1VQ9P

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 53
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq9P02
3CCSP 1M90Q 1VQNP 1VQLP 3CD6P 2OTJP 3CCQP 1YITP 3CC4P 1YIJP 3I56P 1K73Q 1K8AQ 1Q7YQ 1VQMP 1QVGO 1YI2P 3CCJP 3CMAP 1Q86Q 1VQ7P 1VQ9P 3OW2O 1YHQP 1YJ9P 1VQ4P 3CPWO 3CC2P 1VQOP 1KD1Q 1VQ8P 3CCLP 1K9MQ 3CCRP 1M1KQ 3CCMP 3CCEP 1KQSO 3CMEP 1JJ2O 2OTLP 1QVFO 1YJNP 1W2BO 3G4SP 2QA4P 1KC8Q 1VQ5P 1YJWP 3G6EP 3CXCO 3CCUP 1NJIQ 1VQKP 3CCVP 1VQPP 1N8RQ 1VQ6P 3I55P 3G71P 2QEXP 1S72P 3CC7P 1Q82Q 1Q81Q
chains in the Genus database with same CATH superfamily
5APXA 1PGOA 2EFJA 5BU8B 1SQVJ 3CCJP 2WQYC 1KYOD 3OW2O 2KGEA 1FZBA 1U7JA 2IBZI 1KQFB 1IZNB 3SFDC 1M1JB 3H1KE 1L4AB 2YKOA 4DCKA 1R8EA 2KIKA 2HPCA 1T8ZA 1L0LG 1LTTC 1K73Q 2N50A 3RG2A 1N2DC 1NTKK 3OJAB 5KJ7D 2B87B 3GZLA 2O1JA 1VF5B 3L75J 2PGDA 5CCGD 1JCDA 2LOLA 3CXCO 2PEQA 1M74A 1AQTA 2FQ1A 3G71P 4L76A 2N98A 3JSVC 4D6TD 2QJYB 1IFDA 1VPCA 1RE4C 5HGNA 1EZVD 1YTZI 2CPSA 2KGCA 2R3CA 1OIPA 1VL2A 3E7KA 2JYGA 1GL2C 1JY3O 5APUA 1NAFA 3AE5C 2C9LY 5BS2A 2WSEH 3RGUA 2MF4A 1KB9D 2J58A 1HBWA 1PGPA 5AW0B 1L0NE 2A06E 1VQ9P 1GU4A 4BPGA 2JP3A 3KYQA 1NU1K 5KP7B 3HE4A 5KAFE 1BE3E 1M6NA 1RNIA 1BXIA 2LMLA 2P2UA 2N6YA 3MIWA 2ERHA 2OYOA 3M9HA 4U3FE 1KILC 2AFDA 1YIJP 3AEFC 2P1JA 3H1LE 2KXPB 2KLUA 5CZDB 1VHNA 1IFPA 1L4AD 4JPZB 1RE4A 2CPBA 3L72E 3V5BA 2BCCD 1W2BO 1HJBA 3CCUP 3P8CE 1RF1C 2YKPA 2N9BA 2WPSA 1VF5D 2K0DX 4H2XC 1IFJA 2NRGA 2HODB 4IZ6A 1OVUA 2OYHC 2KUBA 3PHLA 3SWKA 1HH0A 4WVZA 3L74J 1DNYA 1GZLA 2N1TB 1JNMA 2E76C 2M5AA 2PP6A 2EIAA 1N8RQ 2PFXA 1X3OA 1OVRA 1RE3C 1GU5A 4C7NA 1XTGB 2ZAEB 4U0DA 2GA1A 3P7KA 5DJUB 4F37A 3Q3DA 2ZT9C 2O01H 4AQRD 1KILA 1L0HA 3M9QA 4KHXA 3A7OA 1VQ6P 1E0HA 3WMM0 2KODA 2L22A 3CL3D 2QJKB 3IAOA 5KLVK 2HFED 3PLNA 3O8ZA 1RF1A 2J5UA 1ZR2A 2KOOA 2D2CB 3H1JJ 4GKGA 1JMBA 1NTZD 1BGYD 1PEMA 2PAJA 2HLOA 4KJMA 1BCCD 2ROQA 3E1RA 1FE6A 2O3JA 1NTMD 1SQPJ 2AEFA 4OWFA 4XFYA 3P05A 3G0VA 1SQXD 1VQ7P 4N78E 3CX5D 1ZMEC 1RE3A 2K0YA 2DW3A 2H8PD 2Q3IA 2KZIA 4PH0A 2E75D 2LL8A 2AXTH 1SQQE 1R5SA 3N4XA 2ZXXA 1M90Q 4Y99B 1URQC 3H32A 3B71A 2POHA 1Y9BA 4MN4C 2FXPA 3L36A 3D6YA 2YXRB 5AVWB 2PY8A 5AW4B 1KQGB 2M8RA 3A0BE 2XZ1C 4PD4D 4TT3H 2BUOA 2KOGA 1ZV8A 1FZCC 1KYOH 3VTPC 3FXEA 3AEEC 1ZRTD 3CCQP 3U1CA 1FOSE 2M5AB 3WBHA 2JJLA 1Y8AA 1L0NK 1PPJG 2NPSB 3B4QA 5L8RJ 1PP9D 3LW5J 2C9NY 1LTJC 1SQBG 4H44C 2OTKE 1VKUA 3TGUE 1NOHA 3WUTA 3JCUH 2Z5HA 3CLQA 4OVNF 1N7SB 3L73E 3G28A 2D2CD 1YQ3C 2AVAA 4XA4A 3RK3B 2EHSA 2K3RA 1L2PA 3BVHA 1HWTC 1URQA 4W7ZA 1TU3F 1AVYA 3TNUB 1CEIA 2FYUG 1IMQA 3NY7B 1MZ8A 1CSBA 2A45G 2H88C 1LWUB 2KNCB 1Q81Q 2ONTA 2K1AA 3GHGB 1FJKA 2VLPA 3SWYA 3OA7A 1N73C 3RL0B 2CGQA 1FZCA 4DOJA 2LTEA 2K37A 5AW2B 1EC5A 2X2BA 2OARA 1FZGA 1OVVA 1GTWA 1KB9H 3EFGA 5KP6B 1HJ0A 1U57A 5HGOA 2GUVA 4OGQD 2XZRA 3F5HA 1LTJA 3L70G 3CXHI 1MUUA 2V4HA 4GDOA 1H0TA 1S5LX 1MV8A 3BCCD 3L71D 3DS5A 4W80A 5HGLA 2LXBA 5TISE 2MR8A 1JTHB 2E74D 4R4MA 3H1HE 3B5IA 2MY5A 2Q1KA 1J1EC 1T6AA 1VQPP 4IFMA 3G29A 1L0LK 1JY2N 5KKZB 2KSJA 1NU1D 2E5YA 2AXCA 3AECC 4TLFA 4DJGA 1N73A 5CCGA 2LR2A 3NTNA 3DPHA 1Z6MA 1FZFA 1FZEA 1PEUA 1LP1A 1S72P 3GZMA 2RN0A 1WT6A 4H13D 1JB0J 1NTKE 4WYMA 5AVUB 3USSA 2K94A 2KGDA 1NTZJ 2W27A 1BGYJ 5B5EH 4U0BA 1RF0C 2JDIH 3BRVB 5AVRB 2PNGA 1BCCJ 4BRYB 3UIAA 2M3EA 3RL0D 1VF5C 1EMVA 5E79E 2MVUA 1OR5A 3CD6P 1SQQK 1FC2C 2K5XA 1F80D 1CZQA 1LTIC 1HY8A 3NXSA 3KQGA 5GTHH 4I7ZB 2QJYC 3CPWO 1LT9A 1EDJA 2P58A 3MGNA 2K88A 1OW8A 3HYBA 2CNRA 3H1IG 1FR2A 5HVCA 1SLQA 3GMAA 1K05A 1NYHA 2ZYGA 2OTJP 3CWBG 2GZIA 2PEKA 3A2AA 3AE2C 1SQVE 2GM4A 3V2RA 5AW3B 3HD7B 1M1JA 4PV1B 1H89A 1KFNA 3OAKA 1L4AA 1P84E 2H7HA 2WITA 3KHUA 4PXHB 2FAEA 2M8NA 5CMZA 1S9KD 5KLVD 3CX5H 2FXOA 2NZ2A 2PEMA 3CC4P 2B87A 5H2FE 3Q5SA 2RMZA 3H1JG 2M8PA 1KILE 1VQOP 1QGKB 3L75E 2W83C 1SFCC 3H1KD 5B66E 1SQPG 2DNWA 2W90A 3T97B 5BVZA 2Z45A 2YO2A 4L75A 2C0XA 1JM0A 4PD4H 2KR5A 2P10A 3B8EB 1LTGC 3G26A 5JPAA 5APQA 5APSA 3G3ZA 1G1IA 1FDMA 2GZGA 1Q2NA 3A0HE 1PV3A 2N1TC 1YITP 2P67A 3RL0g 3GF3A 2QJPB 2BASA 1OW7A 4IFFA 1BDDA 1SQBJ 1PZQA 1FS0E 3MHVA 2IBZE 4D6TG 3AEDC 3U59A 2VSQA 3M1MA 3PJSK 5F2NA 1EZVG 4HH2A 1L0ND 2A06D 3V4QA 4JQ0D 4AYCA 3WU2E 4IL6H 4M3LA 2YXQB 1BE3D 1JJ2O 3FWLA 1JY3N 1QVFO 2FYUJ 1UIIA 2JKVA 4I1LA 2MKVA 2HODA 1G1JA 4U3FD 1PFIA 3H1LD 1N7LA 2WSEJ 1WMKA 2RH0A 5AVTB 5DJTB 2N1TA 1M7LA 1SVFA 3L72D 3L74E 3U43A 3U1AA 4U0AA 3ZDMA 3V2NA 3AE4C 1NJIQ 3P8CD 5KP8B 1NO4A 3TDKA 1NKNA 4RJTA 5APYA 3L70J 1QVGO 4XFJA 2XT1A 1FBMA 4Y99C 4LC1A 1S5LE 2HYNA 3CCRP 2BCCG 5HV8A 4GODA 4Z1MH 2A45H 3GLMA 2GDYA 2B9BA 4PJ0H 5AW5B 4ZMDA 1KTMA 4XE5B 1SP4A 2FACA 3VP8A 1SQVK 1KQLA 1H8AA 3KZIH 2Y9YA 1WRGA 3A5TA 4C7RA 3I5CA 2WPVB 2VRSA 2NPSC 3KXDA 3LIEA 1AVOA 4BPHA 1G2CB 2K93A 1HUCA 3S1KA 4NPEA 1HGZA 1GK4A 1Q7YQ 1YI2P 1Q86Q 1AUMA 1EDKA 2E42A 1ZXGA 1KFMA 1N7SC 1T8KA 4ASWA 1QEXA 4DT0A 3RK3C 3HE5B 2VLNA 2OYIB 2YMYA 2K2QA 5APVA 4PWVB 5KLVJ 3Q1MA 2O01J 1LWUC 1Q90D 3FX0A 2E75B 4N78D 1NTZG 1PIXA 3D6ZA 1NVOA 4N3YB 3GHGC 1BGYG 1BCCG 4WY4D 3H1KJ 1RHZB 2XU6A 1NTMG 3EQ2A 1K30A 2I1JA 3H1IJ 4WBAA 1J1DB 3O6QB 2M0BA 3AEAC 1SQXG 2NPSA 3CWBJ 1BSNA 2E1MA 1VQ4P 4JBZA 5KAIH 3CCLP 3GF7A 1X8YA 2XZ0D 5K5GB 3AE1C 1N7SA 3QWOC 1KB9E 1Q82Q 3B5ND 4UB8E 2FBWC 2W6BA 2KG8A 1L0LE 2HG5D 2LKIA 4BPFA 3TNUA 2YMKA 1XTCC 1U7MA 3DTJA 4ZKUA 1LWUA 5KKZC 1KB9I 3EWKA 2KNCA 1T2KC 3TGUD 2K9YA 3GHGA 4XFZA 3L73D 1JO5A 2N9YB 1RO0A 1AV1A 2Q5UA 3MP7B 3CI9A 4H0LD 1MKMA 3PP5A 1PP9G 2ZYDA 5BS1A 1EDLA 3CMEP 1K04A 1OZHA 3GG2A 4AUWA 3IF4A 2W6AA 3GKLC 1J2JB 2QEXP 2I1KA 4GR2A 3VYIA 2L9FA 1JTHA 4OGQB 1S4XA 4W7YA 2L4BA 2PENA 2FY8A 1K9MQ 2VLQA 1E79H 1AFOA 1HVVA 1QL1A 4I7ZC 2WTYA 3SWFA 2FQ2A 1QRJA 2L91A 1PGQA 2E74B 1GL2B 1NWQA 1FDOA 4D6TJ 5M1BA 4LGDE 5CJ0A 3H47A 4B86A 5KAFH 3R4YA 3MGEA 2KP8A 1W2EA 1PEQA 3MTUE 3H1HD 1RH5B 3HD7C 1USEA 4PV1C 1ZLLA 5AW1B 2KLVA 3RK2D 1SQPK 3HTKB 1GXHA 2IYOA 3BCCG 2XXMA 2N5IA 3L71G 5CCHD 3P8MC 3Q5RA 2UWJE 2JQ4A 2QM8A 4GOFA 2Z46A 3QH9A 2WMMA 4BRYA 4RESB 4H13B 2R5DA 1HGVA 1Z56A 3H6PA 2LIUA 1NU1G 2LKMA 1VQMP 5KJ7C 1NTKD 1KV4A 3CX5E 3CXHE 5CCGC 2E5TA 2VLOA 3HUSB 4YTPC 2XKMA 2BCCJ 1EIAA 3LMOA 3WUUA 3CCVP 1IO4A 2NO8A 1NKZB 1X79B 3CX5I 4YXDC 3HD7A 3DS3A 3EFFK 5EW5E 1BDCA 2N6ZA 1IJDB 3VMYA 1GL2D 1FDIA 3M0AA 4EI2A 4QMAA 2FKWB 2QJPC 2O1KA 2WSFJ 1LT9C 1M8OB 2ZT9B 1MFTA 1N86A 1SQVD 1HQBA 3M0DA 2IZ1A 4PD4I 2KS1B 1P84D 2JWAA 5KJ7A 1PEOA 1OMIA 3T97A 1YJWP 4UB6E 2I8DA 3RG6C 3CE7A 1M1JC 2BEZF 1T3UA 1IK9A 1L4AC 1KILD 2KSEA 2WPQA 2PRRA 2JBGA 1KZUB 3L75D 1EQ7A 2WSFH 1A8OA 1E6JP 2WT7B 2JAZA 3TGUJ 5KLVG 3I55P 1NTMJ 1ZNVA 2MD9A 2Y0DA 1MFZA 1SQXJ 3A0BH 1R5LA 2KGAA 1PPJE 3H1KG 2B88A 2ITAA 1SQBE 2FQ0A 2Y0EA 2LPKA 3VRLC 2E76D 3C9IA 2R32A 1JY2O 4K35A 2K92A 1ZR4A 1ZP0C 2R3SA 4MRTC 1EXJA 3L35A 1M56D 2FVEA 4N6JA 2ZT9D 1LT1A 2FYUE 2KOQA 5EJDA 3C1LA 2IBZD 2DGYA 2OQQA 3V6IA 2M3BA 2ZJSE 4R0MA 3HZQA 4U0CA 1D7MA 1X9VA 3AE7C 3G21A 1KORA 2JU1A 1LGHB 1QLED 5AVZB 1PP9J 3R2PA 1IK7A 2OTLP 2O01N 2A45I 2E43A 2C0WA 2AF8A 2ZFCA 3RK3E 3K5BA 3M9BA 3CC7P 1L0NG 3Q2YA 3CCSP 2A06G 3IR9A 3L70E 1M57D 2IZ0A 3S4RA 2G8YA 1QX8A 3CC2P 1BE3G 4A7PA 1DEEG 1IC2A 2CG5B 3L74D 5CHXA 1NQ4A 3NFQA 2E75C 3WUVA 1EOQA 4U3FG 3AE6C 1VQLP 3H1LG 5TISH 5HGMA 2OGUA 2W8ZA 1NTKJ 2KORA 1H88A 4PH1A 1J1DC 3L72G 4HB1A 3NMDA 4IPYA 2QG4A 2EHTA 4GOEA 1NHLA 2FVFA 2YO3A 4EOTA 1G2CA 3G6EP 2GDXA 3KPEA 1IUQA 1OWAA 1GK6A 3V2QA 4QKOA 2JO1A 1L0IA 2JO0A 2P7JA 1GPJA 3BCCJ 2MR7A 1YHQP 3L71J 3HE5A 2QJKC 1LTSC 2OYIA 3N7NA 3VN0A 2YIUB 3FWNA 3BATA 3DS0A 2KOSA 2QVAA 3JC22 4GIFA 2D2CC 4H44D 2WPTA 2H89C 1A02F 1UIXA 4O9BA 2CQ8A 3I56P 5AVVB 2B89A 2LF4A 3GW6A 4NPDA 3SFEC 1ZN5A 1DD3A 4R4LA 1NU1J 1FAVA 3AE8C 2G3AA 5E79H 4ZNCA 1ACPA 3O6QA 1FU1A 3MUDC 4GR6A 3H1IE 1HTLC 4WY4B 5CBOA 2IDBA 3CWBE 1CI6A 2FYZA 4IFDK 1EDIA 3RBXA 3ABVC 1X0TA 4NEOA 5AW9B 4OGQC 3AEGC 1YQ4C 1BAJA 3PRJA 1SQBK 1GXGA 1LTBC 3Q20A 5GTIH 1IMPA 1JY2P 5AVSB 1P84H 1JUNA 2GZFA 1RQUA 2AXTE 2GZEA 2E74C 2V7QJ 4L74A 5CCHA 3G1GA 3B5NB 3H1JE 2Q7CA 5APWA 2AFEA 4BXLA 2QRXA 4JF7A 1VQ5P 1VQKP 1SQQG 5H2FH 1ZMBA 2FYUK 2KW2A 2K9JB 2FYNB 1S3JA 1SQPE 1X22A 1LTAC 2YKQA 2IX7C 1L0LD 1GW4A 1K8AQ 2BHVA 5KLIB 1KYOE 3MUDA 2FFDB 3H0DA 2WSSH 2WVRA 1GMJA 5B66H 5I4TG 4COPA 5AW6B 4H0LB 1LJ2A 3IFMA 2QE7H 2V7QH 4H13C 1KYOI 1DIPA 1LNQA 2H43A 1SFCB 2BQ1E 3JCUE 3G1IA 2ZVOB 4IL6X 3A0HH 3TGUG 3RL0C 2FXMA 1PL5A 1GL2A 1Y47A 3D71A 3HUSC 3L73G 4NPFX 3SSUA 1SQQD 4D6TE 1MZ9A 2HPCB 1EZVE 2QM7A 2PEIA 3L4FA 2Q3EA 3M06A 1CI6B 2Q9IA 2N5HA 2FVAA 4CPGA 1RY3A 1DEBA 3ITKA 1EZVI 3HTKA 1ZW0A 3WU2H 5CBNA 4JYCA 4L73A 2R5BA 2Q6QA 1AF8A 5AW8B 1DD4A 4EIJA 2HR3A 1KD1Q 1FOSF 3RK2B 1NGMB 2JGPA 3H25A 3TF5A 1PGJA 4U0FA 3KDPB 1S1CX 1DH3A 3VMXA 1L0NJ 3HUSA 2LXCB 4ASVA 1HF9A 4I2LC 3H1HG 2WPRA 4GT1A 1GD2E 1BE3J 1A02J 2BCCE 2OYHA 2PEOA 3HE4B 1SFCD 1AQ5A 1KMIZ 3V2PA 4U7JA 3VOPA 1S5LH 1GDTA 4COCA 4U3FJ 3CMAP 3H1LJ 3G9RA 3CXHD 4K3AA 2L6EA 3MD0A 3CCEP 3L72J 3VMAA 1UNKA 2R44A 3L37A 2KZJA 1EXIA 2WSCJ 3MZWB 1AYIA 1NAYA 4BWNA 5CJ4A 5B5EE 5KTBA 1NTKG 2JEEA 2KWLA 2QIWA 2N1TD 5EFWB 2Z44A 2KS1A 2EG5A 1OXZA 3GJNA 4M0IA 2XV6A 1JY3P 1M1KQ 3BRTB 5GTHE 3BASA 1DX7A 1KN7A 4YXWH 5AVQB 3DS4A 2XNXA 4EDFA 4HYTB 5APTA 3AE9C 4C7NB 1NTZE 2WSCH 2WT7A 2ZYAA 1BGYE 5KLVE 1BCCE 4XFXA 4H2YC 1KILB 1W5CE 5BU5A 1NTME 3M0DC 3LRYA 1UJZA 1SQVG 1L0LJ 1SQXE 4LLHA 1OFCX 3DS1A 3Q5PA 1RF1B 2JR8A 4WWIA 1BSHA 1D1DA 1NH4A 2OYHB 2L5GB 2YNYA 3LW5H 4HKZH 4JYBA 4RO0A 3L75G 2KYVA 2E76B 1PPJD 2Y0CA 4IOIH 2Z5IA 4UHPB 2P9XA 4UB8H 1SQBD 3G4SP 3VMZA 4PD4E 1M6EX 2PEJA 5AVXB 4QNBA 1SQQJ 1ZRTE 2XV5A 3C8VA 3II6A 3AEBC 4U0EA 3H32B 1PP9E 2JWDA 2LIWA 3M91A 2IFMA 2FYUD 3FGAD 3F89A 2YIUC 2NPSD 1VQ8P 3VP9A 4KT0J 2IPPA 5AW7B 3P32A 3A3YB 3FXDA 1YYCA 1QL2A 2W6JH 3TYYA 2ZVNB 3IN6A 1N7SD 5F2OA 1S2EA 3TK1A 5C39A 2IBZG 1SS1A 4IL6E 4OH8B 2MVVA 3RK3D 7CEIA 1A43A 2KG6A 1JEKA 3L73J 3L70D 2QNWA 4Y28J 4WY4C 4DZOA 1RO2A 1OX3A 5TJHA 2JB0A 1DV5A 2QA4P 1URQB 1KLPA 3AE3C 3S9OA 5DCKA 2BEQD 2XNDH 3B4SA 3NTEA 2CK3H 1YTZT 1CW5A 2MJZA 1VDFA 3W67A 3BCCE 3L71E 4YPCA 3L74G 1AA0A 2KB7P 4C46A 3EJDA 4XRQA 1FZCB 1KQSO 2CWOA 2Y9ZA 1JCCA 4WB4A 4EYYQ 3B5NC 3E1IA 3HRNA 4I6MC 5F2KA 2IYPA 1LTJB 5AVYB 4H44B 2FYNC 4PJ0E 3PH0A 2L0QA 1NU1E 1H0TB 5GTIE 4HKGA 1NTZK 2GUSA 2AEJA 5KLIC 3H1HJ 2FFDC 2KOPA 1RQVA 1T3JA 3KZIE 1T2KD 4WY4A 3EJBA 3DS2A 2SPZA 1ZOYC 3CXHH 4H0LC 2KG9A 1RF0A 3EJEA 1NTMK 2OYIC 2K0XA 1P84I 1FJPA 4DG9A 1YJ9P 1SQXK 2WZ7A 3LIDA 2WWWA 2Z4EA 2M8LA 2J59M 2M5RA 4XROA 2GZJA 1AJYA 2KI7B 2JU2A 1N73B 3W68A 1GW3A 3H1ID 2FHSC 1JMMA 1VQNP 2QSIA 3CWBD 1LP1B 1YBKA 3B5NA 1URQD 1IFIA 1OW6A 3CCMP 2JYLA 1IFMA 2K9JA 2KK7A 1KC8Q 3H4EA 3RBZA 3TSIA 2GYKA 3E2DA 1FZAA 1JOCA 3D70A 2GDWA 2XDJA 2IFNA 2FFDA 3PTZA 2AEMA 1IFNA 2RKLA 4RKUJ 4ZKPA 4UB6H 2FADA 3H1JD 1J1EB 4HJGH 1E5WA 4CA3A 1LT9B 3V4WA 2ZXEB 1YJNP 5KAIE 3RK2C 4H2WC 1S9KE 3HD7D 1USDA 1SFCA 4PV1D 1SQPD 5CCHC
chains in the Genus database with same CATH topology
3CCSP 3CD6P 4XFYA 5F2KA 1YITP 2XXMA 3P05A 2EFJA 3G0VA 1YIJP 2Z44A 3CCJP 1VQ7P 2EG5A 4U0EA 3OW2O 2PEIA 2Z46A 3CPWO 3CC2P 4M0IA 2XV6A 2OARA 1M1KQ 3DTJA 3HYBA 1A8OA 1E6JP 1W2BO 5HGOA 1BAJA 4PH0A 3CCUP 4XFZA 3I55P 3DS2A 1VQ8P 3M1MA 1EOQA 3CC7P 2OTJP 1M90Q 5F2NA 1VQLP 1RO0A 5HGMA 3DS4A 3Q20A 2PEKA 1K73Q 1Q7YQ 1VQMP 1YI2P 1Q86Q 1AUMA 3DS5A 4PH1A 5HGLA 1YJ9P 3G1GA 1KD1Q 4IPYA 5BS1A 2PY8A 5F2OA 1JJ2O 3CMEP 2M8LA 3B5IA 1QVFO 4XROA 4XFXA 1VQ5P 1EIAA 2BUOA 3G6EP 3CXCO 1VQKP 2M8NA 1ZMBA 1M74A 2PEQA 4U0FA 3CCVP 2EIAA 1VQPP 1N8RQ 3VRLC 1A43A 3G71P 2QEXP 1VQNP 1IUQA 3G29A 3LRYA 3CCQP 2PEMA 3WBHA 5HGNA 2JO0A 3CC4P 4GR2A 1K8AQ 3DS3A 2BHVA 4U0DA 3DS1A 2PENA 1YHQP 2M8PA 3H0DA 2JYGA 5I4TG 1VQOP 4COPA 1K9MQ 1RO2A 3CCMP 3DS0A 4U0AA 2JYLA 2QA4P 2PEOA 1KC8Q 1NJIQ 5BS2A 3H4EA 5DCKA 3DPHA 1D1DA 2DGYA 1VQ6P 1K30A 1QRJA 1PEUA 2KODA 1S72P 3E2DA 3G28A 3NTEA 4COCA 2Z45A 3HZQA 4U0CA 3H47A 3I56P 2BQ1E 1QVGO 2LF4A 2XT1A 3G1IA 3CMAP 1VQ9P 4WYMA 3G21A 2E1MA 3MGEA 1VQ4P 2L6EA 3CCLP 4XRQA 3CCRP 1PEQA 3CCEP 2OTLP 1KQSO 2CWOA 3G26A 1M6NA 4U0BA 1PEMA 2P9XA 1RNIA 5JPAA 1YJNP 1PEOA 3G4SP 1YJWP 1M6EX 2PEJA 4GR6A 4QNBA 3RG6C 1Q82Q 1Q81Q 2ONTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS P;  1M90 Q;  1VQN P;  1VQL P;  3CD6 P;  2OTJ P;  3CCQ P;  1YIT P;  3CC4 P;  1YIJ P;  3I56 P;  1K73 Q;  1K8A Q;  1Q7Y Q;  1VQM P;  1QVG O;  1YI2 P;  3CCJ P;  3CMA P;  1Q86 Q;  1VQ7 P;  1VQ9 P;  3OW2 O;  1YHQ P;  1YJ9 P;  1VQ4 P;  3CPW O;  3CC2 P;  1VQO P;  1KD1 Q;  1VQ8 P;  3CCL P;  1K9M Q;  3CCR P;  1M1K Q;  3CCM P;  3CCE P;  1KQS O;  3CME P;  1JJ2 O;  2OTL P;  1QVF O;  1YJN P;  1W2B O;  3G4S P;  2QA4 P;  1KC8 Q;  1VQ5 P;  1YJW P;  3G6E P;  3CXC O;  3CCU P;  1NJI Q;  1VQK P;  3CCV P;  1VQP P;  1N8R Q;  1VQ6 P;  3I55 P;  3G71 P;  2QEX P;  1S72 P;  3CC7 P;  1Q82 Q;  1Q81 Q; 
#chains in the Genus database with same CATH topology
 5APX A;  1PGO A;  2EFJ A;  5BU8 B;  1SQV J;  3CCJ P;  2WQY C;  1KYO D;  3OW2 O;  2KGE A;  1FZB A;  1U7J A;  2IBZ I;  1KQF B;  1IZN B;  3SFD C;  1M1J B;  3H1K E;  1L4A B;  2YKO A;  4DCK A;  1R8E A;  2KIK A;  2HPC A;  1T8Z A;  1L0L G;  1LTT C;  1K73 Q;  2N50 A;  3RG2 A;  1N2D C;  1NTK K;  3OJA B;  5KJ7 D;  2B87 B;  3GZL A;  2O1J A;  1VF5 B;  3L75 J;  2PGD A;  5CCG D;  1JCD A;  2LOL A;  3CXC O;  2PEQ A;  1M74 A;  1AQT A;  2FQ1 A;  3G71 P;  4L76 A;  2N98 A;  3JSV C;  4D6T D;  2QJY B;  1IFD A;  1VPC A;  1RE4 C;  5HGN A;  1EZV D;  1YTZ I;  2CPS A;  2KGC A;  2R3C A;  1OIP A;  1VL2 A;  3E7K A;  2JYG A;  1GL2 C;  1JY3 O;  5APU A;  1NAF A;  3AE5 C;  2C9L Y;  5BS2 A;  2WSE H;  3RGU A;  2MF4 A;  1KB9 D;  2J58 A;  1HBW A;  1PGP A;  5AW0 B;  1L0N E;  2A06 E;  1VQ9 P;  1GU4 A;  4BPG A;  2JP3 A;  3KYQ A;  1NU1 K;  5KP7 B;  3HE4 A;  5KAF E;  1BE3 E;  1M6N A;  1RNI A;  1BXI A;  2LML A;  2P2U A;  2N6Y A;  3MIW A;  2ERH A;  2OYO A;  3M9H A;  4U3F E;  1KIL C;  2AFD A;  1YIJ P;  3AEF C;  2P1J A;  3H1L E;  2KXP B;  2KLU A;  5CZD B;  1VHN A;  1IFP A;  1L4A D;  4JPZ B;  1RE4 A;  2CPB A;  3L72 E;  3V5B A;  2BCC D;  1W2B O;  1HJB A;  3CCU P;  3P8C E;  1RF1 C;  2YKP A;  2N9B A;  2WPS A;  1VF5 D;  2K0D X;  4H2X C;  1IFJ A;  2NRG A;  2HOD B;  4IZ6 A;  1OVU A;  2OYH C;  2KUB A;  3PHL A;  3SWK A;  1HH0 A;  4WVZ A;  3L74 J;  1DNY A;  1GZL A;  2N1T B;  1JNM A;  2E76 C;  2M5A A;  2PP6 A;  2EIA A;  1N8R Q;  2PFX A;  1X3O A;  1OVR A;  1RE3 C;  1GU5 A;  4C7N A;  1XTG B;  2ZAE B;  4U0D A;  2GA1 A;  3P7K A;  5DJU B;  4F37 A;  3Q3D A;  2ZT9 C;  2O01 H;  4AQR D;  1KIL A;  1L0H A;  3M9Q A;  4KHX A;  3A7O A;  1VQ6 P;  1E0H A;  3WMM 0;  2KOD A;  2L22 A;  3CL3 D;  2QJK B;  3IAO A;  5KLV K;  2HFE D;  3PLN A;  3O8Z A;  1RF1 A;  2J5U A;  1ZR2 A;  2KOO A;  2D2C B;  3H1J J;  4GKG A;  1JMB A;  1NTZ D;  1BGY D;  1PEM A;  2PAJ A;  2HLO A;  4KJM A;  1BCC D;  2ROQ A;  3E1R A;  1FE6 A;  2O3J A;  1NTM D;  1SQP J;  2AEF A;  4OWF A;  4XFY A;  3P05 A;  3G0V A;  1SQX D;  1VQ7 P;  4N78 E;  3CX5 D;  1ZME C;  1RE3 A;  2K0Y A;  2DW3 A;  2H8P D;  2Q3I A;  2KZI A;  4PH0 A;  2E75 D;  2LL8 A;  2AXT H;  1SQQ E;  1R5S A;  3N4X A;  2ZXX A;  1M90 Q;  4Y99 B;  1URQ C;  3H32 A;  3B71 A;  2POH A;  1Y9B A;  4MN4 C;  2FXP A;  3L36 A;  3D6Y A;  2YXR B;  5AVW B;  2PY8 A;  5AW4 B;  1KQG B;  2M8R A;  3A0B E;  2XZ1 C;  4PD4 D;  4TT3 H;  2BUO A;  2KOG A;  1ZV8 A;  1FZC C;  1KYO H;  3VTP C;  3FXE A;  3AEE C;  1ZRT D;  3CCQ P;  3U1C A;  1FOS E;  2M5A B;  3WBH A;  2JJL A;  1Y8A A;  1L0N K;  1PPJ G;  2NPS B;  3B4Q A;  5L8R J;  1PP9 D;  3LW5 J;  2C9N Y;  1LTJ C;  1SQB G;  4H44 C;  2OTK E;  1VKU A;  3TGU E;  1NOH A;  3WUT A;  3JCU H;  2Z5H A;  3CLQ A;  4OVN F;  1N7S B;  3L73 E;  3G28 A;  2D2C D;  1YQ3 C;  2AVA A;  4XA4 A;  3RK3 B;  2EHS A;  2K3R A;  1L2P A;  3BVH A;  1HWT C;  1URQ A;  4W7Z A;  1TU3 F;  1AVY A;  3TNU B;  1CEI A;  2FYU G;  1IMQ A;  3NY7 B;  1MZ8 A;  1CSB A;  2A45 G;  2H88 C;  1LWU B;  2KNC B;  1Q81 Q;  2ONT A;  2K1A A;  3GHG B;  1FJK A;  2VLP A;  3SWY A;  3OA7 A;  1N73 C;  3RL0 B;  2CGQ A;  1FZC A;  4DOJ A;  2LTE A;  2K37 A;  5AW2 B;  1EC5 A;  2X2B A;  2OAR A;  1FZG A;  1OVV A;  1GTW A;  1KB9 H;  3EFG A;  5KP6 B;  1HJ0 A;  1U57 A;  5HGO A;  2GUV A;  4OGQ D;  2XZR A;  3F5H A;  1LTJ A;  3L70 G;  3CXH I;  1MUU A;  2V4H A;  4GDO A;  1H0T A;  1S5L X;  1MV8 A;  3BCC D;  3L71 D;  3DS5 A;  4W80 A;  5HGL A;  2LXB A;  5TIS E;  2MR8 A;  1JTH B;  2E74 D;  4R4M A;  3H1H E;  3B5I A;  2MY5 A;  2Q1K A;  1J1E C;  1T6A A;  1VQP P;  4IFM A;  3G29 A;  1L0L K;  1JY2 N;  5KKZ B;  2KSJ A;  1NU1 D;  2E5Y A;  2AXC A;  3AEC C;  4TLF A;  4DJG A;  1N73 A;  5CCG A;  2LR2 A;  3NTN A;  3DPH A;  1Z6M A;  1FZF A;  1FZE A;  1PEU A;  1LP1 A;  1S72 P;  3GZM A;  2RN0 A;  1WT6 A;  4H13 D;  1JB0 J;  1NTK E;  4WYM A;  5AVU B;  3USS A;  2K94 A;  2KGD A;  1NTZ J;  2W27 A;  1BGY J;  5B5E H;  4U0B A;  1RF0 C;  2JDI H;  3BRV B;  5AVR B;  2PNG A;  1BCC J;  4BRY B;  3UIA A;  2M3E A;  3RL0 D;  1VF5 C;  1EMV A;  5E79 E;  2MVU A;  1OR5 A;  3CD6 P;  1SQQ K;  1FC2 C;  2K5X A;  1F80 D;  1CZQ A;  1LTI C;  1HY8 A;  3NXS A;  3KQG A;  5GTH H;  4I7Z B;  2QJY C;  3CPW O;  1LT9 A;  1EDJ A;  2P58 A;  3MGN A;  2K88 A;  1OW8 A;  3HYB A;  2CNR A;  3H1I G;  1FR2 A;  5HVC A;  1SLQ A;  3GMA A;  1K05 A;  1NYH A;  2ZYG A;  2OTJ P;  3CWB G;  2GZI A;  2PEK A;  3A2A A;  3AE2 C;  1SQV E;  2GM4 A;  3V2R A;  5AW3 B;  3HD7 B;  1M1J A;  4PV1 B;  1H89 A;  1KFN A;  3OAK A;  1L4A A;  1P84 E;  2H7H A;  2WIT A;  3KHU A;  4PXH B;  2FAE A;  2M8N A;  5CMZ A;  1S9K D;  5KLV D;  3CX5 H;  2FXO A;  2NZ2 A;  2PEM A;  3CC4 P;  2B87 A;  5H2F E;  3Q5S A;  2RMZ A;  3H1J G;  2M8P A;  1KIL E;  1VQO P;  1QGK B;  3L75 E;  2W83 C;  1SFC C;  3H1K D;  5B66 E;  1SQP G;  2DNW A;  2W90 A;  3T97 B;  5BVZ A;  2Z45 A;  2YO2 A;  4L75 A;  2C0X A;  1JM0 A;  4PD4 H;  2KR5 A;  2P10 A;  3B8E B;  1LTG C;  3G26 A;  5JPA A;  5APQ A;  5APS A;  3G3Z A;  1G1I A;  1FDM A;  2GZG A;  1Q2N A;  3A0H E;  1PV3 A;  2N1T C;  1YIT P;  2P67 A;  3RL0 g;  3GF3 A;  2QJP B;  2BAS A;  1OW7 A;  4IFF A;  1BDD A;  1SQB J;  1PZQ A;  1FS0 E;  3MHV A;  2IBZ E;  4D6T G;  3AED C;  3U59 A;  2VSQ A;  3M1M A;  3PJS K;  5F2N A;  1EZV G;  4HH2 A;  1L0N D;  2A06 D;  3V4Q A;  4JQ0 D;  4AYC A;  3WU2 E;  4IL6 H;  4M3L A;  2YXQ B;  1BE3 D;  1JJ2 O;  3FWL A;  1JY3 N;  1QVF O;  2FYU J;  1UII A;  2JKV A;  4I1L A;  2MKV A;  2HOD A;  1G1J A;  4U3F D;  1PFI A;  3H1L D;  1N7L A;  2WSE J;  1WMK A;  2RH0 A;  5AVT B;  5DJT B;  2N1T A;  1M7L A;  1SVF A;  3L72 D;  3L74 E;  3U43 A;  3U1A A;  4U0A A;  3ZDM A;  3V2N A;  3AE4 C;  1NJI Q;  3P8C D;  5KP8 B;  1NO4 A;  3TDK A;  1NKN A;  4RJT A;  5APY A;  3L70 J;  1QVG O;  4XFJ A;  2XT1 A;  1FBM A;  4Y99 C;  4LC1 A;  1S5L E;  2HYN A;  3CCR P;  2BCC G;  5HV8 A;  4GOD A;  4Z1M H;  2A45 H;  3GLM A;  2GDY A;  2B9B A;  4PJ0 H;  5AW5 B;  4ZMD A;  1KTM A;  4XE5 B;  1SP4 A;  2FAC A;  3VP8 A;  1SQV K;  1KQL A;  1H8A A;  3KZI H;  2Y9Y A;  1WRG A;  3A5T A;  4C7R A;  3I5C A;  2WPV B;  2VRS A;  2NPS C;  3KXD A;  3LIE A;  1AVO A;  4BPH A;  1G2C B;  2K93 A;  1HUC A;  3S1K A;  4NPE A;  1HGZ A;  1GK4 A;  1Q7Y Q;  1YI2 P;  1Q86 Q;  1AUM A;  1EDK A;  2E42 A;  1ZXG A;  1KFM A;  1N7S C;  1T8K A;  4ASW A;  1QEX A;  4DT0 A;  3RK3 C;  3HE5 B;  2VLN A;  2OYI B;  2YMY A;  2K2Q A;  5APV A;  4PWV B;  5KLV J;  3Q1M A;  2O01 J;  1LWU C;  1Q90 D;  3FX0 A;  2E75 B;  4N78 D;  1NTZ G;  1PIX A;  3D6Z A;  1NVO A;  4N3Y B;  3GHG C;  1BGY G;  1BCC G;  4WY4 D;  3H1K J;  1RHZ B;  2XU6 A;  1NTM G;  3EQ2 A;  1K30 A;  2I1J A;  3H1I J;  4WBA A;  1J1D B;  3O6Q B;  2M0B A;  3AEA C;  1SQX G;  2NPS A;  3CWB J;  1BSN A;  2E1M A;  1VQ4 P;  4JBZ A;  5KAI H;  3CCL P;  3GF7 A;  1X8Y A;  2XZ0 D;  5K5G B;  3AE1 C;  1N7S A;  3QWO C;  1KB9 E;  1Q82 Q;  3B5N D;  4UB8 E;  2FBW C;  2W6B A;  2KG8 A;  1L0L E;  2HG5 D;  2LKI A;  4BPF A;  3TNU A;  2YMK A;  1XTC C;  1U7M A;  3DTJ A;  4ZKU A;  1LWU A;  5KKZ C;  1KB9 I;  3EWK A;  2KNC A;  1T2K C;  3TGU D;  2K9Y A;  3GHG A;  4XFZ A;  3L73 D;  1JO5 A;  2N9Y B;  1RO0 A;  1AV1 A;  2Q5U A;  3MP7 B;  3CI9 A;  4H0L D;  1MKM A;  3PP5 A;  1PP9 G;  2ZYD A;  5BS1 A;  1EDL A;  3CME P;  1K04 A;  1OZH A;  3GG2 A;  4AUW A;  3IF4 A;  2W6A A;  3GKL C;  1J2J B;  2QEX P;  2I1K A;  4GR2 A;  3VYI A;  2L9F A;  1JTH A;  4OGQ B;  1S4X A;  4W7Y A;  2L4B A;  2PEN A;  2FY8 A;  1K9M Q;  2VLQ A;  1E79 H;  1AFO A;  1HVV A;  1QL1 A;  4I7Z C;  2WTY A;  3SWF A;  2FQ2 A;  1QRJ A;  2L91 A;  1PGQ A;  2E74 B;  1GL2 B;  1NWQ A;  1FDO A;  4D6T J;  5M1B A;  4LGD E;  5CJ0 A;  3H47 A;  4B86 A;  5KAF H;  3R4Y A;  3MGE A;  2KP8 A;  1W2E A;  1PEQ A;  3MTU E;  3H1H D;  1RH5 B;  3HD7 C;  1USE A;  4PV1 C;  1ZLL A;  5AW1 B;  2KLV A;  3RK2 D;  1SQP K;  3HTK B;  1GXH A;  2IYO A;  3BCC G;  2XXM A;  2N5I A;  3L71 G;  5CCH D;  3P8M C;  3Q5R A;  2UWJ E;  2JQ4 A;  2QM8 A;  4GOF A;  2Z46 A;  3QH9 A;  2WMM A;  4BRY A;  4RES B;  4H13 B;  2R5D A;  1HGV A;  1Z56 A;  3H6P A;  2LIU A;  1NU1 G;  2LKM A;  1VQM P;  5KJ7 C;  1NTK D;  1KV4 A;  3CX5 E;  3CXH E;  5CCG C;  2E5T A;  2VLO A;  3HUS B;  4YTP C;  2XKM A;  2BCC J;  1EIA A;  3LMO A;  3WUU A;  3CCV P;  1IO4 A;  2NO8 A;  1NKZ B;  1X79 B;  3CX5 I;  4YXD C;  3HD7 A;  3DS3 A;  3EFF K;  5EW5 E;  1BDC A;  2N6Z A;  1IJD B;  3VMY A;  1GL2 D;  1FDI A;  3M0A A;  4EI2 A;  4QMA A;  2FKW B;  2QJP C;  2O1K A;  2WSF J;  1LT9 C;  1M8O B;  2ZT9 B;  1MFT A;  1N86 A;  1SQV D;  1HQB A;  3M0D A;  2IZ1 A;  4PD4 I;  2KS1 B;  1P84 D;  2JWA A;  5KJ7 A;  1PEO A;  1OMI A;  3T97 A;  1YJW P;  4UB6 E;  2I8D A;  3RG6 C;  3CE7 A;  1M1J C;  2BEZ F;  1T3U A;  1IK9 A;  1L4A C;  1KIL D;  2KSE A;  2WPQ A;  2PRR A;  2JBG A;  1KZU B;  3L75 D;  1EQ7 A;  2WSF H;  1A8O A;  1E6J P;  2WT7 B;  2JAZ A;  3TGU J;  5KLV G;  3I55 P;  1NTM J;  1ZNV A;  2MD9 A;  2Y0D A;  1MFZ A;  1SQX J;  3A0B H;  1R5L A;  2KGA A;  1PPJ E;  3H1K G;  2B88 A;  2ITA A;  1SQB E;  2FQ0 A;  2Y0E A;  2LPK A;  3VRL C;  2E76 D;  3C9I A;  2R32 A;  1JY2 O;  4K35 A;  2K92 A;  1ZR4 A;  1ZP0 C;  2R3S A;  4MRT C;  1EXJ A;  3L35 A;  1M56 D;  2FVE A;  4N6J A;  2ZT9 D;  1LT1 A;  2FYU E;  2KOQ A;  5EJD A;  3C1L A;  2IBZ D;  2DGY A;  2OQQ A;  3V6I A;  2M3B A;  2ZJS E;  4R0M A;  3HZQ A;  4U0C A;  1D7M A;  1X9V A;  3AE7 C;  3G21 A;  1KOR A;  2JU1 A;  1LGH B;  1QLE D;  5AVZ B;  1PP9 J;  3R2P A;  1IK7 A;  2OTL P;  2O01 N;  2A45 I;  2E43 A;  2C0W A;  2AF8 A;  2ZFC A;  3RK3 E;  3K5B A;  3M9B A;  3CC7 P;  1L0N G;  3Q2Y A;  3CCS P;  2A06 G;  3IR9 A;  3L70 E;  1M57 D;  2IZ0 A;  3S4R A;  2G8Y A;  1QX8 A;  3CC2 P;  1BE3 G;  4A7P A;  1DEE G;  1IC2 A;  2CG5 B;  3L74 D;  5CHX A;  1NQ4 A;  3NFQ A;  2E75 C;  3WUV A;  1EOQ A;  4U3F G;  3AE6 C;  1VQL P;  3H1L G;  5TIS H;  5HGM A;  2OGU A;  2W8Z A;  1NTK J;  2KOR A;  1H88 A;  4PH1 A;  1J1D C;  3L72 G;  4HB1 A;  3NMD A;  4IPY A;  2QG4 A;  2EHT A;  4GOE A;  1NHL A;  2FVF A;  2YO3 A;  4EOT A;  1G2C A;  3G6E P;  2GDX A;  3KPE A;  1IUQ A;  1OWA A;  1GK6 A;  3V2Q A;  4QKO A;  2JO1 A;  1L0I A;  2JO0 A;  2P7J A;  1GPJ A;  3BCC J;  2MR7 A;  1YHQ P;  3L71 J;  3HE5 A;  2QJK C;  1LTS C;  2OYI A;  3N7N A;  3VN0 A;  2YIU B;  3FWN A;  3BAT A;  3DS0 A;  2KOS A;  2QVA A;  3JC2 2;  4GIF A;  2D2C C;  4H44 D;  2WPT A;  2H89 C;  1A02 F;  1UIX A;  4O9B A;  2CQ8 A;  3I56 P;  5AVV B;  2B89 A;  2LF4 A;  3GW6 A;  4NPD A;  3SFE C;  1ZN5 A;  1DD3 A;  4R4L A;  1NU1 J;  1FAV A;  3AE8 C;  2G3A A;  5E79 H;  4ZNC A;  1ACP A;  3O6Q A;  1FU1 A;  3MUD C;  4GR6 A;  3H1I E;  1HTL C;  4WY4 B;  5CBO A;  2IDB A;  3CWB E;  1CI6 A;  2FYZ A;  4IFD K;  1EDI A;  3RBX A;  3ABV C;  1X0T A;  4NEO A;  5AW9 B;  4OGQ C;  3AEG C;  1YQ4 C;  1BAJ A;  3PRJ A;  1SQB K;  1GXG A;  1LTB C;  3Q20 A;  5GTI H;  1IMP A;  1JY2 P;  5AVS B;  1P84 H;  1JUN A;  2GZF A;  1RQU A;  2AXT E;  2GZE A;  2E74 C;  2V7Q J;  4L74 A;  5CCH A;  3G1G A;  3B5N B;  3H1J E;  2Q7C A;  5APW A;  2AFE A;  4BXL A;  2QRX A;  4JF7 A;  1VQ5 P;  1VQK P;  1SQQ G;  5H2F H;  1ZMB A;  2FYU K;  2KW2 A;  2K9J B;  2FYN B;  1S3J A;  1SQP E;  1X22 A;  1LTA C;  2YKQ A;  2IX7 C;  1L0L D;  1GW4 A;  1K8A Q;  2BHV A;  5KLI B;  1KYO E;  3MUD A;  2FFD B;  3H0D A;  2WSS H;  2WVR A;  1GMJ A;  5B66 H;  5I4T G;  4COP A;  5AW6 B;  4H0L B;  1LJ2 A;  3IFM A;  2QE7 H;  2V7Q H;  4H13 C;  1KYO I;  1DIP A;  1LNQ A;  2H43 A;  1SFC B;  2BQ1 E;  3JCU E;  3G1I A;  2ZVO B;  4IL6 X;  3A0H H;  3TGU G;  3RL0 C;  2FXM A;  1PL5 A;  1GL2 A;  1Y47 A;  3D71 A;  3HUS C;  3L73 G;  4NPF X;  3SSU A;  1SQQ D;  4D6T E;  1MZ9 A;  2HPC B;  1EZV E;  2QM7 A;  2PEI A;  3L4F A;  2Q3E A;  3M06 A;  1CI6 B;  2Q9I A;  2N5H A;  2FVA A;  4CPG A;  1RY3 A;  1DEB A;  3ITK A;  1EZV I;  3HTK A;  1ZW0 A;  3WU2 H;  5CBN A;  4JYC A;  4L73 A;  2R5B A;  2Q6Q A;  1AF8 A;  5AW8 B;  1DD4 A;  4EIJ A;  2HR3 A;  1KD1 Q;  1FOS F;  3RK2 B;  1NGM B;  2JGP A;  3H25 A;  3TF5 A;  1PGJ A;  4U0F A;  3KDP B;  1S1C X;  1DH3 A;  3VMX A;  1L0N J;  3HUS A;  2LXC B;  4ASV A;  1HF9 A;  4I2L C;  3H1H G;  2WPR A;  4GT1 A;  1GD2 E;  1BE3 J;  1A02 J;  2BCC E;  2OYH A;  2PEO A;  3HE4 B;  1SFC D;  1AQ5 A;  1KMI Z;  3V2P A;  4U7J A;  3VOP A;  1S5L H;  1GDT A;  4COC A;  4U3F J;  3CMA P;  3H1L J;  3G9R A;  3CXH D;  4K3A A;  2L6E A;  3MD0 A;  3CCE P;  3L72 J;  3VMA A;  1UNK A;  2R44 A;  3L37 A;  2KZJ A;  1EXI A;  2WSC J;  3MZW B;  1AYI A;  1NAY A;  4BWN A;  5CJ4 A;  5B5E E;  5KTB A;  1NTK G;  2JEE A;  2KWL A;  2QIW A;  2N1T D;  5EFW B;  2Z44 A;  2KS1 A;  2EG5 A;  1OXZ A;  3GJN A;  4M0I A;  2XV6 A;  1JY3 P;  1M1K Q;  3BRT B;  5GTH E;  3BAS A;  1DX7 A;  1KN7 A;  4YXW H;  5AVQ B;  3DS4 A;  2XNX A;  4EDF A;  4HYT B;  5APT A;  3AE9 C;  4C7N B;  1NTZ E;  2WSC H;  2WT7 A;  2ZYA A;  1BGY E;  5KLV E;  1BCC E;  4XFX A;  4H2Y C;  1KIL B;  1W5C E;  5BU5 A;  1NTM E;  3M0D C;  3LRY A;  1UJZ A;  1SQV G;  1L0L J;  1SQX E;  4LLH A;  1OFC X;  3DS1 A;  3Q5P A;  1RF1 B;  2JR8 A;  4WWI A;  1BSH A;  1D1D A;  1NH4 A;  2OYH B;  2L5G B;  2YNY A;  3LW5 H;  4HKZ H;  4JYB A;  4RO0 A;  3L75 G;  2KYV A;  2E76 B;  1PPJ D;  2Y0C A;  4IOI H;  2Z5I A;  4UHP B;  2P9X A;  4UB8 H;  1SQB D;  3G4S P;  3VMZ A;  4PD4 E;  1M6E X;  2PEJ A;  5AVX B;  4QNB A;  1SQQ J;  1ZRT E;  2XV5 A;  3C8V A;  3II6 A;  3AEB C;  4U0E A;  3H32 B;  1PP9 E;  2JWD A;  2LIW A;  3M91 A;  2IFM A;  2FYU D;  3FGA D;  3F89 A;  2YIU C;  2NPS D;  1VQ8 P;  3VP9 A;  4KT0 J;  2IPP A;  5AW7 B;  3P32 A;  3A3Y B;  3FXD A;  1YYC A;  1QL2 A;  2W6J H;  3TYY A;  2ZVN B;  3IN6 A;  1N7S D;  5F2O A;  1S2E A;  3TK1 A;  5C39 A;  2IBZ G;  1SS1 A;  4IL6 E;  4OH8 B;  2MVV A;  3RK3 D;  7CEI A;  1A43 A;  2KG6 A;  1JEK A;  3L73 J;  3L70 D;  2QNW A;  4Y28 J;  4WY4 C;  4DZO A;  1RO2 A;  1OX3 A;  5TJH A;  2JB0 A;  1DV5 A;  2QA4 P;  1URQ B;  1KLP A;  3AE3 C;  3S9O A;  5DCK A;  2BEQ D;  2XND H;  3B4S A;  3NTE A;  2CK3 H;  1YTZ T;  1CW5 A;  2MJZ A;  1VDF A;  3W67 A;  3BCC E;  3L71 E;  4YPC A;  3L74 G;  1AA0 A;  2KB7 P;  4C46 A;  3EJD A;  4XRQ A;  1FZC B;  1KQS O;  2CWO A;  2Y9Z A;  1JCC A;  4WB4 A;  4EYY Q;  3B5N C;  3E1I A;  3HRN A;  4I6M C;  5F2K A;  2IYP A;  1LTJ B;  5AVY B;  4H44 B;  2FYN C;  4PJ0 E;  3PH0 A;  2L0Q A;  1NU1 E;  1H0T B;  5GTI E;  4HKG A;  1NTZ K;  2GUS A;  2AEJ A;  5KLI C;  3H1H J;  2FFD C;  2KOP A;  1RQV A;  1T3J A;  3KZI E;  1T2K D;  4WY4 A;  3EJB A;  3DS2 A;  2SPZ A;  1ZOY C;  3CXH H;  4H0L C;  2KG9 A;  1RF0 A;  3EJE A;  1NTM K;  2OYI C;  2K0X A;  1P84 I;  1FJP A;  4DG9 A;  1YJ9 P;  1SQX K;  2WZ7 A;  3LID A;  2WWW A;  2Z4E A;  2M8L A;  2J59 M;  2M5R A;  4XRO A;  2GZJ A;  1AJY A;  2KI7 B;  2JU2 A;  1N73 B;  3W68 A;  1GW3 A;  3H1I D;  2FHS C;  1JMM A;  1VQN P;  2QSI A;  3CWB D;  1LP1 B;  1YBK A;  3B5N A;  1URQ D;  1IFI A;  1OW6 A;  3CCM P;  2JYL A;  1IFM A;  2K9J A;  2KK7 A;  1KC8 Q;  3H4E A;  3RBZ A;  3TSI A;  2GYK A;  3E2D A;  1FZA A;  1JOC A;  3D70 A;  2GDW A;  2XDJ A;  2IFN A;  2FFD A;  3PTZ A;  2AEM A;  1IFN A;  2RKL A;  4RKU J;  4ZKP A;  4UB6 H;  2FAD A;  3H1J D;  1J1E B;  4HJG H;  1E5W A;  4CA3 A;  1LT9 B;  3V4W A;  2ZXE B;  1YJN P;  5KAI E;  3RK2 C;  4H2W C;  1S9K E;  3HD7 D;  1USD A;  1SFC A;  4PV1 D;  1SQP D;  5CCH C; 
#chains in the Genus database with same CATH homology
 3CCS P;  3CD6 P;  4XFY A;  5F2K A;  1YIT P;  2XXM A;  3P05 A;  2EFJ A;  3G0V A;  1YIJ P;  2Z44 A;  3CCJ P;  1VQ7 P;  2EG5 A;  4U0E A;  3OW2 O;  2PEI A;  2Z46 A;  3CPW O;  3CC2 P;  4M0I A;  2XV6 A;  2OAR A;  1M1K Q;  3DTJ A;  3HYB A;  1A8O A;  1E6J P;  1W2B O;  5HGO A;  1BAJ A;  4PH0 A;  3CCU P;  4XFZ A;  3I55 P;  3DS2 A;  1VQ8 P;  3M1M A;  1EOQ A;  3CC7 P;  2OTJ P;  1M90 Q;  5F2N A;  1VQL P;  1RO0 A;  5HGM A;  3DS4 A;  3Q20 A;  2PEK A;  1K73 Q;  1Q7Y Q;  1VQM P;  1YI2 P;  1Q86 Q;  1AUM A;  3DS5 A;  4PH1 A;  5HGL A;  1YJ9 P;  3G1G A;  1KD1 Q;  4IPY A;  5BS1 A;  2PY8 A;  5F2O A;  1JJ2 O;  3CME P;  2M8L A;  3B5I A;  1QVF O;  4XRO A;  4XFX A;  1VQ5 P;  1EIA A;  2BUO A;  3G6E P;  3CXC O;  1VQK P;  2M8N A;  1ZMB A;  1M74 A;  2PEQ A;  4U0F A;  3CCV P;  2EIA A;  1VQP P;  1N8R Q;  3VRL C;  1A43 A;  3G71 P;  2QEX P;  1VQN P;  1IUQ A;  3G29 A;  3LRY A;  3CCQ P;  2PEM A;  3WBH A;  5HGN A;  2JO0 A;  3CC4 P;  4GR2 A;  1K8A Q;  3DS3 A;  2BHV A;  4U0D A;  3DS1 A;  2PEN A;  1YHQ P;  2M8P A;  3H0D A;  2JYG A;  5I4T G;  1VQO P;  4COP A;  1K9M Q;  1RO2 A;  3CCM P;  3DS0 A;  4U0A A;  2JYL A;  2QA4 P;  2PEO A;  1KC8 Q;  1NJI Q;  5BS2 A;  3H4E A;  5DCK A;  3DPH A;  1D1D A;  2DGY A;  1VQ6 P;  1K30 A;  1QRJ A;  1PEU A;  2KOD A;  1S72 P;  3E2D A;  3G28 A;  3NTE A;  4COC A;  2Z45 A;  3HZQ A;  4U0C A;  3H47 A;  3I56 P;  2BQ1 E;  1QVG O;  2LF4 A;  2XT1 A;  3G1I A;  3CMA P;  1VQ9 P;  4WYM A;  3G21 A;  2E1M A;  3MGE A;  1VQ4 P;  2L6E A;  3CCL P;  4XRQ A;  3CCR P;  1PEQ A;  3CCE P;  2OTL P;  1KQS O;  2CWO A;  3G26 A;  1M6N A;  4U0B A;  1PEM A;  2P9X A;  1RNI A;  5JPA A;  1YJN P;  1PEO A;  3G4S P;  1YJW P;  1M6E X;  2PEJ A;  4GR6 A;  4QNB A;  3RG6 C;  1Q82 Q;  1Q81 Q;  2ONT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...