1VQ9P

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 53
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq9P02
1VQ6P 3CCVP 1VQ4P 1W2BO 1VQLP 1VQ9P 1VQ8P 1YI2P 1YJ9P 3CCQP 1VQNP 3CMAP 1YIJP 3CCLP 1Q7YQ 1K73Q 1VQ5P 3OW2O 3CD6P 3CPWO 3CC4P 1QVFO 1KD1Q 1YITP 1KC8Q 1M90Q 1Q86Q 3G71P 3CCUP 2OTLP 3CC2P 1NJIQ 1YHQP 3G4SP 1VQOP 1YJWP 3CCEP 3CC7P 3I56P 1YJNP 1Q82Q 2QA4P 1M1KQ 1Q81Q 1S72P 3CCRP 3G6EP 3CXCO 1QVGO 1K9MQ 1JJ2O 1VQMP 3CCMP 3CCSP 1KQSO 3CCJP 2OTJP 1N8RQ 1VQKP 1VQ7P 3CMEP 1VQPP 1K8AQ 2QEXP 3I55P
chains in the Genus database with same CATH superfamily
3CLQA 2KI7B 3G21A 2BCCD 3AE8C 1GL2B 3EJDA 4L76A 2NPSD 3LRYA 2GM4A 1Y9BA 2N5IA 2OYIB 1KYOI 2BQ1E 1JY3N 1N7SD 2KG6A 3SWKA 2JGPA 2AFEA 2BCCG 2NRGA 2N1TD 2WWWA 1SLQA 1VF5B 5EFWB 4IFDK 4PD4D 2XV5A 1JEKA 5HGNA 3HD7D 1NTMD 4OWFA 1RF0C 2W8ZA 1VQ7P 3IN6A 2K94A 3AEBC 3Q5PA 1UIIA 2K88A 1EDLA 1NTKD 1A8OA 3CCQP 1N7SA 3JCUH 1HTLC 2WMMA 3B5NC 4DT0A 1KILA 1T6AA 1P84E 2N5HA 4BPHA 5AW9B 2GZEA 2LKMA 2M0BA 4K3AA 2B87A 1UJZA 4HKGA 1NYHA 2YO2A 1LGHB 1YI2P 2HPCA 1AV1A 1FOSF 4IOIH 2W6JH 1X0TA 1M1JA 3EJEA 1FJKA 4PD4E 3PHLA 4H44D 2K9YA 2L4BA 1BAJA 2C9LY 2K9JB 5KLVD 2OTJP 1OW7A 1NTZD 1OMIA 3HUSB 2P9XA 3JSVC 5KTBA 5CCHC 2KNCA 3CXHI 5CBOA 2FYUE 1SQQK 4QNBA 2PEIA 4U0EA 2RKLA 4ZKUA 5AVRB 3BRVB 1MKMA 1S1CX 1WT6A 1FR2A 3H1JD 1LTSC 2WVRA 3RK2D 2E43A 2KUBA 3DS5A 1M8OB 1WRGA 2N1TC 1Z56A 1ZRTE 5CJ0A 3Q5SA 1BCCG 3S4RA 1CZQA 3MD0A 2IDBA 1QLED 3WMM0 5B66H 2A06D 5AW6B 5KJ7C 2IX7C 2W6AA 3HUSA 1NTMG 5KLVJ 1BE3G 1DNYA 2O1JA 3GHGA 5CHXA 2FBWC 4UB8E 3TDKA 1N7SB 2G3AA 2W83C 1RF1B 3GZMA 3MP7B 1BE3J 4TLFA 1NU1K 1NU1G 1LTJA 4LGDE 3I5CA 2AXTH 2O3JA 3CWBD 1IMQA 2L22A 4DJGA 3Q1MA 1VF5C 5HGMA 2E1MA 4RJTA 2FACA 4IFFA 1KTMA 3MTUE 1GDTA 3L73E 2WPSA 3U43A 2N6YA 1GL2A 1OXZA 2FVAA 1AUMA 2YKQA 4JBZA 1AQTA 5F2NA 4YTPC 2XZRA 2Z44A 3RL0D 1KB9H 5APVA 2KS1A 2IBZI 1N7SC 1J2JB 2IBZD 3CWBE 5KLVG 3VMZA 3H1HD 1AF8A 2GZIA 1DEBA 2EG5A 4N6JA 1M6EX 5KJ7D 2LIWA 1LNQA 2AEMA 1M90Q 2WPRA 3M9HA 2JQ4A 1ACPA 1M1KQ 5H2FH 1R5LA 1LP1A 4H2XC 3WUUA 1ZOYC 1SQXG 1SQXK 2FHSC 1ZW0A 1VQPP 1X9VA 1GU5A 2JEEA 2E74C 4N78E 3H1LG 2OQQA 4K35A 1JTHA 1URQA 2M8LA 3HUSC 4BWNA 1DIPA 1ZMEC 1OR5A 2L91A 4TT3H 1HJBA 2NPSB 3V4WA 2QJKC 3V2RA 1MFTA 4H13D 5L8RJ 3O6QB 4WB4A 3MUDA 2POHA 1AFOA 1N73A 2YKOA 2GA1A 3TGUD 3HE4A 3TF5A 1LP1B 3SFDC 3CCRP 1R5SA 2AVAA 1Y47A 3LW5J 3RL0B 1FZAA 2AFDA 1LTGC 2YNYA 1KMIZ 2ZVNB 3H1IJ 3DS0A 1KYOH 5KLVE 1BGYD 3OAKA 3H1JJ 2KSJA 4W80A 3H32A 3C8VA 2D2CD 2Y0DA 3RGUA 2QIWA 3RG2A 2IZ1A 4JYBA 3L73D 3KZIH 2M3BA 2VRSA 4W7ZA 1VF5D 1PL5A 5APYA 1FDMA 3ITKA 3M0DC 2QE7H 1L2PA 3AEDC 4BPFA 1S5LE 5CZDB 2JU2A 4LLHA 1SS1A 3AE1C 1KQGB 1VQMP 3L74G 1QL2A 1N86A 2ZJSE 4Y99B 3L4FA 1NU1E 1M1JB 1UIXA 1T2KD 2FQ1A 1NH4A 2GDWA 3A3YB 4ASWA 1IFMA 5C39A 4IZ6A 2XDJA 1KC8Q 5AW7B 2QJPC 2YXQB 1G2CB 1BE3D 1IFDA 2FYUK 2KG9A 3P05A 3BRTB 2LXBA 3L74J 4M0IA 2LOLA 2LIUA 5KLIB 1SQBD 2CGQA 1TU3F 2ZYDA 5KAIH 3K5BA 2VLNA 1UNKA 1JY2P 3MHVA 3IFMA 2Q7CA 1KQLA 3NFQA 5BU8B 2FKWB 3G9RA 1FDOA 2H8PD 3VP8A 3L75J 3L70D 2PRRA 2G8YA 3A0BH 1J1EC 2C0XA 5EJDA 1DD4A 2MKVA 3L37A 1SQVK 2LL8A 3FWNA 4XRQA 3DTJA 3W68A 1OZHA 1SQQJ 3L71G 3Q20A 2KOQA 2Y0CA 1PP9G 4UB6E 3H1HJ 4EIJA 1IFNA 4D6TE 1Q81Q 2DGYA 1Y8AA 3GMAA 1IFPA 3M06A 3RBZA 1KYOE 3G29A 1IMPA 1K8AQ 2D2CB 5M1BA 5KLIC 2FADA 1NTZE 3RBXA 2N9YB 2HLOA 1M57D 5GTIE 2Z45A 2WITA 1BDDA 1IO4A 3MIWA 1YQ4C 1CEIA 3H1KG 3QWOC 5AVUB 2M3EA 3W67A 2E42A 1XTCC 1GD2E 3MZWB 1IUQA 1NU1D 1L0NJ 2A06E 2LTEA 2KGCA 5BVZA 3R2PA 3Q3DA 2FVFA 1NOHA 5F2KA 4JPZB 1JM0A 1MZ8A 1VHNA 1K05A 3II6A 4H2WC 1VKUA 1WMKA 4XFXA 5DJUB 4F37A 5KJ7A 1L0LD 3AE6C 2E74B 1G2CA 1SQQG 1L4AA 3L71J 3EFGA 1GTWA 3DS4A 2W6BA 1EZVG 2E5YA 5CBNA 3M91A 2XZ0D 3CCUP 1NJIQ 1S3JA 1OWAA 3H4EA 5APUA 1S72P 1OW6A 4H2YC 4L75A 1BGYE 1G1JA 3IAOA 1BGYJ 2MVVA 1RE3A 1FOSE 1JB0J 1LWUA 3E1RA 3GKLC 5KP7B 3M9BA 2QJPB 2ONTA 1BXIA 2FYNC 4EDFA 1N73B 2V7QJ 2C9NY 1Q82Q 1J1DC 2N6ZA 3LW5H 2Q5UA 1CI6A 4XFJA 3U1CA 1FAVA 2KZIA 1MUUA 2R32A 3TSIA 5TJHA 1NTMJ 1SQVD 4H0LD 2KXPB 4U3FG 3BASA 3G71P 3USSA 1KORA 3DPHA 1RO0A 1FE6A 2OYIC 2XNDH 1AVOA 1PP9E 1PV3A 2K3RA 3FWLA 4CA3A 3L75E 1VQ8P 1LWUB 2YXRB 3KPEA 1SQBE 1PFIA 2XZ1C 1KD1Q 4U3FE 3FXDA 2KP8A 1SQQE 2LF4A 3VN0A 1R8EA 1ZNVA 3RK3E 3A2AA 1KILD 2FXOA 1VQ9P 3PLNA 1X3OA 1ZN5A 1SQBK 3L75D 1FZGA 2EFJA 1RQVA 4EI2A 1YJWP 1NTMK 3B4QA 3T97B 1LTJC 3CX5D 3G26A 1SQVE 1MV8A 1NKZB 7CEIA 1AJYA 3PP5A 2SPZA 1MFZA 5CCHA 4ZMDA 4MN4C 1NQ4A 3H1HG 3L74D 3H1KE 2JAZA 4XE5B 4IL6X 4IPYA 1A02F 1EQ7A 2UWJE 2M8RA 3DS1A 5AW2B 2JYGA 2ZT9C 4WBAA 1PEQA 2PGDA 1HGVA 4DZOA 4I1LA 3CX5I 1L4AB 2JR8A 4HB1A 1BE3E 2ZVOB 1N2DC 5APSA 4DCKA 3RK2C 1ZV8A 1VDFA 1ZP0C 1GMJA 1SQPK 3O8ZA 1S9KE 1EZVE 1YIJP 1ZXGA 1KILC 4WY4D 3P7KA 2V7QH 4PV1C 2VLPA 3WU2E 3HD7A 1VQOP 4O9BA 3TYYA 1L0NK 4C7RA 2P7JA 4AQRD 1JJ2O 3RK3C 1KQSO 2KGAA 2ZXEB 3RL0C 1YTZT 2AXCA 2Y9ZA 2E75B 2GDYA 2Q3IA 3KQGA 1GZLA 1BCCJ 1FZBA 5I4TG 2IYPA 3E2DA 2KK7A 2N50A 3Q5RA 1NTME 2A06G 3L73G 3L36A 1S5LH 2PY8A 3BVHA 2IFNA 3BATA 4H0LC 4EOTA 4U0DA 1JO5A 4PD4H 4NPDA 4I2LC 3HE4B 4L74A 2YKPA 1X79B 3AE7C 1E0HA 2Z4EA 3TNUA 1EDJA 3TGUG 2CG5B 2QG4A 2FAEA 1L0LJ 1QVGO 1IFJA 3NXSA 2MR7A 1RF1C 3VRLC 2A45I 4DG9A 5KAIE 3HTKA 2RMZA 2Y0EA 3V6IA 2FFDC 4R4LA 4M3LA 2E5TA 4C46A 3G6EP 2XKMA 5H2FE 3EFFK 1OVRA 1OFCX 5GTHE 4WVZA 2K0DX 1H0TB 5AVXB 3V4QA 1NTKE 2H7HA 5B5EH 2DNWA 4YXWH 3H1LD 2BUOA 3NTNA 3D6YA 1SQPG 3CXCO 2AEFA 1SFCC 5CCGC 2L5GB 1VQKP 2C0WA 1OX3A 2I8DA 3TGUJ 3CMAP 3H1HE 4HJGH 1QX8A 2E75D 5HGLA 2ZYGA 2HYNA 2OYHA 1NAYA 2JWAA 4YPCA 2J58A 3BCCD 5AW0B 1SVFA 1Q90D 2KLVA 3CCJP 3EQ2A 1N8RQ 2KGDA 1NGMB 4OGQD 4WY4C 4WY4B 1VQLP 2PAJA 5E79E 3SSUA 1PPJG 2WPVB 1JMBA 2LKIA 2WTYA 3VOPA 1QL1A 2MR8A 2KLUA 2IFMA 1RY3A 3JCUE 3A0HE 4PV1B 4Z1MH 2N1TB 3H25A 4PWVB 2WSCH 3HE5A 2XT1A 4MRTC 1JMMA 3L73J 3DS2A 2JDIH 2BEQD 2OYIA 2ERHA 2E76D 2K92A 3CMEP 4GR2A 4QKOA 1H0TA 1KV4A 2KWLA 1GW3A 2PEOA 1FZCA 3HZQA 3SWYA 4W7YA 5KP6B 3B5ND 3ZDMA 1SQQD 4C7NA 3AEFC 1L0NG 1HUCA 3EWKA 1E6JP 1NTZG 4R4MA 1LWUC 3CD6P 3P8MC 2KIKA 3D6ZA 1YBKA 1LTAC 2IYOA 1USEA 4PD4I 2GUSA 2QA4P 2CPBA 3Q2YA 3B5NA 2MF4A 2GZGA 3H47A 2M8NA 3CCMP 5B5EE 3G28A 2Q1KA 3M0DA 2HPCB 1DD3A 2LR2A 4D6TJ 2ZFCA 2PFXA 5AVQB 1NTKG 1DEEG 3WUTA 3S1KA 1YHQP 1EZVI 1L0ND 2KOOA 3VTPC 1HF9A 4GODA 4EYYQ 1KFNA 3NMDA 2Q9IA 2VLQA 4I6MC 2E76C 1M7LA 2JB0A 5B66E 4RESB 1A43A 3GF3A 1AYIA 2KZJA 4L73A 3CC4P 3AEEC 3GG2A 4KT0J 1KLPA 1EDIA 3AEGC 1NO4A 3V2NA 4C7NB 2JU1A 3LMOA 2QM8A 5KKZB 3B8EB 2E75C 2BCCE 2L0QA 4IFMA 3MUDC 3WU2H 1DV5A 3JC22 3A0HH 1SQXD 1L4AD 5GTIH 1CI6B 3CX5E 2M8PA 1VPCA 1USDA 3L71E 2CPSA 1URQB 1SQBG 1W2EA 4H44B 1IK9A 3MGNA 1JCCA 2WT7B 3A7OA 4LC1A 1Q2NA 2BASA 1KB9I 2FFDB 1SQPJ 1FJPA 3AE5C 2GDXA 2B9BA 4PJ0H 3IF4A 3AECC 3PJSK 3WUVA 1MZ9A 1NKNA 2WQYC 4U0AA 1S5LX 2IZ0A 3HD7B 2IBZG 1GPJA 2R3CA 3G0VA 4IL6E 2J59M 2KS1B 1OIPA 5TISE 4PXHB 2KB7P 3V2QA 2Z46A 1S4XA 2DW3A 3D71A 1H88A 2P2UA 1SQXE 4COPA 1Q7YQ 4H0LB 1RF1A 3SFEC 3NTEA 5F2OA 3PH0A 2QM7A 2N9BA 3G1GA 2WPQA 3L70E 1K04A 1PPJD 4NEOA 3L70J 1RF0A 3QH9A 2IPPA 5BU5A 3VYIA 2O01J 3AEAC 3C9IA 1GXHA 2KYVA 3CCLP 4XFYA 1DX7A 4BXLA 1L4AC 2HG5D 1QRJA 2FYNB 1RH5B 2KR5A 3TK1A 3D70A 5AW5B 4GR6A 1IK7A 3H1LE 3G1IA 1LT9B 3CCSP 2QRXA 1RQUA 3CWBJ 4ZNCA 3CE7A 2AF8A 4B86A 2B89A 3CX5H 3NY7B 2PEJA 1OVVA 3P8CE 3H1JG 1PEMA 1K30A 3U59A 1H8AA 3H6PA 1Q86Q 2OARA 5BS1A 4COCA 1EXIA 2KW2A 2NPSA 2KSEA 1XTGB 1P84D 3DS3A 1HJ0A 1L0IA 2P67A 2EIAA 1KN7A 1YJ9P 4N78D 1VQNP 1E5WA 1G1IA 3GLMA 1FDIA 4N3YB 1SQVG 1HH0A 3H1JE 3B71A 1FS0E 4U0CA 1HVVA 3CXHH 1EXJA 1EMVA 1KFMA 1SFCA 4A7PA 5CCGA 4I7ZC 4I7ZB 2NPSC 1N7LA 2KNCB 1NTZK 3A5TA 2Z5IA 1JY2O 2GUVA 2O01N 1QEXA 2IBZE 4XA4A 4GOFA 1PGOA 1LTBC 2Q6QA 3CCEP 2R5DA 1EDKA 1LT9A 3N7NA 3CWBG 1NHLA 4GIFA 1PGJA 1HGZA 1HWTC 3HE5B 4JYCA 1F80D 1YQ3C 2H88C 3B5NB 3B5IA 4BPGA 1M6NA 2JBGA 3AE4C 4RKUJ 3CC7P 2I1KA 3HRNA 2FXMA 4KHXA 1S2EA 1RE4A 3P8CD 3B4SA 1SQPD 1EZVD 2P1JA 5AW3B 1ZMBA 3A0BE 2VSQA 2K0XA 2W90A 2R5BA 2ZYAA 3LIDA 2KG8A 4U0BA 4OH8B 1X8YA 4HKZH 4YXDC 1LT1A 1GXGA 3G4SP 2FQ0A 2VLOA 1DH3A 1GK6A 1ZLLA 1U57A 2B87B 1PZQA 2WSEH 5AVSB 2QEXP 2WPTA 3HYBA 4Y99C 2XV6A 3L35A 2WT7A 4U7JA 1W5CE 1KYOD 2HODA 2KGEA 1HBWA 2M5RA 2XXMA 1QGKB 3RK2B 3F89A 1LT9C 3H1KD 3L74E 2WSFJ 3H1LJ 2YIUB 2H43A 3VMAA 4GT1A 1IC2A 2K9JA 1JUNA 2GZJA 2A45H 3T97A 3R4YA 2ZXXA 5CJ4A 2ZT9B 1CW5A 1SQVJ 2PNGA 1SFCD 5CCGD 4CPGA 1T8ZA 1NTKJ 2MY5A 2FYZA 3FXEA 1LJ2A 1YITP 2OTKE 1RE4C 1JNMA 3H32B 3V5BA 2MD9A 2FYUG 3LIEA 2RH0A 3OW2O 3PTZA 2Y9YA 1FC2C 2OTLP 4HH2A 4OVNF 5HV8A 2YO3A 3TGUE 2YMYA 4OGQC 2JO1A 5DCKA 2FYUJ 1AVYA 2KODA 2CK3H 4ASVA 4NPEA 5AW4B 1L0HA 3L72E 5CCHD 4GKGA 1T3UA 1GW4A 2QNWA 5HVCA 2V4HA 4ZKPA 4BRYA 1HY8A 2BHVA 1NVOA 1T3JA 3HTKB 1P84I 2MVUA 1M1JC 5JPAA 1EIAA 4HYTB 1D1DA 2L6EA 1KILB 3FGAD 1RO2A 3AE9C 2X2BA 3F5HA 1J1DB 3MGEA 1P84H 3P32A 1N73C 1PIXA 2ROQA 2O01H 3KXDA 1BCCD 2K0YA 5KAFE 2Q3EA 3OA7A 3ABVC 5E79H 3SWFA 1BGYG 2QJYC 3H0DA 2P58A 1EC5A 3AE2C 1GU4A 1QVFO 3E1IA 1JOCA 2ZAEB 4D6TD 1BDCA 2OGUA 1KQFB 1GL2D 1IJDB 1URQC 3O6QA 1Z6MA 3CCVP 1OW8A 3VP9A 3BCCG 4IL6H 3IR9A 3TNUB 1L0LE 2KOGA 5TISH 3L75G 1RNIA 2P10A 2ITAA 3G3ZA 1RHZB 2EHSA 4JQ0D 3VMXA 2YIUC 3L72D 1AA0A 3OJAB 5KKZC 1S9KD 2OYOA 4RO0A 1OVUA 2YMKA 4H13C 1KZUB 2JO0A 3EJBA 5AW1B 3I56P 1SQXJ 2PEQA 5AVTB 3VMYA 1JY3P 1PGQA 2PEKA 1J1EB 1RE3C 2Z5HA 2WSSH 2LPKA 2N1TA 5APTA 3C1LA 1CSBA 3H1KJ 4XROA 1U7MA 1GK4A 2CWOA 3L72G 4U3FJ 1FZCC 1IFIA 2WSEJ 2KOSA 3GW6A 2M5AB 1ZRTD 2JKVA 2K1AA 1VL2A 2K5XA 3I55P 1URQD 2I1JA 2QJKB 1L0LK 2MJZA 4GOEA 4KJMA 2E74D 3L72J 2AXTE 1KB9D 3BCCJ 1M56D 1A02J 1SP4A 3BCCE 2PENA 1PEOA 1T2KC 5EW5E 1NAFA 3FX0A 3RL0g 5KAFH 5BS2A 1ZR4A 3N4XA 3WBHA 4AYCA 4D6TG 3KHUA 1VQ6P 1VQ4P 3E7KA 2KORA 1JY2N 5APWA 1LTTC 3RK3D 1NU1J 2JJLA 2H89C 3U1AA 4PH1A 1YJNP 1L0NE 2A45G 2M5AA 5AVWB 4U3FD 1JCDA 1FZCB 2AEJA 3M0AA 1X22A 5DJTB 1HQBA 4BRYB 2KOPA 1E79H 2JP3A 5AVYB 1K73Q 3KYQA 2BEZF 4WYMA 3CPWO 5KLVK 2JYLA 3CXHE 2ZT9D 5HGOA 4OGQB 2WSFH 1JTHB 3CXHD 1FU1A 3H1ID 1SFCB 3V2PA 2QVAA 1D7MA 2CNRA 2LMLA 4XFZA 2D2CC 3RG6C 4R0MA 4H44C 2R44A 1AQ5A 2LXCB 5APQA 1JY3O 4WWIA 3PRJA 2CQ8A 1IZNB 2XNXA 2NZ2A 3KDPB 2B88A 4U0FA 3CC2P 1FZFA 2W27A 2FYUD 4AUWA 4NPFX 2HODB 3GF7A 2J5UA 3CI9A 3HD7C 1BSHA 2EHTA 1W2BO 1NTKK 5GTHH 2FVEA 2N98A 1BCCE 3H1IG 4UB6H 3S9OA 1T8KA 3CL3D 1NTZJ 3M1MA 5APXA 1GL2C 1LTJB 2FY8A 2RN0A 3AE3C 2HR3A 1YYCA 4Y28J 1ZR2A 1L0LG 2E76B 2QSIA 5AVVB 1YTZI 4JF7A 4UHPB 2FXPA 3GZLA 5K5GB 1PP9J 1VQ5P 3UIAA 2K2QA 1M74A 1FBMA 3H1IE 2FQ2A 2XU6A 3RK3B 4DOJA 1SQBJ 5KP8B 4UB8H 1K9MQ 3L70G 1PEUA 4PH0A 2WSCJ 2BCCJ 2R3SA 2K93A 2PP6A 2QJYB 1KILE 3GJNA 2GZFA 4PV1D 5CMZA 3GHGB 3GHGC 1FZEA 2PEMA 2GYKA 2O1KA 2K37A 1BSNA 1NWQA 2FFDA 3M9QA 2NO8A 4WY4A 1H89A 4PJ0E 2JWDA 1EOQA 1PGPA 3KZIE 1SQPE 4H13B 5AVZB 4QMAA 1U7JA 4GDOA 1PP9D 2OYHC 2OYHB 2HFED 3L71D 5AW8B 2L9FA 1PPJE 2WZ7A 1KB9E 1LTIC
chains in the Genus database with same CATH topology
1W2BO 1VQLP 3G21A 4XRQA 3DS0A 3NTEA 5F2OA 1A43A 2P9XA 3DTJA 3H0DA 3Q20A 3CC4P 1QVFO 1AUMA 3G1GA 2ONTA 3M1MA 5F2NA 4IPYA 3CCEP 4QNBA 2PEIA 3LRYA 4U0EA 2PENA 1Q82Q 1PEOA 2XT1A 1Q81Q 2DGYA 2Z44A 3DS2A 1QVGO 5BS2A 2BQ1E 3G29A 3WBHA 3CMEP 1K8AQ 3DS1A 3VRLC 1YITP 1VQ6P 3CCVP 1VQ4P 2JYGA 4GR2A 1PEQA 2EG5A 3CCLP 1M6EX 1Q7YQ 1VQ5P 3DS5A 3OW2O 4XFYA 2PEOA 2Z45A 1M74A 3HZQA 3B5IA 1QRJA 1M90Q 1M6NA 4PH1A 3G71P 2OTLP 2M8PA 1RNIA 3CC7P 1YJNP 4GR6A 1M1KQ 5HGNA 3DPHA 3G6EP 3G1IA 1RO0A 1K9MQ 5DCKA 1VQMP 3CCSP 1PEUA 4PH0A 1VQ7P 1VQPP 2KODA 1VQ8P 1A8OA 3CCQP 1YIJP 1ZMBA 1IUQA 1E6JP 2PEJA 1K73Q 3CD6P 1K30A 1PEMA 4WYMA 2M8LA 3CPWO 4U0BA 1KD1Q 1KC8Q 1Q86Q 2JO0A 2OARA 2JYLA 2LF4A 5BS1A 4COCA 3G4SP 1VQOP 2BUOA 5HGOA 3P05A 3I56P 2QA4P 2PEMA 2PEQA 5F2KA 4M0IA 2BHVA 3CXCO 1JJ2O 3H47A 2M8NA 4XFXA 3CCMP 3DS3A 1KQSO 1VQKP 2PEKA 4U0AA 4XFZA 3HYBA 3G28A 5JPAA 2QEXP 1EIAA 2EIAA 3RG6C 1VQ9P 1EOQA 3G0VA 1YI2P 2XV6A 1YJ9P 1D1DA 2L6EA 3DS4A 3CMAP 1VQNP 1RO2A 5I4TG 3E2DA 4XROA 5HGLA 2EFJA 3MGEA 2CWOA 3CCUP 4U0FA 4U0CA 1NJIQ 2Z46A 1YHQP 3CC2P 1YJWP 5HGMA 2E1MA 3H4EA 2XXMA 1S72P 3CCRP 2PY8A 1BAJA 3G26A 3CCJP 1N8RQ 4U0DA 2OTJP 4COPA 3I55P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 P;  3CCV P;  1VQ4 P;  1W2B O;  1VQL P;  1VQ9 P;  1VQ8 P;  1YI2 P;  1YJ9 P;  3CCQ P;  1VQN P;  3CMA P;  1YIJ P;  3CCL P;  1Q7Y Q;  1K73 Q;  1VQ5 P;  3OW2 O;  3CD6 P;  3CPW O;  3CC4 P;  1QVF O;  1KD1 Q;  1YIT P;  1KC8 Q;  1M90 Q;  1Q86 Q;  3G71 P;  3CCU P;  2OTL P;  3CC2 P;  1NJI Q;  1YHQ P;  3G4S P;  1VQO P;  1YJW P;  3CCE P;  3CC7 P;  3I56 P;  1YJN P;  1Q82 Q;  2QA4 P;  1M1K Q;  1Q81 Q;  1S72 P;  3CCR P;  3G6E P;  3CXC O;  1QVG O;  1K9M Q;  1JJ2 O;  1VQM P;  3CCM P;  3CCS P;  1KQS O;  3CCJ P;  2OTJ P;  1N8R Q;  1VQK P;  1VQ7 P;  3CME P;  1VQP P;  1K8A Q;  2QEX P;  3I55 P; 
#chains in the Genus database with same CATH topology
 3CLQ A;  2KI7 B;  3G21 A;  2BCC D;  3AE8 C;  1GL2 B;  3EJD A;  4L76 A;  2NPS D;  3LRY A;  2GM4 A;  1Y9B A;  2N5I A;  2OYI B;  1KYO I;  2BQ1 E;  1JY3 N;  1N7S D;  2KG6 A;  3SWK A;  2JGP A;  2AFE A;  2BCC G;  2NRG A;  2N1T D;  2WWW A;  1SLQ A;  1VF5 B;  5EFW B;  4IFD K;  4PD4 D;  2XV5 A;  1JEK A;  5HGN A;  3HD7 D;  1NTM D;  4OWF A;  1RF0 C;  2W8Z A;  1VQ7 P;  3IN6 A;  2K94 A;  3AEB C;  3Q5P A;  1UII A;  2K88 A;  1EDL A;  1NTK D;  1A8O A;  3CCQ P;  1N7S A;  3JCU H;  1HTL C;  2WMM A;  3B5N C;  4DT0 A;  1KIL A;  1T6A A;  1P84 E;  2N5H A;  4BPH A;  5AW9 B;  2GZE A;  2LKM A;  2M0B A;  4K3A A;  2B87 A;  1UJZ A;  4HKG A;  1NYH A;  2YO2 A;  1LGH B;  1YI2 P;  2HPC A;  1AV1 A;  1FOS F;  4IOI H;  2W6J H;  1X0T A;  1M1J A;  3EJE A;  1FJK A;  4PD4 E;  3PHL A;  4H44 D;  2K9Y A;  2L4B A;  1BAJ A;  2C9L Y;  2K9J B;  5KLV D;  2OTJ P;  1OW7 A;  1NTZ D;  1OMI A;  3HUS B;  2P9X A;  3JSV C;  5KTB A;  5CCH C;  2KNC A;  3CXH I;  5CBO A;  2FYU E;  1SQQ K;  4QNB A;  2PEI A;  4U0E A;  2RKL A;  4ZKU A;  5AVR B;  3BRV B;  1MKM A;  1S1C X;  1WT6 A;  1FR2 A;  3H1J D;  1LTS C;  2WVR A;  3RK2 D;  2E43 A;  2KUB A;  3DS5 A;  1M8O B;  1WRG A;  2N1T C;  1Z56 A;  1ZRT E;  5CJ0 A;  3Q5S A;  1BCC G;  3S4R A;  1CZQ A;  3MD0 A;  2IDB A;  1QLE D;  3WMM 0;  5B66 H;  2A06 D;  5AW6 B;  5KJ7 C;  2IX7 C;  2W6A A;  3HUS A;  1NTM G;  5KLV J;  1BE3 G;  1DNY A;  2O1J A;  3GHG A;  5CHX A;  2FBW C;  4UB8 E;  3TDK A;  1N7S B;  2G3A A;  2W83 C;  1RF1 B;  3GZM A;  3MP7 B;  1BE3 J;  4TLF A;  1NU1 K;  1NU1 G;  1LTJ A;  4LGD E;  3I5C A;  2AXT H;  2O3J A;  3CWB D;  1IMQ A;  2L22 A;  4DJG A;  3Q1M A;  1VF5 C;  5HGM A;  2E1M A;  4RJT A;  2FAC A;  4IFF A;  1KTM A;  3MTU E;  1GDT A;  3L73 E;  2WPS A;  3U43 A;  2N6Y A;  1GL2 A;  1OXZ A;  2FVA A;  1AUM A;  2YKQ A;  4JBZ A;  1AQT A;  5F2N A;  4YTP C;  2XZR A;  2Z44 A;  3RL0 D;  1KB9 H;  5APV A;  2KS1 A;  2IBZ I;  1N7S C;  1J2J B;  2IBZ D;  3CWB E;  5KLV G;  3VMZ A;  3H1H D;  1AF8 A;  2GZI A;  1DEB A;  2EG5 A;  4N6J A;  1M6E X;  5KJ7 D;  2LIW A;  1LNQ A;  2AEM A;  1M90 Q;  2WPR A;  3M9H A;  2JQ4 A;  1ACP A;  1M1K Q;  5H2F H;  1R5L A;  1LP1 A;  4H2X C;  3WUU A;  1ZOY C;  1SQX G;  1SQX K;  2FHS C;  1ZW0 A;  1VQP P;  1X9V A;  1GU5 A;  2JEE A;  2E74 C;  4N78 E;  3H1L G;  2OQQ A;  4K35 A;  1JTH A;  1URQ A;  2M8L A;  3HUS C;  4BWN A;  1DIP A;  1ZME C;  1OR5 A;  2L91 A;  4TT3 H;  1HJB A;  2NPS B;  3V4W A;  2QJK C;  3V2R A;  1MFT A;  4H13 D;  5L8R J;  3O6Q B;  4WB4 A;  3MUD A;  2POH A;  1AFO A;  1N73 A;  2YKO A;  2GA1 A;  3TGU D;  3HE4 A;  3TF5 A;  1LP1 B;  3SFD C;  3CCR P;  1R5S A;  2AVA A;  1Y47 A;  3LW5 J;  3RL0 B;  1FZA A;  2AFD A;  1LTG C;  2YNY A;  1KMI Z;  2ZVN B;  3H1I J;  3DS0 A;  1KYO H;  5KLV E;  1BGY D;  3OAK A;  3H1J J;  2KSJ A;  4W80 A;  3H32 A;  3C8V A;  2D2C D;  2Y0D A;  3RGU A;  2QIW A;  3RG2 A;  2IZ1 A;  4JYB A;  3L73 D;  3KZI H;  2M3B A;  2VRS A;  4W7Z A;  1VF5 D;  1PL5 A;  5APY A;  1FDM A;  3ITK A;  3M0D C;  2QE7 H;  1L2P A;  3AED C;  4BPF A;  1S5L E;  5CZD B;  2JU2 A;  4LLH A;  1SS1 A;  3AE1 C;  1KQG B;  1VQM P;  3L74 G;  1QL2 A;  1N86 A;  2ZJS E;  4Y99 B;  3L4F A;  1NU1 E;  1M1J B;  1UIX A;  1T2K D;  2FQ1 A;  1NH4 A;  2GDW A;  3A3Y B;  4ASW A;  1IFM A;  5C39 A;  4IZ6 A;  2XDJ A;  1KC8 Q;  5AW7 B;  2QJP C;  2YXQ B;  1G2C B;  1BE3 D;  1IFD A;  2FYU K;  2KG9 A;  3P05 A;  3BRT B;  2LXB A;  3L74 J;  4M0I A;  2LOL A;  2LIU A;  5KLI B;  1SQB D;  2CGQ A;  1TU3 F;  2ZYD A;  5KAI H;  3K5B A;  2VLN A;  1UNK A;  1JY2 P;  3MHV A;  3IFM A;  2Q7C A;  1KQL A;  3NFQ A;  5BU8 B;  2FKW B;  3G9R A;  1FDO A;  2H8P D;  3VP8 A;  3L75 J;  3L70 D;  2PRR A;  2G8Y A;  3A0B H;  1J1E C;  2C0X A;  5EJD A;  1DD4 A;  2MKV A;  3L37 A;  1SQV K;  2LL8 A;  3FWN A;  4XRQ A;  3DTJ A;  3W68 A;  1OZH A;  1SQQ J;  3L71 G;  3Q20 A;  2KOQ A;  2Y0C A;  1PP9 G;  4UB6 E;  3H1H J;  4EIJ A;  1IFN A;  4D6T E;  1Q81 Q;  2DGY A;  1Y8A A;  3GMA A;  1IFP A;  3M06 A;  3RBZ A;  1KYO E;  3G29 A;  1IMP A;  1K8A Q;  2D2C B;  5M1B A;  5KLI C;  2FAD A;  1NTZ E;  3RBX A;  2N9Y B;  2HLO A;  1M57 D;  5GTI E;  2Z45 A;  2WIT A;  1BDD A;  1IO4 A;  3MIW A;  1YQ4 C;  1CEI A;  3H1K G;  3QWO C;  5AVU B;  2M3E A;  3W67 A;  2E42 A;  1XTC C;  1GD2 E;  3MZW B;  1IUQ A;  1NU1 D;  1L0N J;  2A06 E;  2LTE A;  2KGC A;  5BVZ A;  3R2P A;  3Q3D A;  2FVF A;  1NOH A;  5F2K A;  4JPZ B;  1JM0 A;  1MZ8 A;  1VHN A;  1K05 A;  3II6 A;  4H2W C;  1VKU A;  1WMK A;  4XFX A;  5DJU B;  4F37 A;  5KJ7 A;  1L0L D;  3AE6 C;  2E74 B;  1G2C A;  1SQQ G;  1L4A A;  3L71 J;  3EFG A;  1GTW A;  3DS4 A;  2W6B A;  1EZV G;  2E5Y A;  5CBN A;  3M91 A;  2XZ0 D;  3CCU P;  1NJI Q;  1S3J A;  1OWA A;  3H4E A;  5APU A;  1S72 P;  1OW6 A;  4H2Y C;  4L75 A;  1BGY E;  1G1J A;  3IAO A;  1BGY J;  2MVV A;  1RE3 A;  1FOS E;  1JB0 J;  1LWU A;  3E1R A;  3GKL C;  5KP7 B;  3M9B A;  2QJP B;  2ONT A;  1BXI A;  2FYN C;  4EDF A;  1N73 B;  2V7Q J;  2C9N Y;  1Q82 Q;  1J1D C;  2N6Z A;  3LW5 H;  2Q5U A;  1CI6 A;  4XFJ A;  3U1C A;  1FAV A;  2KZI A;  1MUU A;  2R32 A;  3TSI A;  5TJH A;  1NTM J;  1SQV D;  4H0L D;  2KXP B;  4U3F G;  3BAS A;  3G71 P;  3USS A;  1KOR A;  3DPH A;  1RO0 A;  1FE6 A;  2OYI C;  2XND H;  1AVO A;  1PP9 E;  1PV3 A;  2K3R A;  3FWL A;  4CA3 A;  3L75 E;  1VQ8 P;  1LWU B;  2YXR B;  3KPE A;  1SQB E;  1PFI A;  2XZ1 C;  1KD1 Q;  4U3F E;  3FXD A;  2KP8 A;  1SQQ E;  2LF4 A;  3VN0 A;  1R8E A;  1ZNV A;  3RK3 E;  3A2A A;  1KIL D;  2FXO A;  1VQ9 P;  3PLN A;  1X3O A;  1ZN5 A;  1SQB K;  3L75 D;  1FZG A;  2EFJ A;  1RQV A;  4EI2 A;  1YJW P;  1NTM K;  3B4Q A;  3T97 B;  1LTJ C;  3CX5 D;  3G26 A;  1SQV E;  1MV8 A;  1NKZ B;  7CEI A;  1AJY A;  3PP5 A;  2SPZ A;  1MFZ A;  5CCH A;  4ZMD A;  4MN4 C;  1NQ4 A;  3H1H G;  3L74 D;  3H1K E;  2JAZ A;  4XE5 B;  4IL6 X;  4IPY A;  1A02 F;  1EQ7 A;  2UWJ E;  2M8R A;  3DS1 A;  5AW2 B;  2JYG A;  2ZT9 C;  4WBA A;  1PEQ A;  2PGD A;  1HGV A;  4DZO A;  4I1L A;  3CX5 I;  1L4A B;  2JR8 A;  4HB1 A;  1BE3 E;  2ZVO B;  1N2D C;  5APS A;  4DCK A;  3RK2 C;  1ZV8 A;  1VDF A;  1ZP0 C;  1GMJ A;  1SQP K;  3O8Z A;  1S9K E;  1EZV E;  1YIJ P;  1ZXG A;  1KIL C;  4WY4 D;  3P7K A;  2V7Q H;  4PV1 C;  2VLP A;  3WU2 E;  3HD7 A;  1VQO P;  4O9B A;  3TYY A;  1L0N K;  4C7R A;  2P7J A;  4AQR D;  1JJ2 O;  3RK3 C;  1KQS O;  2KGA A;  2ZXE B;  3RL0 C;  1YTZ T;  2AXC A;  2Y9Z A;  2E75 B;  2GDY A;  2Q3I A;  3KQG A;  1GZL A;  1BCC J;  1FZB A;  5I4T G;  2IYP A;  3E2D A;  2KK7 A;  2N50 A;  3Q5R A;  1NTM E;  2A06 G;  3L73 G;  3L36 A;  1S5L H;  2PY8 A;  3BVH A;  2IFN A;  3BAT A;  4H0L C;  4EOT A;  4U0D A;  1JO5 A;  4PD4 H;  4NPD A;  4I2L C;  3HE4 B;  4L74 A;  2YKP A;  1X79 B;  3AE7 C;  1E0H A;  2Z4E A;  3TNU A;  1EDJ A;  3TGU G;  2CG5 B;  2QG4 A;  2FAE A;  1L0L J;  1QVG O;  1IFJ A;  3NXS A;  2MR7 A;  1RF1 C;  3VRL C;  2A45 I;  4DG9 A;  5KAI E;  3HTK A;  2RMZ A;  2Y0E A;  3V6I A;  2FFD C;  4R4L A;  4M3L A;  2E5T A;  4C46 A;  3G6E P;  2XKM A;  5H2F E;  3EFF K;  1OVR A;  1OFC X;  5GTH E;  4WVZ A;  2K0D X;  1H0T B;  5AVX B;  3V4Q A;  1NTK E;  2H7H A;  5B5E H;  2DNW A;  4YXW H;  3H1L D;  2BUO A;  3NTN A;  3D6Y A;  1SQP G;  3CXC O;  2AEF A;  1SFC C;  5CCG C;  2L5G B;  1VQK P;  2C0W A;  1OX3 A;  2I8D A;  3TGU J;  3CMA P;  3H1H E;  4HJG H;  1QX8 A;  2E75 D;  5HGL A;  2ZYG A;  2HYN A;  2OYH A;  1NAY A;  2JWA A;  4YPC A;  2J58 A;  3BCC D;  5AW0 B;  1SVF A;  1Q90 D;  2KLV A;  3CCJ P;  3EQ2 A;  1N8R Q;  2KGD A;  1NGM B;  4OGQ D;  4WY4 C;  4WY4 B;  1VQL P;  2PAJ A;  5E79 E;  3SSU A;  1PPJ G;  2WPV B;  1JMB A;  2LKI A;  2WTY A;  3VOP A;  1QL1 A;  2MR8 A;  2KLU A;  2IFM A;  1RY3 A;  3JCU E;  3A0H E;  4PV1 B;  4Z1M H;  2N1T B;  3H25 A;  4PWV B;  2WSC H;  3HE5 A;  2XT1 A;  4MRT C;  1JMM A;  3L73 J;  3DS2 A;  2JDI H;  2BEQ D;  2OYI A;  2ERH A;  2E76 D;  2K92 A;  3CME P;  4GR2 A;  4QKO A;  1H0T A;  1KV4 A;  2KWL A;  1GW3 A;  2PEO A;  1FZC A;  3HZQ A;  3SWY A;  4W7Y A;  5KP6 B;  3B5N D;  3ZDM A;  1SQQ D;  4C7N A;  3AEF C;  1L0N G;  1HUC A;  3EWK A;  1E6J P;  1NTZ G;  4R4M A;  1LWU C;  3CD6 P;  3P8M C;  2KIK A;  3D6Z A;  1YBK A;  1LTA C;  2IYO A;  1USE A;  4PD4 I;  2GUS A;  2QA4 P;  2CPB A;  3Q2Y A;  3B5N A;  2MF4 A;  2GZG A;  3H47 A;  2M8N A;  3CCM P;  5B5E E;  3G28 A;  2Q1K A;  3M0D A;  2HPC B;  1DD3 A;  2LR2 A;  4D6T J;  2ZFC A;  2PFX A;  5AVQ B;  1NTK G;  1DEE G;  3WUT A;  3S1K A;  1YHQ P;  1EZV I;  1L0N D;  2KOO A;  3VTP C;  1HF9 A;  4GOD A;  4EYY Q;  1KFN A;  3NMD A;  2Q9I A;  2VLQ A;  4I6M C;  2E76 C;  1M7L A;  2JB0 A;  5B66 E;  4RES B;  1A43 A;  3GF3 A;  1AYI A;  2KZJ A;  4L73 A;  3CC4 P;  3AEE C;  3GG2 A;  4KT0 J;  1KLP A;  1EDI A;  3AEG C;  1NO4 A;  3V2N A;  4C7N B;  2JU1 A;  3LMO A;  2QM8 A;  5KKZ B;  3B8E B;  2E75 C;  2BCC E;  2L0Q A;  4IFM A;  3MUD C;  3WU2 H;  1DV5 A;  3JC2 2;  3A0H H;  1SQX D;  1L4A D;  5GTI H;  1CI6 B;  3CX5 E;  2M8P A;  1VPC A;  1USD A;  3L71 E;  2CPS A;  1URQ B;  1SQB G;  1W2E A;  4H44 B;  1IK9 A;  3MGN A;  1JCC A;  2WT7 B;  3A7O A;  4LC1 A;  1Q2N A;  2BAS A;  1KB9 I;  2FFD B;  1SQP J;  1FJP A;  3AE5 C;  2GDX A;  2B9B A;  4PJ0 H;  3IF4 A;  3AEC C;  3PJS K;  3WUV A;  1MZ9 A;  1NKN A;  2WQY C;  4U0A A;  1S5L X;  2IZ0 A;  3HD7 B;  2IBZ G;  1GPJ A;  2R3C A;  3G0V A;  4IL6 E;  2J59 M;  2KS1 B;  1OIP A;  5TIS E;  4PXH B;  2KB7 P;  3V2Q A;  2Z46 A;  1S4X A;  2DW3 A;  3D71 A;  1H88 A;  2P2U A;  1SQX E;  4COP A;  1Q7Y Q;  4H0L B;  1RF1 A;  3SFE C;  3NTE A;  5F2O A;  3PH0 A;  2QM7 A;  2N9B A;  3G1G A;  2WPQ A;  3L70 E;  1K04 A;  1PPJ D;  4NEO A;  3L70 J;  1RF0 A;  3QH9 A;  2IPP A;  5BU5 A;  3VYI A;  2O01 J;  3AEA C;  3C9I A;  1GXH A;  2KYV A;  3CCL P;  4XFY A;  1DX7 A;  4BXL A;  1L4A C;  2HG5 D;  1QRJ A;  2FYN B;  1RH5 B;  2KR5 A;  3TK1 A;  3D70 A;  5AW5 B;  4GR6 A;  1IK7 A;  3H1L E;  3G1I A;  1LT9 B;  3CCS P;  2QRX A;  1RQU A;  3CWB J;  4ZNC A;  3CE7 A;  2AF8 A;  4B86 A;  2B89 A;  3CX5 H;  3NY7 B;  2PEJ A;  1OVV A;  3P8C E;  3H1J G;  1PEM A;  1K30 A;  3U59 A;  1H8A A;  3H6P A;  1Q86 Q;  2OAR A;  5BS1 A;  4COC A;  1EXI A;  2KW2 A;  2NPS A;  2KSE A;  1XTG B;  1P84 D;  3DS3 A;  1HJ0 A;  1L0I A;  2P67 A;  2EIA A;  1KN7 A;  1YJ9 P;  4N78 D;  1VQN P;  1E5W A;  1G1I A;  3GLM A;  1FDI A;  4N3Y B;  1SQV G;  1HH0 A;  3H1J E;  3B71 A;  1FS0 E;  4U0C A;  1HVV A;  3CXH H;  1EXJ A;  1EMV A;  1KFM A;  1SFC A;  4A7P A;  5CCG A;  4I7Z C;  4I7Z B;  2NPS C;  1N7L A;  2KNC B;  1NTZ K;  3A5T A;  2Z5I A;  1JY2 O;  2GUV A;  2O01 N;  1QEX A;  2IBZ E;  4XA4 A;  4GOF A;  1PGO A;  1LTB C;  2Q6Q A;  3CCE P;  2R5D A;  1EDK A;  1LT9 A;  3N7N A;  3CWB G;  1NHL A;  4GIF A;  1PGJ A;  1HGZ A;  1HWT C;  3HE5 B;  4JYC A;  1F80 D;  1YQ3 C;  2H88 C;  3B5N B;  3B5I A;  4BPG A;  1M6N A;  2JBG A;  3AE4 C;  4RKU J;  3CC7 P;  2I1K A;  3HRN A;  2FXM A;  4KHX A;  1S2E A;  1RE4 A;  3P8C D;  3B4S A;  1SQP D;  1EZV D;  2P1J A;  5AW3 B;  1ZMB A;  3A0B E;  2VSQ A;  2K0X A;  2W90 A;  2R5B A;  2ZYA A;  3LID A;  2KG8 A;  4U0B A;  4OH8 B;  1X8Y A;  4HKZ H;  4YXD C;  1LT1 A;  1GXG A;  3G4S P;  2FQ0 A;  2VLO A;  1DH3 A;  1GK6 A;  1ZLL A;  1U57 A;  2B87 B;  1PZQ A;  2WSE H;  5AVS B;  2QEX P;  2WPT A;  3HYB A;  4Y99 C;  2XV6 A;  3L35 A;  2WT7 A;  4U7J A;  1W5C E;  1KYO D;  2HOD A;  2KGE A;  1HBW A;  2M5R A;  2XXM A;  1QGK B;  3RK2 B;  3F89 A;  1LT9 C;  3H1K D;  3L74 E;  2WSF J;  3H1L J;  2YIU B;  2H43 A;  3VMA A;  4GT1 A;  1IC2 A;  2K9J A;  1JUN A;  2GZJ A;  2A45 H;  3T97 A;  3R4Y A;  2ZXX A;  5CJ4 A;  2ZT9 B;  1CW5 A;  1SQV J;  2PNG A;  1SFC D;  5CCG D;  4CPG A;  1T8Z A;  1NTK J;  2MY5 A;  2FYZ A;  3FXE A;  1LJ2 A;  1YIT P;  2OTK E;  1RE4 C;  1JNM A;  3H32 B;  3V5B A;  2MD9 A;  2FYU G;  3LIE A;  2RH0 A;  3OW2 O;  3PTZ A;  2Y9Y A;  1FC2 C;  2OTL P;  4HH2 A;  4OVN F;  5HV8 A;  2YO3 A;  3TGU E;  2YMY A;  4OGQ C;  2JO1 A;  5DCK A;  2FYU J;  1AVY A;  2KOD A;  2CK3 H;  4ASV A;  4NPE A;  5AW4 B;  1L0H A;  3L72 E;  5CCH D;  4GKG A;  1T3U A;  1GW4 A;  2QNW A;  5HVC A;  2V4H A;  4ZKP A;  4BRY A;  1HY8 A;  2BHV A;  1NVO A;  1T3J A;  3HTK B;  1P84 I;  2MVU A;  1M1J C;  5JPA A;  1EIA A;  4HYT B;  1D1D A;  2L6E A;  1KIL B;  3FGA D;  1RO2 A;  3AE9 C;  2X2B A;  3F5H A;  1J1D B;  3MGE A;  1P84 H;  3P32 A;  1N73 C;  1PIX A;  2ROQ A;  2O01 H;  3KXD A;  1BCC D;  2K0Y A;  5KAF E;  2Q3E A;  3OA7 A;  3ABV C;  5E79 H;  3SWF A;  1BGY G;  2QJY C;  3H0D A;  2P58 A;  1EC5 A;  3AE2 C;  1GU4 A;  1QVF O;  3E1I A;  1JOC A;  2ZAE B;  4D6T D;  1BDC A;  2OGU A;  1KQF B;  1GL2 D;  1IJD B;  1URQ C;  3O6Q A;  1Z6M A;  3CCV P;  1OW8 A;  3VP9 A;  3BCC G;  4IL6 H;  3IR9 A;  3TNU B;  1L0L E;  2KOG A;  5TIS H;  3L75 G;  1RNI A;  2P10 A;  2ITA A;  3G3Z A;  1RHZ B;  2EHS A;  4JQ0 D;  3VMX A;  2YIU C;  3L72 D;  1AA0 A;  3OJA B;  5KKZ C;  1S9K D;  2OYO A;  4RO0 A;  1OVU A;  2YMK A;  4H13 C;  1KZU B;  2JO0 A;  3EJB A;  5AW1 B;  3I56 P;  1SQX J;  2PEQ A;  5AVT B;  3VMY A;  1JY3 P;  1PGQ A;  2PEK A;  1J1E B;  1RE3 C;  2Z5H A;  2WSS H;  2LPK A;  2N1T A;  5APT A;  3C1L A;  1CSB A;  3H1K J;  4XRO A;  1U7M A;  1GK4 A;  2CWO A;  3L72 G;  4U3F J;  1FZC C;  1IFI A;  2WSE J;  2KOS A;  3GW6 A;  2M5A B;  1ZRT D;  2JKV A;  2K1A A;  1VL2 A;  2K5X A;  3I55 P;  1URQ D;  2I1J A;  2QJK B;  1L0L K;  2MJZ A;  4GOE A;  4KJM A;  2E74 D;  3L72 J;  2AXT E;  1KB9 D;  3BCC J;  1M56 D;  1A02 J;  1SP4 A;  3BCC E;  2PEN A;  1PEO A;  1T2K C;  5EW5 E;  1NAF A;  3FX0 A;  3RL0 g;  5KAF H;  5BS2 A;  1ZR4 A;  3N4X A;  3WBH A;  4AYC A;  4D6T G;  3KHU A;  1VQ6 P;  1VQ4 P;  3E7K A;  2KOR A;  1JY2 N;  5APW A;  1LTT C;  3RK3 D;  1NU1 J;  2JJL A;  2H89 C;  3U1A A;  4PH1 A;  1YJN P;  1L0N E;  2A45 G;  2M5A A;  5AVW B;  4U3F D;  1JCD A;  1FZC B;  2AEJ A;  3M0A A;  1X22 A;  5DJT B;  1HQB A;  4BRY B;  2KOP A;  1E79 H;  2JP3 A;  5AVY B;  1K73 Q;  3KYQ A;  2BEZ F;  4WYM A;  3CPW O;  5KLV K;  2JYL A;  3CXH E;  2ZT9 D;  5HGO A;  4OGQ B;  2WSF H;  1JTH B;  3CXH D;  1FU1 A;  3H1I D;  1SFC B;  3V2P A;  2QVA A;  1D7M A;  2CNR A;  2LML A;  4XFZ A;  2D2C C;  3RG6 C;  4R0M A;  4H44 C;  2R44 A;  1AQ5 A;  2LXC B;  5APQ A;  1JY3 O;  4WWI A;  3PRJ A;  2CQ8 A;  1IZN B;  2XNX A;  2NZ2 A;  3KDP B;  2B88 A;  4U0F A;  3CC2 P;  1FZF A;  2W27 A;  2FYU D;  4AUW A;  4NPF X;  2HOD B;  3GF7 A;  2J5U A;  3CI9 A;  3HD7 C;  1BSH A;  2EHT A;  1W2B O;  1NTK K;  5GTH H;  2FVE A;  2N98 A;  1BCC E;  3H1I G;  4UB6 H;  3S9O A;  1T8K A;  3CL3 D;  1NTZ J;  3M1M A;  5APX A;  1GL2 C;  1LTJ B;  2FY8 A;  2RN0 A;  3AE3 C;  2HR3 A;  1YYC A;  4Y28 J;  1ZR2 A;  1L0L G;  2E76 B;  2QSI A;  5AVV B;  1YTZ I;  4JF7 A;  4UHP B;  2FXP A;  3GZL A;  5K5G B;  1PP9 J;  1VQ5 P;  3UIA A;  2K2Q A;  1M74 A;  1FBM A;  3H1I E;  2FQ2 A;  2XU6 A;  3RK3 B;  4DOJ A;  1SQB J;  5KP8 B;  4UB8 H;  1K9M Q;  3L70 G;  1PEU A;  4PH0 A;  2WSC J;  2BCC J;  2R3S A;  2K93 A;  2PP6 A;  2QJY B;  1KIL E;  3GJN A;  2GZF A;  4PV1 D;  5CMZ A;  3GHG B;  3GHG C;  1FZE A;  2PEM A;  2GYK A;  2O1K A;  2K37 A;  1BSN A;  1NWQ A;  2FFD A;  3M9Q A;  2NO8 A;  4WY4 A;  1H89 A;  4PJ0 E;  2JWD A;  1EOQ A;  1PGP A;  3KZI E;  1SQP E;  4H13 B;  5AVZ B;  4QMA A;  1U7J A;  4GDO A;  1PP9 D;  2OYH C;  2OYH B;  2HFE D;  3L71 D;  5AW8 B;  2L9F A;  1PPJ E;  2WZ7 A;  1KB9 E;  1LTI C; 
#chains in the Genus database with same CATH homology
 1W2B O;  1VQL P;  3G21 A;  4XRQ A;  3DS0 A;  3NTE A;  5F2O A;  1A43 A;  2P9X A;  3DTJ A;  3H0D A;  3Q20 A;  3CC4 P;  1QVF O;  1AUM A;  3G1G A;  2ONT A;  3M1M A;  5F2N A;  4IPY A;  3CCE P;  4QNB A;  2PEI A;  3LRY A;  4U0E A;  2PEN A;  1Q82 Q;  1PEO A;  2XT1 A;  1Q81 Q;  2DGY A;  2Z44 A;  3DS2 A;  1QVG O;  5BS2 A;  2BQ1 E;  3G29 A;  3WBH A;  3CME P;  1K8A Q;  3DS1 A;  3VRL C;  1YIT P;  1VQ6 P;  3CCV P;  1VQ4 P;  2JYG A;  4GR2 A;  1PEQ A;  2EG5 A;  3CCL P;  1M6E X;  1Q7Y Q;  1VQ5 P;  3DS5 A;  3OW2 O;  4XFY A;  2PEO A;  2Z45 A;  1M74 A;  3HZQ A;  3B5I A;  1QRJ A;  1M90 Q;  1M6N A;  4PH1 A;  3G71 P;  2OTL P;  2M8P A;  1RNI A;  3CC7 P;  1YJN P;  4GR6 A;  1M1K Q;  5HGN A;  3DPH A;  3G6E P;  3G1I A;  1RO0 A;  1K9M Q;  5DCK A;  1VQM P;  3CCS P;  1PEU A;  4PH0 A;  1VQ7 P;  1VQP P;  2KOD A;  1VQ8 P;  1A8O A;  3CCQ P;  1YIJ P;  1ZMB A;  1IUQ A;  1E6J P;  2PEJ A;  1K73 Q;  3CD6 P;  1K30 A;  1PEM A;  4WYM A;  2M8L A;  3CPW O;  4U0B A;  1KD1 Q;  1KC8 Q;  1Q86 Q;  2JO0 A;  2OAR A;  2JYL A;  2LF4 A;  5BS1 A;  4COC A;  3G4S P;  1VQO P;  2BUO A;  5HGO A;  3P05 A;  3I56 P;  2QA4 P;  2PEM A;  2PEQ A;  5F2K A;  4M0I A;  2BHV A;  3CXC O;  1JJ2 O;  3H47 A;  2M8N A;  4XFX A;  3CCM P;  3DS3 A;  1KQS O;  1VQK P;  2PEK A;  4U0A A;  4XFZ A;  3HYB A;  3G28 A;  5JPA A;  2QEX P;  1EIA A;  2EIA A;  3RG6 C;  1VQ9 P;  1EOQ A;  3G0V A;  1YI2 P;  2XV6 A;  1YJ9 P;  1D1D A;  2L6E A;  3DS4 A;  3CMA P;  1VQN P;  1RO2 A;  5I4T G;  3E2D A;  4XRO A;  5HGL A;  2EFJ A;  3MGE A;  2CWO A;  3CCU P;  4U0F A;  4U0C A;  1NJI Q;  2Z46 A;  1YHQ P;  3CC2 P;  1YJW P;  5HGM A;  2E1M A;  3H4E A;  2XXM A;  1S72 P;  3CCR P;  2PY8 A;  1BAJ A;  3G26 A;  3CCJ P;  1N8R Q;  4U0D A;  2OTJ P;  4COP A;  3I55 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...