P;  3G26 A;  1VQ6 P;  4COP A;  1NJI Q;  2M8P A;  5HGM A;  1E6J P;  3RG6 C;  1YIJ P;  4XRQ A;  1W2B O;  1QVG O;  3NTE A;  3CCR P;  2LF4 A;  3MGE A;  2XXM A;  2PEM A;  4GR6 A;  2QA4 P;  3I56 P;  3H0D A;  3DS3 A;  1M74 A;  2PEI A;  2PEQ A;  3DPH A;  4COC A;  1M1K Q;  1VQ4 P;  1YJ9 P;  1VQO P;  1EIA A;  2Z45 A;  1YI2 P;  3CCM P;  4PH0 A;  1AUM A;  3VRL C;  1K30 A;  2P9X A;  3CCL P;  2XT1 A;  5F2K A;  1S72 P;  5F2O A;  1VQL P;  1A8O A;  1VQ8 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...