1VQ9P

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 53
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vq9P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vq9P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vq9P02
3CCLP 1Q7YQ 1VQ5P 3G71P 3CCSP 1VQ9P 2OTLP 1KC8Q 1VQNP 3CD6P 1Q81Q 1YI2P 1YJ9P 1S72P 1YIJP 3CCQP 1VQPP 3G6EP 3CCUP 1M90Q 1YJWP 1YITP 1VQKP 3CMEP 1YHQP 3CMAP 1W2BO 1KQSO 1QVFO 1K9MQ 1VQ7P 1NJIQ 1K8AQ 1QVGO 3CCVP 1YJNP 3OW2O 1K73Q 1KD1Q 2QEXP 3CCEP 3CC2P 3CCJP 1JJ2O 3G4SP 1Q86Q 3CPWO 1Q82Q 3CC4P 3CC7P 1VQOP 1VQ8P 1VQ4P 1VQLP 2OTJP 3CCRP 1VQMP 1N8RQ 3CXCO 1M1KQ 2QA4P 3CCMP 3I56P 1VQ6P 3I55P
chains in the Genus database with same CATH superfamily
3AE5C 2UWJE 5E79E 1NAYA 2C0WA 3Q20A 4Y28J 1KYOD 1EIAA 2CPBA 3Q5SA 2E75C 3H1KE 1H8AA 1FZBA 1OMIA 1H88A 1G1JA 1L0LE 1U7MA 3CL3D 4UB6H 5KLIB 4CPGA 1RO0A 1G2CA 1KZUB 3M91A 1OW6A 3L73D 1M6EX 3Q5RA 3L37A 2KOQA 4NPEA 1SQQJ 3G1IA 4GODA 3L72E 1M1JC 1KFNA 3VYIA 2PEKA 3G1GA 4AQRD 5AVUB 3L73G 2BCCJ 2M0BA 2BASA 3L4FA 3W68A 2FKWB 1JEKA 5APXA 2I1JA 4OVNF 1IZNB 1YQ3C 2FACA 1J1EB 4COPA 3TGUE 1RY3A 3VTPC 3BRVB 1NYHA 3P8MC 4HH2A 2N6ZA 2XT1A 2LF4A 3PHLA 1GPJA 1AYIA 4ASWA 2ITAA 1K8AQ 5B66H 3RK2D 2WPRA 2E76C 2YMYA 3KYQA 3KXDA 1J2JB 4IFMA 3CXHI 1PGQA 3R2PA 4BRYA 2KYVA 2N1TB 4Y99C 2EFJA 3B8EB 1HF9A 2HPCB 1KTMA 1AJYA 1PV3A 2JAZA 5DJTB 2B88A 1NJIQ 4PXHB 2R5BA 5KJ7A 2P9XA 2P2UA 1HGVA 2ZT9B 3NY7B 1NTKK 2VLNA 1JNMA 1KILE 1ZV8A 5H2FH 4KHXA 4N78E 1EDLA 2QG4A 1USDA 1AVOA 3PP5A 1G1IA 1IUQA 4I7ZB 3A0BH 2PEJA 3HYBA 4WVZA 3SWKA 2GYKA 1NTKD 2POHA 3TNUA 1DNYA 2LL8A 3GG2A 4YTPC 3ZDMA 1PGOA 4WY4C 2WSFH 1T8KA 5APWA 3MUDC 2AXTE 1HBWA 1VQKP 3HUSA 2OYHC 4D6TJ 1NTKG 4OGQD 2OQQA 4LGDE 2P7JA 3KZIE 3CX5E 1DIPA 1LTJA 3VMZA 2JEEA 1A43A 1URQC 1KYOH 4N6JA 4DT0A 2JJLA 1L0LK 2WITA 3FX0A 3NTNA 2YIUC 4XA4A 2K88A 1EDJA 1HQBA 2N9YB 2EHTA 3USSA 4D6TD 1MFZA 1S2EA 1OFCX 1Z6MA 4U0AA 2BHVA 1IFDA 3L72J 1WT6A 4U0DA 1NVOA 3CXCO 1SLQA 2IBZI 1E79H 4U3FE 4D6TG 4EYYQ 1JY2N 2N5HA 5F2OA 2W90A 1OWAA 3HE4A 1DD4A 2O01J 2C9NY 4IFFA 4IZ6A 2E74D 2KGAA 3L72D 2IZ0A 2XNDH 4DOJA 4H44D 2PAJA 1SQPJ 2LR2A 3JCUH 1EXIA 2YNYA 3OJAB 3MHVA 2KZJA 3LW5J 5AVSB 4LLHA 3CWBE 1QVGO 2WPSA 3L72G 4GDOA 1QGKB 4YXWH 4BPGA 3EJBA 5HGMA 4XFJA 1FR2A 1W5CE 2Q9IA 3N4XA 3VP8A 2N1TD 3II6A 3HD7A 3TGUD 2KLUA 2K9YA 1EZVI 3BATA 2GDXA 2ZXXA 2WPTA 2EHSA 1FBMA 4WY4A 3HE5A 4HYTB 2L5GB 3K5BA 1P84I 1KMIZ 1N73A 5CCHC 3TGUG 3SWYA 1Y8AA 3DS4A 1QL1A 1R5LA 1LT1A 1URQA 2L4BA 2K93A 4TT3H 2B87B 5AW6B 3AECC 2JQ4A 5APTA 1NTMJ 2V7QJ 1NH4A 3V2PA 5AVZB 1CEIA 2FBWC 4L75A 1ZRTD 1PZQA 3MP7B 1A02J 3GLMA 4PV1B 1KILD 4H0LB 2FAEA 4N78D 2GZGA 1SFCB 1LP1B 1NTMD 3V5BA 1PPJD 1RHZB 2QE7H 5GTHH 2PEOA 2K5XA 1X22A 2JGPA 1NAFA 1IFJA 2FFDA 4R4LA 3TDKA 2BEZF 4IL6E 3A0HE 2FQ2A 1LWUC 2EG5A 3L75J 3AE4C 4WB4A 1NTMG 1PPJG 4EOTA 3MTUE 5KAFE 2KWLA 2JB0A 2FYNC 1E5WA 2MY5A 3HD7D 4AUWA 1QEXA 2QJKB 1L4AB 3M9HA 4ZKPA 3CX5D 1IK9A 3V2QA 1CI6B 3H1IE 1IJDB 1RE4C 1K9MQ 3DS5A 4WYMA 1SS1A 1AA0A 2XXMA 4WWIA 2AVAA 3GHGC 1H0TA 5AW0B 2KR5A 5CCGC 2NPSB 2QJPB 1M7LA 3L74E 4U0BA 2A06E 3GF7A 1PGPA 2K3RA 4HB1A 2YMKA 1AQ5A 2K0XA 3DTJA 5KKZC 4UB8E 1GK6A 4U0CA 3H1HE 1WMKA 5CJ0A 3B5IA 2LOLA 2M5RA 2ZJSE 3NMDA 2B89A 3LIDA 4IPYA 3P7KA 2LXBA 3G71P 1KQGB 2J5UA 3CWBJ 1BSNA 1Y9BA 1KC8Q 2O01H 1YJ9P 1GL2B 1GU4A 1MZ8A 1LT9C 1PFIA 1JCDA 3RG6C 2C9LY 1N7SB 2K0DX 3G3ZA 4PWVB 3AEAC 3GW6A 3RK2C 5APVA 1NWQA 2YO3A 3CWBD 2AEJA 3LW5H 3CCSP 3VMXA 2XZRA 1KB9E 2GZFA 2Y0CA 5CMZA 2GDYA 1IFMA 2QSIA 5KLVJ 5EJDA 1OW8A 3CC2P 3CPWO 3CWBG 4EIJA 4DJGA 2BUOA 1GD2E 3H32A 1GZLA 2KLVA 1S3JA 1KLPA 4ZNCA 1DV5A 2KNCB 5HGOA 4XFXA 4PV1D 1PEOA 2LTEA 1QX8A 2N6YA 1SFCD 1FDMA 2FVFA 1FZAA 2FXOA 3B5NB 5KAIH 1S9KD 2A45G 1JM0A 4HKGA 1KYOI 5KLVG 1YTZI 2KGCA 1FZCB 2LMLA 1EMVA 1BCCE 1BSHA 1J1DC 2V7QH 3G21A 2WSFJ 2PRRA 1ZLLA 1JUNA 4OGQC 4C7RA 2LIWA 2L22A 3V4QA 4GR2A 1RH5B 2O01N 1JY3P 2O3JA 4XFYA 3AEEC 3A2AA 2FQ0A 3CXHE 4DCKA 1FOSF 3MGNA 2M8LA 2AXTH 3Q3DA 5M1BA 5AW4B 2PY8A 2WT7A 4H2WC 2QEXP 2VLOA 2FXPA 4JQ0D 1YTZT 2HG5D 2D2CB 3MIWA 3L70E 3V4WA 5KJ7C 1W2BO 3P05A 3AEBC 1X8YA 2N9BA 5BS1A 2L0QA 1S5LE 3VRLC 3RGUA 1M74A 1VQ8P 3H6PA 3L74J 3CCRP 3RBZA 1M1KQ 5AW3B 4H13B 4H44C 3AEFC 3RBXA 1W2EA 3FXDA 2RKLA 2HODA 2LKMA 3BCCE 1FDIA 1DEBA 2KS1B 5GTIE 3CMEP 1GL2D 3F89A 4UHPB 3WUVA 4NPDA 1N7SD 2R3CA 2K2QA 5C39A 4H2XC 3L74D 2A06D 2KG8A 1LTTC 4XROA 4DG9A 3U1AA 2JO1A 1JMBA 1N2DC 5BVZA 1FOSE 3HUSC 2G8YA 2LPKA 3B4QA 3EFGA 2JU1A 3L74G 2A06G 1BGYE 2WQYC 3PRJA 1LTJC 4GIFA 2IYPA 2AF8A 5B5EH 4RESB 1S1CX 4GOFA 4RJTA 3WUTA 1D7MA 1ZOYC 4CA3A 2E75B 3CD6P 3KDPB 3G0VA 4YXDC 1FJPA 4PH1A 1KB9D 2NO8A 3H1LE 1SQVK 2SPZA 1BE3E 2A45H 4DZOA 2I8DA 2PENA 3H4EA 1Q7YQ 5BU5A 2GUVA 2KSJA 2WSSH 1M1JB 4W80A 3D71A 1ZP0C 1PP9J 5AW1B 5AVRB 1NTZE 4KT0J 1KILC 1SQXE 1LTBC 3WBHA 2Y9YA 1GMJA 1NO4A 1NTKJ 4BPHA 1BCCJ 3N7NA 3GZMA 3DS0A 4BWNA 1PP9D 3ITKA 1OIPA 1LTJB 1FJKA 2XU6A 3T97A 1RF0A 5AVWB 4I2LC 3HD7C 1BCCD 1SQBE 2BEQD 2OYIA 2NZ2A 1FDOA 1S4XA 1PP9G 2VRSA 2D2CD 2N1TA 2L6EA 3CE7A 4PJ0E 3QH9A 4IL6H 2E76B 3A0HH 1N73C 2W8ZA 1NU1E 1BCCG 3C9IA 1L0NK 4GT1A 1ZNVA 4Y99B 2AXCA 2MVVA 3H1KJ 3AE8C 3S9OA 3B71A 2VLPA 1E6JP 5F2NA 1JY3O 1VF5C 2ZVNB 4C7NB 1X3OA 1Q81Q 5AVYB 1YI2P 1L0LJ 1QRJA 2MJZA 3RL0C 4QMAA 2CK3H 4GR6A 2AEMA 2GA1A 4EI2A 2JBGA 2IFNA 2YKQA 3MGEA 1GW4A 3H1KD 2FYZA 2P67A 1OVUA 5TISH 2FQ1A 2DNWA 1ACPA 2JYGA 1L0LD 3HZQA 4R0MA 5AVTB 3VMYA 1OW7A 3CCQP 4UB6E 1OZHA 1RNIA 1DX7A 2FY8A 1LTAC 5BS2A 4W7YA 2BQ1E 2XNXA 1KD1Q 3H1KG 1KILA 3BCCD 2RMZA 2Z46A 4C46A 2W6AA 4UB8H 3FGAD 3CLQA 2P1JA 2FFDC 1L0LG 4I1LA 4WY4B 2QNWA 3I56P 1PEMA 2H43A 3TGUJ 3RL0g 4BPFA 1VDFA 1CZQA 3WU2H 1UJZA 1A8OA 2KOPA 1BGYJ 3D70A 2OYHB 2QIWA 2WPVB 3BCCG 3EFFK 2JWAA 3OW2O 3SFDC 3MZWB 2KOGA 3E2DA 2KP8A 2Y0DA 2L9FA 5EFWB 1URQB 1VF5B 1SQPK 1XTCC 5F2KA 1VQ5P 1CW5A 2YIUB 3M06A 1LTIC 2K37A 1BGYD 2YKPA 1RQVA 2RN0A 3A7OA 2GDWA 1ZMEC 2WVRA 1BE3J 1KB9H 1KORA 1NKNA 2QJYC 1AUMA 1JY2P 2XZ0D 4PD4E 3EWKA 1AQTA 2GZIA 2ZT9D 2KG9A 1NKZB 4IL6X 4Z1MH 1BGYG 3RK3C 1LGHB 1NTZK 5CBOA 5APYA 1SQXK 4NPFX 1Y47A 5B66E 3H1LD 2PEQA 2HLOA 1IFNA 1M90Q 1BE3D 3CCUP 2PP6A 3O8ZA 5KP6B 3V2RA 2KG6A 3D6YA 1OX3A 2P10A 3M0DA 3SSUA 3H1LG 1NTZD 4RKUJ 5CHXA 3CCLP 1SQXD 1BE3G 2Y0EA 2WTYA 1RF1A 2P58A 2C0XA 1SQBK 4ZKUA 1EDKA 1T6AA 2WWWA 3IF4A 3JSVC 2M5AB 2G3AA 3M1MA 1HJBA 2FYUK 1MKMA 3L71E 1GDTA 2K0YA 1FS0E 1SQXG 1ZMBA 5BU8B 3LRYA 1NU1K 4GKGA 3A0BE 1X9VA 1HGZA 2W6JH 2R5DA 3M9BA 2B9BA 3CCVP 5AVQB 1EC5A 1HWTC 2WZ7A 5AW7B 1VKUA 2B87A 4JF7A 2PGDA 5AVXB 4K3AA 1NU1D 1USEA 4WBAA 1YJWP 2K94A 1LTSC 4JPZB 5E79H 3L36A 1GK4A 2Z45A 2Z5IA 3VP9A 1KYOE 4U3FJ 1SFCA 1S5LH 3IFMA 1NU1G 2OGUA 2ZYDA 2ZXEB 1Z56A 1CSBA 3OA7A 2M8PA 2IPPA 3L73E 2CG5B 4U0EA 1FAVA 3O6QB 4M3LA 3G9RA 3Q5PA 2MR7A 4U3FD 1F80D 1JTHB 1VQLP 2OTJP 2W27A 2A45I 2WPQA 2ZVOB 3I5CA 3AE1C 1LWUB 5I4TG 4L74A 1L4AA 1HVVA 2LIUA 2K92A 1YHQP 4U3FG 3KHUA 7CEIA 1SQQE 2FYNB 2KI7B 1JO5A 1ZR2A 1OVVA 2E1MA 1KFMA 2Q1KA 3JCUE 2LXCB 3DS2A 3TK1A 1VQMP 5L8RJ 2QM7A 4JYBA 5HVCA 3JC22 2BCCE 1IMPA 4LC1A 4XRQA 1L0IA 2Q3EA 2K9JB 1PIXA 2VLQA 2Q7CA 3AE6C 3GHGB 3E1IA 4PD4D 1RE3A 1SQVE 1U7JA 1FE6A 3C1LA 1X0TA 3PTZA 5KKZB 1JY2O 3U43A 1YBKA 3E1RA 3FWLA 4H0LD 3EJEA 4A7PA 2YKOA 1GL2A 3GF3A 1IMQA 1AF8A 3GZLA 1UNKA 1N7SA 2KGDA 4O9BA 2IFMA 1K30A 1S5LX 1LT9B 2WT7B 2OTKE 3L71J 1IC2A 3RK2B 1M6NA 2CWOA 2FVAA 5CBNA 2JR8A 5KLIC 3DS3A 1NHLA 2LKIA 1L4AD 2YXRB 2Z5HA 1KN7A 3VN0A 3L71D 3A3YB 4W7ZA 3AE7C 4L76A 1G2CB 4H2YC 4MN4C 2GUSA 2H89C 3W67A 1X79B 2J59M 3AE2C 3H1IJ 3KZIH 5APUA 1VQ6P 3CX5H 2NPSD 3L71G 2E5TA 1DH3A 3TF5A 1L0NE 4ASVA 1PEQA 4PH0A 4IFDK 2JYLA 1HJ0A 2KOOA 5CJ4A 1FZCA 3HTKA 4F37A 2ERHA 4COCA 1FZFA 1R5SA 2VSQA 4M0IA 1QLED 1FC2C 3H1ID 4D6TE 2E74C 4KJMA 2IYOA 5DJUB 3H47A 3H1HJ 2M8RA 1J1DB 2IX7C 1SP4A 2PFXA 1KB9I 4OGQB 2ZFCA 4ZMDA 3H1IG 1RF0C 2ZAEB 1AFOA 1BAJA 1LNQA 4YPCA 2OYIC 2QA4P 3VOPA 3WUUA 2PEIA 1SQQK 2N1TC 3H1HD 2GZJA 3H0DA 5TJHA 3U59A 5KP7B 1FZEA 2XV6A 1VL2A 3IAOA 1GU5A 4BRYB 3CCJP 2K1AA 5KTBA 1LJ2A 5HV8A 5CCGD 2ZT9C 1H89A 2H7HA 3H1HG 1SQQD 5AW8B 5APSA 2KODA 1MV8A 1U57A 2AFEA 1EQ7A 2KB7P 2N98A 2RH0A 1SQPE 2CGQA 2KS1A 2BCCD 2IBZE 3G29A 4I7ZC 3B5ND 2E74B 1Q86Q 2E42A 2JDIH 1SQQG 1SQVJ 1VQ4P 3H1JE 4H44B 4PD4H 1A02F 3T97B 2BCCG 4U7JA 3U1CA 1ZXGA 3AEGC 4L73A 2YXQB 3TNUB 2FHSC 1SQVD 1N86A 2OYIB 3PH0A 2H88C 1FZGA 3HUSB 5KP8B 2MKVA 4I6MC 5KAIE 1KQSO 1SQVG 3EQ2A 4IOIH 2JP3A 1ZRTE 3Q1MA 3LIEA 1EZVE 1JB0J 2XDJA 1MZ9A 3UIAA 1NTME 1PPJE 3AEDC 3P8CE 1IFPA 2FYUE 1P84E 2FXMA 1BDDA 5CZDB 2KXPB 3D6ZA 1OVRA 1M1JA 2HPCA 1KQLA 1T3UA 3IN6A 2HYNA 3QWOC 3F5HA 2M8NA 1VQOP 2W6BA 3L70J 2XKMA 1L0NJ 3CXHD 5KAFH 3FWNA 4H13D 3HE4B 1NQ4A 1EDIA 3L35A 3IR9A 2KZIA 1KILB 1L2PA 3M0AA 2IDBA 2JO0A 3M0DC 3L75E 3L70D 1OXZA 1L0ND 2E5YA 3BCCJ 3CI9A 2R3SA 1IFIA 3NTEA 2CQ8A 4MRTC 1RF1C 1T2KD 5HGNA 3S1KA 3L70G 2WMMA 1L0NG 1JMMA 2HR3A 3G4SP 3HD7B 1Q90D 2Y9ZA 5AVVB 2DGYA 2GZEA 3HE5B 3E7KA 2E75D 2E43A 5KJ7D 4C7NA 3TYYA 4GOEA 2Q6QA 3V6IA 1N73B 4OH8B 3OAKA 1M57D 3BASA 1YQ4C 1ZN5A 2JWDA 3S4RA 3HRNA 3RL0B 1BXIA 3H1LJ 1VHNA 1HH0A 3H1JJ 5B5EE 4PV1C 2KW2A 1ZW0A 3NXSA 4H0LC 1NGMB 5AW9B 1SFCC 2KGEA 1SQPD 1RQUA 2Q3IA 4BXLA 2IBZD 1RF1B 2JKVA 1T8ZA 1NTZJ 2WSEJ 2QM8A 4N3YB 1SQXJ 3GJNA 2M3EA 1VQPP 3H1JD 3MUDA 1L0HA 2WSCJ 3PLNA 1JCCA 3V2NA 1YYCA 1D1DA 2OYHA 1UIXA 1SQPG 2FVEA 1Q82Q 5KLVE 2FFDB 2IBZG 1N8RQ 2NRGA 2QJKC 5K5GB 4EDFA 1L4AC 3CX5I 3H1JG 1S9KE 3RK3E 1YITP 2CPSA 4HJGH 1KQFB 3A5TA 2YO2A 2OYOA 1MFTA 2E76D 1SQBJ 1HY8A 1NTMK 5DCKA 5H2FE 2HFED 1JOCA 2IZ1A 4QKOA 3EJDA 2FYUJ 1NTZG 4NEOA 5EW5E 2ROQA 2OTLP 2KUBA 2NPSC 1KV4A 1EZVD 2QJPC 1NU1J 2M3BA 1DEEG 2QJYB 2PEMA 2DW3A 1SQBD 2O1JA 3G28A 1YJNP 1H0TB 1RO2A 3CCEP 3P8CD 2FYUD 3CXHH 1P84D 2JU2A 2OARA 3RK3B 1E0HA 2MR8A 1EZVG 2N50A 1RE3C 1SQBG 3DPHA 3CMAP 1QVFO 1NOHA 3RG2A 1GL2C 2FYUG 1K73Q 2AFDA 2KOSA 5AW2B 1N7SC 2I1KA 4U0FA 2R44A 2M5AA 1PEUA 1LP1A 3CCMP 1GXHA 1MUUA 1VPCA 3I55P 4WY4D 1VQ9P 3L75D 1GW3A 1IK7A 3LMOA 2KK7A 1EXJA 1VQ7P 4XFZA 5GTIH 5TISE 1LTGC 1JJ2O 5CCHA 2X2BA 1URQD 4XE5B 1VF5D 2KIKA 4PD4I 5AW5B 4AYCA 5HGLA 2ZYAA 3ABVC 3KPEA 3L75G 3R4YA 3RL0D 1GTWA 2GM4A 1CI6A 2ONTA 3CC4P 3B5NC 2MD9A 1DD3A 4TLFA 3WU2E 3H32B 2J58A 2Z4EA 4R4MA 2R32A 2FADA 1EOQA 1OR5A 3C8VA 1XTGB 2QRXA 4HKZH 2NPSA 3GMAA 3M9QA 1FZCC 3BVHA 1HUCA 3AE9C 3FXEA 2XV5A 3O6QA 4QNBA 3MD0A 3BRTB 3NFQA 3CC7P 1PGJA 3AE3C 4RO0A 1JTHA 1Q2NA 3TSIA 5APQA 1WRGA 2MF4A 1S72P 3SWFA 5KLVK 1LWUA 3SFEC 2W83C 1IO4A 1SVFA 2WSEH 1JY3N 2KSEA 1BDCA 2AEFA 3B4SA 2WSCH 3VMAA 1HTLC 3PJSK 2Q5UA 3P32A 1ZR4A 1QL2A 2D2CC 1YIJP 5KLVD 1AV1A 2Z44A 4B86A 2V4HA 1RE4A 2EIAA 4JBZA 1N7LA 1UIIA 5CCHD 2K9JA 3Q2YA 2H8PD 1PP9E 3RK3D 2N5IA 3GHGA 3WMM0 3DS1A 5CCGA 4H13C 1VQNP 3H25A 1NTKE 3HTKB 3GKLC 5JPAA 1R8EA 2QVAA 4OWFA 5GTHE 1P84H 1T3JA 2KNCA 1AVYA 1K05A 4JYCA 4PJ0H 2XZ1C 1GXGA 3B5NA 2HODB 1PL5A 3KQGA 2MVUA 1FU1A 3G6EP 1K04A 1T2KC 1J1EC 2L91A 2PNGA 1LT9A 1TU3F 1M56D 2CNRA 2ZYGA 1M8OB 4K35A 3G26A 2KORA 3L73J 2O1KA
chains in the Genus database with same CATH topology
2EFJA 5F2NA 1E6JP 3G71P 3Q20A 2PEQA 1KC8Q 3CD6P 4XFYA 1Q81Q 1K30A 1YI2P 1YJ9P 1S72P 5F2OA 1EIAA 1QRJA 3H0DA 1M90Q 2M8PA 3G0VA 3CCUP 3DPHA 4U0EA 3CMAP 1QVFO 1NJIQ 2P9XA 2XV6A 2M8LA 3RG6C 4PH1A 1M6NA 2CWOA 4GR6A 2PY8A 1K73Q 2QEXP 3CCJP 3MGEA 1RO0A 2M8NA 4U0FA 3DS3A 1VQOP 2PEOA 1VQLP 2OTJP 1PEUA 1M6EX 2PENA 3H4EA 3CCMP 3I55P 3CCLP 1Q7YQ 1VQ9P 2KODA 3CCSP 2JYGA 3HZQA 5I4TG 3G1IA 1YIJP 3CCQP 1VQPP 2EG5A 2Z44A 1YHQP 1RNIA 1W2BO 1VQ7P 2EIAA 3P05A 5BS2A 1D1DA 2PEKA 1QVGO 1IUQA 2BQ1E 3G1GA 2JO0A 4XFZA 5BS1A 3VRLC 3WBHA 2PEJA 3HYBA 3G29A 1KD1Q 3CC2P 5HGMA 3M1MA 2E1MA 1Q86Q 1JJ2O 2Z46A 1M74A 3CPWO 1Q82Q 1VQ8P 1VQ4P 3DS2A 3CCRP 1ZMBA 1VQMP 1N8RQ 1M1KQ 5HGLA 3DS1A 2BUOA 3I56P 1VQ6P 1PEMA 4XRQA 3LRYA 1VQNP 3NTEA 1A8OA 3DS0A 1VQKP 1YITP 5HGOA 3CMEP 4PH0A 5JPAA 2JYLA 5HGNA 1PEQA 4XFXA 4COPA 1PEOA 1K9MQ 3DS5A 4WYMA 3CCVP 3OW2O 3E2DA 4COCA 5DCKA 3G4SP 2XXMA 2ONTA 3CC4P 4M0IA 4XROA 1A43A 5F2KA 3DS4A 2DGYA 2XT1A 2OTLP 2LF4A 1VQ5P 1EOQA 3H47A 2L6EA 4U0BA 3G6EP 1YJWP 2PEMA 1KQSO 3G28A 1AUMA 3DTJA 1K8AQ 3G21A 1YJNP 2Z45A 1RO2A 4U0CA 4QNBA 4U0AA 3CCEP 3B5IA 2BHVA 1BAJA 2OARA 3CC7P 4GR2A 4U0DA 4IPYA 3G26A 3CXCO 2QA4P 2PEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  1Q7Y Q;  1VQ5 P;  3G71 P;  3CCS P;  1VQ9 P;  2OTL P;  1KC8 Q;  1VQN P;  3CD6 P;  1Q81 Q;  1YI2 P;  1YJ9 P;  1S72 P;  1YIJ P;  3CCQ P;  1VQP P;  3G6E P;  3CCU P;  1M90 Q;  1YJW P;  1YIT P;  1VQK P;  3CME P;  1YHQ P;  3CMA P;  1W2B O;  1KQS O;  1QVF O;  1K9M Q;  1VQ7 P;  1NJI Q;  1K8A Q;  1QVG O;  3CCV P;  1YJN P;  3OW2 O;  1K73 Q;  1KD1 Q;  2QEX P;  3CCE P;  3CC2 P;  3CCJ P;  1JJ2 O;  3G4S P;  1Q86 Q;  3CPW O;  1Q82 Q;  3CC4 P;  3CC7 P;  1VQO P;  1VQ8 P;  1VQ4 P;  1VQL P;  2OTJ P;  3CCR P;  1VQM P;  1N8R Q;  3CXC O;  1M1K Q;  2QA4 P;  3CCM P;  3I56 P;  1VQ6 P;  3I55 P; 
#chains in the Genus database with same CATH topology
 3AE5 C;  2UWJ E;  5E79 E;  1NAY A;  2C0W A;  3Q20 A;  4Y28 J;  1KYO D;  1EIA A;  2CPB A;  3Q5S A;  2E75 C;  3H1K E;  1H8A A;  1FZB A;  1OMI A;  1H88 A;  1G1J A;  1L0L E;  1U7M A;  3CL3 D;  4UB6 H;  5KLI B;  4CPG A;  1RO0 A;  1G2C A;  1KZU B;  3M91 A;  1OW6 A;  3L73 D;  1M6E X;  3Q5R A;  3L37 A;  2KOQ A;  4NPE A;  1SQQ J;  3G1I A;  4GOD A;  3L72 E;  1M1J C;  1KFN A;  3VYI A;  2PEK A;  3G1G A;  4AQR D;  5AVU B;  3L73 G;  2BCC J;  2M0B A;  2BAS A;  3L4F A;  3W68 A;  2FKW B;  1JEK A;  5APX A;  2I1J A;  4OVN F;  1IZN B;  1YQ3 C;  2FAC A;  1J1E B;  4COP A;  3TGU E;  1RY3 A;  3VTP C;  3BRV B;  1NYH A;  3P8M C;  4HH2 A;  2N6Z A;  2XT1 A;  2LF4 A;  3PHL A;  1GPJ A;  1AYI A;  4ASW A;  2ITA A;  1K8A Q;  5B66 H;  3RK2 D;  2WPR A;  2E76 C;  2YMY A;  3KYQ A;  3KXD A;  1J2J B;  4IFM A;  3CXH I;  1PGQ A;  3R2P A;  4BRY A;  2KYV A;  2N1T B;  4Y99 C;  2EFJ A;  3B8E B;  1HF9 A;  2HPC B;  1KTM A;  1AJY A;  1PV3 A;  2JAZ A;  5DJT B;  2B88 A;  1NJI Q;  4PXH B;  2R5B A;  5KJ7 A;  2P9X A;  2P2U A;  1HGV A;  2ZT9 B;  3NY7 B;  1NTK K;  2VLN A;  1JNM A;  1KIL E;  1ZV8 A;  5H2F H;  4KHX A;  4N78 E;  1EDL A;  2QG4 A;  1USD A;  1AVO A;  3PP5 A;  1G1I A;  1IUQ A;  4I7Z B;  3A0B H;  2PEJ A;  3HYB A;  4WVZ A;  3SWK A;  2GYK A;  1NTK D;  2POH A;  3TNU A;  1DNY A;  2LL8 A;  3GG2 A;  4YTP C;  3ZDM A;  1PGO A;  4WY4 C;  2WSF H;  1T8K A;  5APW A;  3MUD C;  2AXT E;  1HBW A;  1VQK P;  3HUS A;  2OYH C;  4D6T J;  1NTK G;  4OGQ D;  2OQQ A;  4LGD E;  2P7J A;  3KZI E;  3CX5 E;  1DIP A;  1LTJ A;  3VMZ A;  2JEE A;  1A43 A;  1URQ C;  1KYO H;  4N6J A;  4DT0 A;  2JJL A;  1L0L K;  2WIT A;  3FX0 A;  3NTN A;  2YIU C;  4XA4 A;  2K88 A;  1EDJ A;  1HQB A;  2N9Y B;  2EHT A;  3USS A;  4D6T D;  1MFZ A;  1S2E A;  1OFC X;  1Z6M A;  4U0A A;  2BHV A;  1IFD A;  3L72 J;  1WT6 A;  4U0D A;  1NVO A;  3CXC O;  1SLQ A;  2IBZ I;  1E79 H;  4U3F E;  4D6T G;  4EYY Q;  1JY2 N;  2N5H A;  5F2O A;  2W90 A;  1OWA A;  3HE4 A;  1DD4 A;  2O01 J;  2C9N Y;  4IFF A;  4IZ6 A;  2E74 D;  2KGA A;  3L72 D;  2IZ0 A;  2XND H;  4DOJ A;  4H44 D;  2PAJ A;  1SQP J;  2LR2 A;  3JCU H;  1EXI A;  2YNY A;  3OJA B;  3MHV A;  2KZJ A;  3LW5 J;  5AVS B;  4LLH A;  3CWB E;  1QVG O;  2WPS A;  3L72 G;  4GDO A;  1QGK B;  4YXW H;  4BPG A;  3EJB A;  5HGM A;  4XFJ A;  1FR2 A;  1W5C E;  2Q9I A;  3N4X A;  3VP8 A;  2N1T D;  3II6 A;  3HD7 A;  3TGU D;  2KLU A;  2K9Y A;  1EZV I;  3BAT A;  2GDX A;  2ZXX A;  2WPT A;  2EHS A;  1FBM A;  4WY4 A;  3HE5 A;  4HYT B;  2L5G B;  3K5B A;  1P84 I;  1KMI Z;  1N73 A;  5CCH C;  3TGU G;  3SWY A;  1Y8A A;  3DS4 A;  1QL1 A;  1R5L A;  1LT1 A;  1URQ A;  2L4B A;  2K93 A;  4TT3 H;  2B87 B;  5AW6 B;  3AEC C;  2JQ4 A;  5APT A;  1NTM J;  2V7Q J;  1NH4 A;  3V2P A;  5AVZ B;  1CEI A;  2FBW C;  4L75 A;  1ZRT D;  1PZQ A;  3MP7 B;  1A02 J;  3GLM A;  4PV1 B;  1KIL D;  4H0L B;  2FAE A;  4N78 D;  2GZG A;  1SFC B;  1LP1 B;  1NTM D;  3V5B A;  1PPJ D;  1RHZ B;  2QE7 H;  5GTH H;  2PEO A;  2K5X A;  1X22 A;  2JGP A;  1NAF A;  1IFJ A;  2FFD A;  4R4L A;  3TDK A;  2BEZ F;  4IL6 E;  3A0H E;  2FQ2 A;  1LWU C;  2EG5 A;  3L75 J;  3AE4 C;  4WB4 A;  1NTM G;  1PPJ G;  4EOT A;  3MTU E;  5KAF E;  2KWL A;  2JB0 A;  2FYN C;  1E5W A;  2MY5 A;  3HD7 D;  4AUW A;  1QEX A;  2QJK B;  1L4A B;  3M9H A;  4ZKP A;  3CX5 D;  1IK9 A;  3V2Q A;  1CI6 B;  3H1I E;  1IJD B;  1RE4 C;  1K9M Q;  3DS5 A;  4WYM A;  1SS1 A;  1AA0 A;  2XXM A;  4WWI A;  2AVA A;  3GHG C;  1H0T A;  5AW0 B;  2KR5 A;  5CCG C;  2NPS B;  2QJP B;  1M7L A;  3L74 E;  4U0B A;  2A06 E;  3GF7 A;  1PGP A;  2K3R A;  4HB1 A;  2YMK A;  1AQ5 A;  2K0X A;  3DTJ A;  5KKZ C;  4UB8 E;  1GK6 A;  4U0C A;  3H1H E;  1WMK A;  5CJ0 A;  3B5I A;  2LOL A;  2M5R A;  2ZJS E;  3NMD A;  2B89 A;  3LID A;  4IPY A;  3P7K A;  2LXB A;  3G71 P;  1KQG B;  2J5U A;  3CWB J;  1BSN A;  1Y9B A;  1KC8 Q;  2O01 H;  1YJ9 P;  1GL2 B;  1GU4 A;  1MZ8 A;  1LT9 C;  1PFI A;  1JCD A;  3RG6 C;  2C9L Y;  1N7S B;  2K0D X;  3G3Z A;  4PWV B;  3AEA C;  3GW6 A;  3RK2 C;  5APV A;  1NWQ A;  2YO3 A;  3CWB D;  2AEJ A;  3LW5 H;  3CCS P;  3VMX A;  2XZR A;  1KB9 E;  2GZF A;  2Y0C A;  5CMZ A;  2GDY A;  1IFM A;  2QSI A;  5KLV J;  5EJD A;  1OW8 A;  3CC2 P;  3CPW O;  3CWB G;  4EIJ A;  4DJG A;  2BUO A;  1GD2 E;  3H32 A;  1GZL A;  2KLV A;  1S3J A;  1KLP A;  4ZNC A;  1DV5 A;  2KNC B;  5HGO A;  4XFX A;  4PV1 D;  1PEO A;  2LTE A;  1QX8 A;  2N6Y A;  1SFC D;  1FDM A;  2FVF A;  1FZA A;  2FXO A;  3B5N B;  5KAI H;  1S9K D;  2A45 G;  1JM0 A;  4HKG A;  1KYO I;  5KLV G;  1YTZ I;  2KGC A;  1FZC B;  2LML A;  1EMV A;  1BCC E;  1BSH A;  1J1D C;  2V7Q H;  3G21 A;  2WSF J;  2PRR A;  1ZLL A;  1JUN A;  4OGQ C;  4C7R A;  2LIW A;  2L22 A;  3V4Q A;  4GR2 A;  1RH5 B;  2O01 N;  1JY3 P;  2O3J A;  4XFY A;  3AEE C;  3A2A A;  2FQ0 A;  3CXH E;  4DCK A;  1FOS F;  3MGN A;  2M8L A;  2AXT H;  3Q3D A;  5M1B A;  5AW4 B;  2PY8 A;  2WT7 A;  4H2W C;  2QEX P;  2VLO A;  2FXP A;  4JQ0 D;  1YTZ T;  2HG5 D;  2D2C B;  3MIW A;  3L70 E;  3V4W A;  5KJ7 C;  1W2B O;  3P05 A;  3AEB C;  1X8Y A;  2N9B A;  5BS1 A;  2L0Q A;  1S5L E;  3VRL C;  3RGU A;  1M74 A;  1VQ8 P;  3H6P A;  3L74 J;  3CCR P;  3RBZ A;  1M1K Q;  5AW3 B;  4H13 B;  4H44 C;  3AEF C;  3RBX A;  1W2E A;  3FXD A;  2RKL A;  2HOD A;  2LKM A;  3BCC E;  1FDI A;  1DEB A;  2KS1 B;  5GTI E;  3CME P;  1GL2 D;  3F89 A;  4UHP B;  3WUV A;  4NPD A;  1N7S D;  2R3C A;  2K2Q A;  5C39 A;  4H2X C;  3L74 D;  2A06 D;  2KG8 A;  1LTT C;  4XRO A;  4DG9 A;  3U1A A;  2JO1 A;  1JMB A;  1N2D C;  5BVZ A;  1FOS E;  3HUS C;  2G8Y A;  2LPK A;  3B4Q A;  3EFG A;  2JU1 A;  3L74 G;  2A06 G;  1BGY E;  2WQY C;  3PRJ A;  1LTJ C;  4GIF A;  2IYP A;  2AF8 A;  5B5E H;  4RES B;  1S1C X;  4GOF A;  4RJT A;  3WUT A;  1D7M A;  1ZOY C;  4CA3 A;  2E75 B;  3CD6 P;  3KDP B;  3G0V A;  4YXD C;  1FJP A;  4PH1 A;  1KB9 D;  2NO8 A;  3H1L E;  1SQV K;  2SPZ A;  1BE3 E;  2A45 H;  4DZO A;  2I8D A;  2PEN A;  3H4E A;  1Q7Y Q;  5BU5 A;  2GUV A;  2KSJ A;  2WSS H;  1M1J B;  4W80 A;  3D71 A;  1ZP0 C;  1PP9 J;  5AW1 B;  5AVR B;  1NTZ E;  4KT0 J;  1KIL C;  1SQX E;  1LTB C;  3WBH A;  2Y9Y A;  1GMJ A;  1NO4 A;  1NTK J;  4BPH A;  1BCC J;  3N7N A;  3GZM A;  3DS0 A;  4BWN A;  1PP9 D;  3ITK A;  1OIP A;  1LTJ B;  1FJK A;  2XU6 A;  3T97 A;  1RF0 A;  5AVW B;  4I2L C;  3HD7 C;  1BCC D;  1SQB E;  2BEQ D;  2OYI A;  2NZ2 A;  1FDO A;  1S4X A;  1PP9 G;  2VRS A;  2D2C D;  2N1T A;  2L6E A;  3CE7 A;  4PJ0 E;  3QH9 A;  4IL6 H;  2E76 B;  3A0H H;  1N73 C;  2W8Z A;  1NU1 E;  1BCC G;  3C9I A;  1L0N K;  4GT1 A;  1ZNV A;  4Y99 B;  2AXC A;  2MVV A;  3H1K J;  3AE8 C;  3S9O A;  3B71 A;  2VLP A;  1E6J P;  5F2N A;  1JY3 O;  1VF5 C;  2ZVN B;  4C7N B;  1X3O A;  1Q81 Q;  5AVY B;  1YI2 P;  1L0L J;  1QRJ A;  2MJZ A;  3RL0 C;  4QMA A;  2CK3 H;  4GR6 A;  2AEM A;  2GA1 A;  4EI2 A;  2JBG A;  2IFN A;  2YKQ A;  3MGE A;  1GW4 A;  3H1K D;  2FYZ A;  2P67 A;  1OVU A;  5TIS H;  2FQ1 A;  2DNW A;  1ACP A;  2JYG A;  1L0L D;  3HZQ A;  4R0M A;  5AVT B;  3VMY A;  1OW7 A;  3CCQ P;  4UB6 E;  1OZH A;  1RNI A;  1DX7 A;  2FY8 A;  1LTA C;  5BS2 A;  4W7Y A;  2BQ1 E;  2XNX A;  1KD1 Q;  3H1K G;  1KIL A;  3BCC D;  2RMZ A;  2Z46 A;  4C46 A;  2W6A A;  4UB8 H;  3FGA D;  3CLQ A;  2P1J A;  2FFD C;  1L0L G;  4I1L A;  4WY4 B;  2QNW A;  3I56 P;  1PEM A;  2H43 A;  3TGU J;  3RL0 g;  4BPF A;  1VDF A;  1CZQ A;  3WU2 H;  1UJZ A;  1A8O A;  2KOP A;  1BGY J;  3D70 A;  2OYH B;  2QIW A;  2WPV B;  3BCC G;  3EFF K;  2JWA A;  3OW2 O;  3SFD C;  3MZW B;  2KOG A;  3E2D A;  2KP8 A;  2Y0D A;  2L9F A;  5EFW B;  1URQ B;  1VF5 B;  1SQP K;  1XTC C;  5F2K A;  1VQ5 P;  1CW5 A;  2YIU B;  3M06 A;  1LTI C;  2K37 A;  1BGY D;  2YKP A;  1RQV A;  2RN0 A;  3A7O A;  2GDW A;  1ZME C;  2WVR A;  1BE3 J;  1KB9 H;  1KOR A;  1NKN A;  2QJY C;  1AUM A;  1JY2 P;  2XZ0 D;  4PD4 E;  3EWK A;  1AQT A;  2GZI A;  2ZT9 D;  2KG9 A;  1NKZ B;  4IL6 X;  4Z1M H;  1BGY G;  3RK3 C;  1LGH B;  1NTZ K;  5CBO A;  5APY A;  1SQX K;  4NPF X;  1Y47 A;  5B66 E;  3H1L D;  2PEQ A;  2HLO A;  1IFN A;  1M90 Q;  1BE3 D;  3CCU P;  2PP6 A;  3O8Z A;  5KP6 B;  3V2R A;  2KG6 A;  3D6Y A;  1OX3 A;  2P10 A;  3M0D A;  3SSU A;  3H1L G;  1NTZ D;  4RKU J;  5CHX A;  3CCL P;  1SQX D;  1BE3 G;  2Y0E A;  2WTY A;  1RF1 A;  2P58 A;  2C0X A;  1SQB K;  4ZKU A;  1EDK A;  1T6A A;  2WWW A;  3IF4 A;  3JSV C;  2M5A B;  2G3A A;  3M1M A;  1HJB A;  2FYU K;  1MKM A;  3L71 E;  1GDT A;  2K0Y A;  1FS0 E;  1SQX G;  1ZMB A;  5BU8 B;  3LRY A;  1NU1 K;  4GKG A;  3A0B E;  1X9V A;  1HGZ A;  2W6J H;  2R5D A;  3M9B A;  2B9B A;  3CCV P;  5AVQ B;  1EC5 A;  1HWT C;  2WZ7 A;  5AW7 B;  1VKU A;  2B87 A;  4JF7 A;  2PGD A;  5AVX B;  4K3A A;  1NU1 D;  1USE A;  4WBA A;  1YJW P;  2K94 A;  1LTS C;  4JPZ B;  5E79 H;  3L36 A;  1GK4 A;  2Z45 A;  2Z5I A;  3VP9 A;  1KYO E;  4U3F J;  1SFC A;  1S5L H;  3IFM A;  1NU1 G;  2OGU A;  2ZYD A;  2ZXE B;  1Z56 A;  1CSB A;  3OA7 A;  2M8P A;  2IPP A;  3L73 E;  2CG5 B;  4U0E A;  1FAV A;  3O6Q B;  4M3L A;  3G9R A;  3Q5P A;  2MR7 A;  4U3F D;  1F80 D;  1JTH B;  1VQL P;  2OTJ P;  2W27 A;  2A45 I;  2WPQ A;  2ZVO B;  3I5C A;  3AE1 C;  1LWU B;  5I4T G;  4L74 A;  1L4A A;  1HVV A;  2LIU A;  2K92 A;  1YHQ P;  4U3F G;  3KHU A;  7CEI A;  1SQQ E;  2FYN B;  2KI7 B;  1JO5 A;  1ZR2 A;  1OVV A;  2E1M A;  1KFM A;  2Q1K A;  3JCU E;  2LXC B;  3DS2 A;  3TK1 A;  1VQM P;  5L8R J;  2QM7 A;  4JYB A;  5HVC A;  3JC2 2;  2BCC E;  1IMP A;  4LC1 A;  4XRQ A;  1L0I A;  2Q3E A;  2K9J B;  1PIX A;  2VLQ A;  2Q7C A;  3AE6 C;  3GHG B;  3E1I A;  4PD4 D;  1RE3 A;  1SQV E;  1U7J A;  1FE6 A;  3C1L A;  1X0T A;  3PTZ A;  5KKZ B;  1JY2 O;  3U43 A;  1YBK A;  3E1R A;  3FWL A;  4H0L D;  3EJE A;  4A7P A;  2YKO A;  1GL2 A;  3GF3 A;  1IMQ A;  1AF8 A;  3GZL A;  1UNK A;  1N7S A;  2KGD A;  4O9B A;  2IFM A;  1K30 A;  1S5L X;  1LT9 B;  2WT7 B;  2OTK E;  3L71 J;  1IC2 A;  3RK2 B;  1M6N A;  2CWO A;  2FVA A;  5CBN A;  2JR8 A;  5KLI C;  3DS3 A;  1NHL A;  2LKI A;  1L4A D;  2YXR B;  2Z5H A;  1KN7 A;  3VN0 A;  3L71 D;  3A3Y B;  4W7Z A;  3AE7 C;  4L76 A;  1G2C B;  4H2Y C;  4MN4 C;  2GUS A;  2H89 C;  3W67 A;  1X79 B;  2J59 M;  3AE2 C;  3H1I J;  3KZI H;  5APU A;  1VQ6 P;  3CX5 H;  2NPS D;  3L71 G;  2E5T A;  1DH3 A;  3TF5 A;  1L0N E;  4ASV A;  1PEQ A;  4PH0 A;  4IFD K;  2JYL A;  1HJ0 A;  2KOO A;  5CJ4 A;  1FZC A;  3HTK A;  4F37 A;  2ERH A;  4COC A;  1FZF A;  1R5S A;  2VSQ A;  4M0I A;  1QLE D;  1FC2 C;  3H1I D;  4D6T E;  2E74 C;  4KJM A;  2IYO A;  5DJU B;  3H47 A;  3H1H J;  2M8R A;  1J1D B;  2IX7 C;  1SP4 A;  2PFX A;  1KB9 I;  4OGQ B;  2ZFC A;  4ZMD A;  3H1I G;  1RF0 C;  2ZAE B;  1AFO A;  1BAJ A;  1LNQ A;  4YPC A;  2OYI C;  2QA4 P;  3VOP A;  3WUU A;  2PEI A;  1SQQ K;  2N1T C;  3H1H D;  2GZJ A;  3H0D A;  5TJH A;  3U59 A;  5KP7 B;  1FZE A;  2XV6 A;  1VL2 A;  3IAO A;  1GU5 A;  4BRY B;  3CCJ P;  2K1A A;  5KTB A;  1LJ2 A;  5HV8 A;  5CCG D;  2ZT9 C;  1H89 A;  2H7H A;  3H1H G;  1SQQ D;  5AW8 B;  5APS A;  2KOD A;  1MV8 A;  1U57 A;  2AFE A;  1EQ7 A;  2KB7 P;  2N98 A;  2RH0 A;  1SQP E;  2CGQ A;  2KS1 A;  2BCC D;  2IBZ E;  3G29 A;  4I7Z C;  3B5N D;  2E74 B;  1Q86 Q;  2E42 A;  2JDI H;  1SQQ G;  1SQV J;  1VQ4 P;  3H1J E;  4H44 B;  4PD4 H;  1A02 F;  3T97 B;  2BCC G;  4U7J A;  3U1C A;  1ZXG A;  3AEG C;  4L73 A;  2YXQ B;  3TNU B;  2FHS C;  1SQV D;  1N86 A;  2OYI B;  3PH0 A;  2H88 C;  1FZG A;  3HUS B;  5KP8 B;  2MKV A;  4I6M C;  5KAI E;  1KQS O;  1SQV G;  3EQ2 A;  4IOI H;  2JP3 A;  1ZRT E;  3Q1M A;  3LIE A;  1EZV E;  1JB0 J;  2XDJ A;  1MZ9 A;  3UIA A;  1NTM E;  1PPJ E;  3AED C;  3P8C E;  1IFP A;  2FYU E;  1P84 E;  2FXM A;  1BDD A;  5CZD B;  2KXP B;  3D6Z A;  1OVR A;  1M1J A;  2HPC A;  1KQL A;  1T3U A;  3IN6 A;  2HYN A;  3QWO C;  3F5H A;  2M8N A;  1VQO P;  2W6B A;  3L70 J;  2XKM A;  1L0N J;  3CXH D;  5KAF H;  3FWN A;  4H13 D;  3HE4 B;  1NQ4 A;  1EDI A;  3L35 A;  3IR9 A;  2KZI A;  1KIL B;  1L2P A;  3M0A A;  2IDB A;  2JO0 A;  3M0D C;  3L75 E;  3L70 D;  1OXZ A;  1L0N D;  2E5Y A;  3BCC J;  3CI9 A;  2R3S A;  1IFI A;  3NTE A;  2CQ8 A;  4MRT C;  1RF1 C;  1T2K D;  5HGN A;  3S1K A;  3L70 G;  2WMM A;  1L0N G;  1JMM A;  2HR3 A;  3G4S P;  3HD7 B;  1Q90 D;  2Y9Z A;  5AVV B;  2DGY A;  2GZE A;  3HE5 B;  3E7K A;  2E75 D;  2E43 A;  5KJ7 D;  4C7N A;  3TYY A;  4GOE A;  2Q6Q A;  3V6I A;  1N73 B;  4OH8 B;  3OAK A;  1M57 D;  3BAS A;  1YQ4 C;  1ZN5 A;  2JWD A;  3S4R A;  3HRN A;  3RL0 B;  1BXI A;  3H1L J;  1VHN A;  1HH0 A;  3H1J J;  5B5E E;  4PV1 C;  2KW2 A;  1ZW0 A;  3NXS A;  4H0L C;  1NGM B;  5AW9 B;  1SFC C;  2KGE A;  1SQP D;  1RQU A;  2Q3I A;  4BXL A;  2IBZ D;  1RF1 B;  2JKV A;  1T8Z A;  1NTZ J;  2WSE J;  2QM8 A;  4N3Y B;  1SQX J;  3GJN A;  2M3E A;  1VQP P;  3H1J D;  3MUD A;  1L0H A;  2WSC J;  3PLN A;  1JCC A;  3V2N A;  1YYC A;  1D1D A;  2OYH A;  1UIX A;  1SQP G;  2FVE A;  1Q82 Q;  5KLV E;  2FFD B;  2IBZ G;  1N8R Q;  2NRG A;  2QJK C;  5K5G B;  4EDF A;  1L4A C;  3CX5 I;  3H1J G;  1S9K E;  3RK3 E;  1YIT P;  2CPS A;  4HJG H;  1KQF B;  3A5T A;  2YO2 A;  2OYO A;  1MFT A;  2E76 D;  1SQB J;  1HY8 A;  1NTM K;  5DCK A;  5H2F E;  2HFE D;  1JOC A;  2IZ1 A;  4QKO A;  3EJD A;  2FYU J;  1NTZ G;  4NEO A;  5EW5 E;  2ROQ A;  2OTL P;  2KUB A;  2NPS C;  1KV4 A;  1EZV D;  2QJP C;  1NU1 J;  2M3B A;  1DEE G;  2QJY B;  2PEM A;  2DW3 A;  1SQB D;  2O1J A;  3G28 A;  1YJN P;  1H0T B;  1RO2 A;  3CCE P;  3P8C D;  2FYU D;  3CXH H;  1P84 D;  2JU2 A;  2OAR A;  3RK3 B;  1E0H A;  2MR8 A;  1EZV G;  2N50 A;  1RE3 C;  1SQB G;  3DPH A;  3CMA P;  1QVF O;  1NOH A;  3RG2 A;  1GL2 C;  2FYU G;  1K73 Q;  2AFD A;  2KOS A;  5AW2 B;  1N7S C;  2I1K A;  4U0F A;  2R44 A;  2M5A A;  1PEU A;  1LP1 A;  3CCM P;  1GXH A;  1MUU A;  1VPC A;  3I55 P;  4WY4 D;  1VQ9 P;  3L75 D;  1GW3 A;  1IK7 A;  3LMO A;  2KK7 A;  1EXJ A;  1VQ7 P;  4XFZ A;  5GTI H;  5TIS E;  1LTG C;  1JJ2 O;  5CCH A;  2X2B A;  1URQ D;  4XE5 B;  1VF5 D;  2KIK A;  4PD4 I;  5AW5 B;  4AYC A;  5HGL A;  2ZYA A;  3ABV C;  3KPE A;  3L75 G;  3R4Y A;  3RL0 D;  1GTW A;  2GM4 A;  1CI6 A;  2ONT A;  3CC4 P;  3B5N C;  2MD9 A;  1DD3 A;  4TLF A;  3WU2 E;  3H32 B;  2J58 A;  2Z4E A;  4R4M A;  2R32 A;  2FAD A;  1EOQ A;  1OR5 A;  3C8V A;  1XTG B;  2QRX A;  4HKZ H;  2NPS A;  3GMA A;  3M9Q A;  1FZC C;  3BVH A;  1HUC A;  3AE9 C;  3FXE A;  2XV5 A;  3O6Q A;  4QNB A;  3MD0 A;  3BRT B;  3NFQ A;  3CC7 P;  1PGJ A;  3AE3 C;  4RO0 A;  1JTH A;  1Q2N A;  3TSI A;  5APQ A;  1WRG A;  2MF4 A;  1S72 P;  3SWF A;  5KLV K;  1LWU A;  3SFE C;  2W83 C;  1IO4 A;  1SVF A;  2WSE H;  1JY3 N;  2KSE A;  1BDC A;  2AEF A;  3B4S A;  2WSC H;  3VMA A;  1HTL C;  3PJS K;  2Q5U A;  3P32 A;  1ZR4 A;  1QL2 A;  2D2C C;  1YIJ P;  5KLV D;  1AV1 A;  2Z44 A;  4B86 A;  2V4H A;  1RE4 A;  2EIA A;  4JBZ A;  1N7L A;  1UII A;  5CCH D;  2K9J A;  3Q2Y A;  2H8P D;  1PP9 E;  3RK3 D;  2N5I A;  3GHG A;  3WMM 0;  3DS1 A;  5CCG A;  4H13 C;  1VQN P;  3H25 A;  1NTK E;  3HTK B;  3GKL C;  5JPA A;  1R8E A;  2QVA A;  4OWF A;  5GTH E;  1P84 H;  1T3J A;  2KNC A;  1AVY A;  1K05 A;  4JYC A;  4PJ0 H;  2XZ1 C;  1GXG A;  3B5N A;  2HOD B;  1PL5 A;  3KQG A;  2MVU A;  1FU1 A;  3G6E P;  1K04 A;  1T2K C;  1J1E C;  2L91 A;  2PNG A;  1LT9 A;  1TU3 F;  1M56 D;  2CNR A;  2ZYG A;  1M8O B;  4K35 A;  3G26 A;  2KOR A;  3L73 J;  2O1K A; 
#chains in the Genus database with same CATH homology
 2EFJ A;  5F2N A;  1E6J P;  3G71 P;  3Q20 A;  2PEQ A;  1KC8 Q;  3CD6 P;  4XFY A;  1Q81 Q;  1K30 A;  1YI2 P;  1YJ9 P;  1S72 P;  5F2O A;  1EIA A;  1QRJ A;  3H0D A;  1M90 Q;  2M8P A;  3G0V A;  3CCU P;  3DPH A;  4U0E A;  3CMA P;  1QVF O;  1NJI Q;  2P9X A;  2XV6 A;  2M8L A;  3RG6 C;  4PH1 A;  1M6N A;  2CWO A;  4GR6 A;  2PY8 A;  1K73 Q;  2QEX P;  3CCJ P;  3MGE A;  1RO0 A;  2M8N A;  4U0F A;  3DS3 A;  1VQO P;  2PEO A;  1VQL P;  2OTJ P;  1PEU A;  1M6E X;  2PEN A;  3H4E A;  3CCM P;  3I55 P;  3CCL P;  1Q7Y Q;  1VQ9 P;  2KOD A;  3CCS P;  2JYG A;  3HZQ A;  5I4T G;  3G1I A;  1YIJ P;  3CCQ P;  1VQP P;  2EG5 A;  2Z44 A;  1YHQ P;  1RNI A;  1W2B O;  1VQ7 P;  2EIA A;  3P05 A;  5BS2 A;  1D1D A;  2PEK A;  1QVG O;  1IUQ A;  2BQ1 E;  3G1G A;  2JO0 A;  4XFZ A;  5BS1 A;  3VRL C;  3WBH A;  2PEJ A;  3HYB A;  3G29 A;  1KD1 Q;  3CC2 P;  5HGM A;  3M1M A;  2E1M A;  1Q86 Q;  1JJ2 O;  2Z46 A;  1M74 A;  3CPW O;  1Q82 Q;  1VQ8 P;  1VQ4 P;  3DS2 A;  3CCR P;  1ZMB A;  1VQM P;  1N8R Q;  1M1K Q;  5HGL A;  3DS1 A;  2BUO A;  3I56 P;  1VQ6 P;  1PEM A;  4XRQ A;  3LRY A;  1VQN P;  3NTE A;  1A8O A;  3DS0 A;  1VQK P;  1YIT P;  5HGO A;  3CME P;  4PH0 A;  5JPA A;  2JYL A;  5HGN A;  1PEQ A;  4XFX A;  4COP A;  1PEO A;  1K9M Q;  3DS5 A;  4WYM A;  3CCV P;  3OW2 O;  3E2D A;  4COC A;  5DCK A;  3G4S P;  2XXM A;  2ONT A;  3CC4 P;  4M0I A;  4XRO A;  1A43 A;  5F2K A;  3DS4 A;  2DGY A;  2XT1 A;  2OTL P;  2LF4 A;  1VQ5 P;  1EOQ A;  3H47 A;  2L6E A;  4U0B A;  3G6E P;  1YJW P;  2PEM A;  1KQS O;  3G28 A;  1AUM A;  3DTJ A;  1K8A Q;  3G21 A;  1YJN P;  2Z45 A;  1RO2 A;  4U0C A;  4QNB A;  4U0A A;  3CCE P;  3B5I A;  2BHV A;  1BAJ A;  2OAR A;  3CC7 P;  4GR2 A;  4U0D A;  4IPY A;  3G26 A;  3CXC O;  2QA4 P;  2PEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...