2EHSA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehsA00
2KOPA 1NQ4A 3CE7A 2KGCA 2LTEA 2N50A 2KGDA 5KP7B 2FAEA 2FVFA 2K2QA 2KGAA 2LKIA 2FQ2A 2FACA 2KW2A 2FQ1A 3EJEA 3GZLA 2LPKA 2FQ0A 1DNYA 2L22A 2KWLA 4IZ6A 2KORA 2K0XA 4PWVB 2CG5B 2CGQA 2MF4A 2MD9A 2KG8A 4MRTC 2GDYA 2GDWA 2K0YA 2GDXA 2MR7A 5HV8A 4H2XC 2N6ZA 2CNRA 2CQ8A 2MR8A 5HVCA 1KLPA 4PXHB 2KOQA 2LIUA 2LMLA 5KP8B 2AVAA 4H2WC 4CA3A 2KR5A 2M5RA 3NY7B 2FVAA 5EJDA 2KOOA 1DV5A 2LOLA 2LL8A 1HY8A 1VKUA 1L0HA 2N98A 2VSQA 2LIWA 2AFEA 3EJDA 2PNGA 2KGEA 3GZMA 5KP6B 4NEOA 3LMOA 2FADA 2JQ4A 2L0QA 5CZDB 1OR5A 2ROQA 1AF8A 2MY5A 2KOSA 2MVVA 2FVEA 1L0IA 2JU2A 2X2BA 2AF8A 1F80D 2KG9A 1X3OA 2QNWA 2N6YA 4BPHA 2MVUA 2EHSA 2JU1A 2KG6A 3EJBA 2L9FA 4H2YC 1T8KA 1HQBA 2EHTA 2JGPA 2K94A 2N5HA 2XZ1C 4HKGA 4BPFA 1ACPA 2XZ0D 2AFDA 2L4BA 4BPGA 2FHSC 2N5IA 2K92A 3RG2A 2DNWA 2K93A 4R0MA 4DG9A
chains in the Genus database with same CATH superfamily
2KOPA 3CE7A 2PEQA 2N50A 3Q20A 2FVFA 3G1IA 2LKIA 2XV6A 3GZLA 2LPKA 2FQ0A 4IZ6A 1YI2P 1QRJA 3G0VA 4PWVB 2CG5B 3CCEP 2GZEA 1QVGO 5F2NA 2L6EA 3CCSP 4PH0A 2CNRA 5HVCA 5KP8B 2AVAA 3CCLP 3G28A 1Q7YQ 2M5RA 1YJ9P 2FVAA 2LOLA 1Q82Q 2OARA 1L0HA 2VLPA 1VQKP 2LIWA 3G26A 2PNGA 5HGNA 1VQ5P 4GR6A 3DS1A 2QA4P 3CMEP 3M1MA 1Q86Q 2JU2A 5I4TG 1RO0A 2AF8A 2PEOA 1A43A 3CCRP 2JBGA 1GXGA 2QNWA 3DTJA 2OTLP 1EOQA 1A8OA 1RNIA 4H2YC 4COPA 1HQBA 3H0DA 4XFXA 2JGPA 5BS2A 2L4BA 4BPGA 4F37A 1NJIQ 3VRLC 2FHSC 3P05A 3WBHA 1EIAA 1VQ6P 2CWOA 3CC2P 2K93A 3GJNA 5KP7B 5JPAA 1UJZA 2KGAA 2FACA 1M90Q 2L22A 2M8LA 3G71P 1ZMBA 2KG8A 4MRTC 3DS5A 2PEMA 5HV8A 2Z45A 4H2XC 3CCJP 1KLPA 2GZIA 4QKOA 2GZJA 3LRYA 3DS4A 5EJDA 1DV5A 1MZ8A 2LL8A 2QEXP 1ZNVA 1IUQA 1M1KQ 2N98A 2JB0A 2K5XA 3CCVP 4WYMA 1K8AQ 2AFEA 2JAZA 2KGEA 5KP6B 1M6NA 2FADA 2JQ4A 2PY8A 5CZDB 2ROQA 2KOSA 1GXHA 2MVVA 1L0IA 1UNKA 1M74A 4U0FA 2KG9A 1X3OA 3H47A 1YJWP 3RG6C 1D1DA 2JYGA 4BPHA 2EIAA 2KG6A 2L9FA 2P9XA 1VQ9P 1VQ4P 1VQ8P 2K94A 2XZ1C 5DCKA 1Q81Q 4GR2A 1K9MQ 1ACPA 2XZ0D 2AFDA 3DS2A 1YHQP 1VQNP 1K73Q 5BS1A 1EMVA 2DNWA 4DG9A 1NQ4A 2KGCA 1KD1Q 2LTEA 2KGDA 2LF4A 1K30A 2FQ2A 2FQ1A 2M8NA 1VQLP 2KORA 2EG5A 2MF4A 2MD9A 2GDYA 1AYIA 4M0IA 1QVFO 2NO8A 2OTJP 3B4QA 4PXHB 1BAJA 1E6JP 3CCQP 2ERHA 4CA3A 4H2WC 2XT1A 2VLQA 2M8PA 2KR5A 1YITP 1YJNP 2VSQA 1M6EX 2GZGA 3CCUP 3EJDA 4QNBA 1CEIA 2E1MA 2GYKA 4U0CA 1YIJP 4XRQA 3MGEA 3LMOA 2L0QA 1OR5A 4U0AA 2JO0A 2FVEA 1FR2A 2K0DX 2X2BA 1RO2A 1F80D 3DPHA 3G1GA 3HYBA 2N6YA 1VHNA 2MVUA 2EHSA 3EJBA 1IMPA 4COCA 1T8KA 2EHTA 4XFZA 3OW2O 4IPYA 3CPWO 2N5HA 1VQPP 1AUMA 2ONTA 4BPFA 1Z6MA 2BHVA 2GZFA 4XROA 3RG2A 2XXMA 1S72P 1W2BO 3HZQA 1KC8Q 2FAEA 2VLOA 2K2QA 3G4SP 2PENA 3EJEA 2KW2A 2WPTA 1DNYA 2KWLA 2K0XA 2CGQA 1VQ7P 3B5IA 1JJ2O 2DGYA 4XFYA 3GKLC 2GDWA 2PEKA 2K0YA 2GDXA 2MR7A 2N6ZA 2CQ8A 2MR8A 2JYLA 2KOQA 2LIUA 3E2DA 2LMLA 4U0DA 4PH1A 1GPJA 3DS0A 3CCMP 3H4EA 3G6EP 3NY7B 5HGLA 2KOOA 3U43A 1KQSO 2Z46A 1HY8A 1VKUA 3G21A 5EW5E 3GZMA 3I56P 4NEOA 3DS3A 2PEIA 2VLNA 1VQMP 1AF8A 5F2KA 2MY5A 4U0BA 1E0HA 1VQOP 5HGOA 2PEJA 3NTEA 3G29A 7CEIA 5F2OA 4U0EA 3CC4P 3CD6P 2Z44A 2JU1A 2BUOA 1N8RQ 4UHPB 2EFJA 1IMQA 4HKGA 3CC7P 3CXCO 2KODA 2N5IA 3CMAP 5HGMA 3I55P 2K92A 1BXIA 4R0MA
chains in the Genus database with same CATH topology
2KOPA 1NQ4A 3CE7A 2KGCA 2LTEA 2N50A 2KGDA 5KP7B 2FAEA 2FVFA 2K2QA 2KGAA 2LKIA 2FQ2A 2FACA 2KW2A 2FQ1A 3EJEA 3GZLA 2LPKA 2FQ0A 1DNYA 2L22A 2KWLA 4IZ6A 2KORA 2K0XA 4PWVB 2CG5B 2CGQA 2MF4A 2MD9A 2KG8A 4MRTC 2GDYA 2GDWA 2K0YA 2GDXA 2MR7A 5HV8A 4H2XC 2N6ZA 2CNRA 2CQ8A 2MR8A 5HVCA 1KLPA 4PXHB 2KOQA 2LIUA 2LMLA 5KP8B 2AVAA 4H2WC 4CA3A 2KR5A 2M5RA 3NY7B 2FVAA 5EJDA 2KOOA 1DV5A 2LOLA 2LL8A 1HY8A 1VKUA 1L0HA 2N98A 2VSQA 2LIWA 2AFEA 3EJDA 2PNGA 2KGEA 3GZMA 5KP6B 4NEOA 3LMOA 2FADA 2JQ4A 2L0QA 5CZDB 1OR5A 2ROQA 1AF8A 2MY5A 2KOSA 2MVVA 2FVEA 1L0IA 2JU2A 2X2BA 2AF8A 1F80D 2KG9A 1X3OA 2QNWA 2N6YA 4BPHA 2MVUA 2EHSA 2JU1A 2KG6A 3EJBA 2L9FA 4H2YC 1T8KA 1HQBA 2EHTA 2JGPA 2K94A 2N5HA 2XZ1C 4HKGA 4BPFA 1ACPA 2XZ0D 2AFDA 2L4BA 4BPGA 2FHSC 2N5IA 2K92A 3RG2A 2DNWA 2K93A 4R0MA 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOP A;  1NQ4 A;  3CE7 A;  2KGC A;  2LTE A;  2N50 A;  2KGD A;  5KP7 B;  2FAE A;  2FVF A;  2K2Q A;  2KGA A;  2LKI A;  2FQ2 A;  2FAC A;  2KW2 A;  2FQ1 A;  3EJE A;  3GZL A;  2LPK A;  2FQ0 A;  1DNY A;  2L22 A;  2KWL A;  4IZ6 A;  2KOR A;  2K0X A;  4PWV B;  2CG5 B;  2CGQ A;  2MF4 A;  2MD9 A;  2KG8 A;  4MRT C;  2GDY A;  2GDW A;  2K0Y A;  2GDX A;  2MR7 A;  5HV8 A;  4H2X C;  2N6Z A;  2CNR A;  2CQ8 A;  2MR8 A;  5HVC A;  1KLP A;  4PXH B;  2KOQ A;  2LIU A;  2LML A;  5KP8 B;  2AVA A;  4H2W C;  4CA3 A;  2KR5 A;  2M5R A;  3NY7 B;  2FVA A;  5EJD A;  2KOO A;  1DV5 A;  2LOL A;  2LL8 A;  1HY8 A;  1VKU A;  1L0H A;  2N98 A;  2VSQ A;  2LIW A;  2AFE A;  3EJD A;  2PNG A;  2KGE A;  3GZM A;  5KP6 B;  4NEO A;  3LMO A;  2FAD A;  2JQ4 A;  2L0Q A;  5CZD B;  1OR5 A;  2ROQ A;  1AF8 A;  2MY5 A;  2KOS A;  2MVV A;  2FVE A;  1L0I A;  2JU2 A;  2X2B A;  2AF8 A;  1F80 D;  2KG9 A;  1X3O A;  2QNW A;  2N6Y A;  4BPH A;  2MVU A;  2EHS A;  2JU1 A;  2KG6 A;  3EJB A;  2L9F A;  4H2Y C;  1T8K A;  1HQB A;  2EHT A;  2JGP A;  2K94 A;  2N5H A;  2XZ1 C;  4HKG A;  4BPF A;  1ACP A;  2XZ0 D;  2AFD A;  2L4B A;  4BPG A;  2FHS C;  2N5I A;  2K92 A;  3RG2 A;  2DNW A;  2K93 A;  4R0M A;  4DG9 A; 
#chains in the Genus database with same CATH topology
 2KOP A;  3CE7 A;  2PEQ A;  2N50 A;  3Q20 A;  2FVF A;  3G1I A;  2LKI A;  2XV6 A;  3GZL A;  2LPK A;  2FQ0 A;  4IZ6 A;  1YI2 P;  1QRJ A;  3G0V A;  4PWV B;  2CG5 B;  3CCE P;  2GZE A;  1QVG O;  5F2N A;  2L6E A;  3CCS P;  4PH0 A;  2CNR A;  5HVC A;  5KP8 B;  2AVA A;  3CCL P;  3G28 A;  1Q7Y Q;  2M5R A;  1YJ9 P;  2FVA A;  2LOL A;  1Q82 Q;  2OAR A;  1L0H A;  2VLP A;  1VQK P;  2LIW A;  3G26 A;  2PNG A;  5HGN A;  1VQ5 P;  4GR6 A;  3DS1 A;  2QA4 P;  3CME P;  3M1M A;  1Q86 Q;  2JU2 A;  5I4T G;  1RO0 A;  2AF8 A;  2PEO A;  1A43 A;  3CCR P;  2JBG A;  1GXG A;  2QNW A;  3DTJ A;  2OTL P;  1EOQ A;  1A8O A;  1RNI A;  4H2Y C;  4COP A;  1HQB A;  3H0D A;  4XFX A;  2JGP A;  5BS2 A;  2L4B A;  4BPG A;  4F37 A;  1NJI Q;  3VRL C;  2FHS C;  3P05 A;  3WBH A;  1EIA A;  1VQ6 P;  2CWO A;  3CC2 P;  2K93 A;  3GJN A;  5KP7 B;  5JPA A;  1UJZ A;  2KGA A;  2FAC A;  1M90 Q;  2L22 A;  2M8L A;  3G71 P;  1ZMB A;  2KG8 A;  4MRT C;  3DS5 A;  2PEM A;  5HV8 A;  2Z45 A;  4H2X C;  3CCJ P;  1KLP A;  2GZI A;  4QKO A;  2GZJ A;  3LRY A;  3DS4 A;  5EJD A;  1DV5 A;  1MZ8 A;  2LL8 A;  2QEX P;  1ZNV A;  1IUQ A;  1M1K Q;  2N98 A;  2JB0 A;  2K5X A;  3CCV P;  4WYM A;  1K8A Q;  2AFE A;  2JAZ A;  2KGE A;  5KP6 B;  1M6N A;  2FAD A;  2JQ4 A;  2PY8 A;  5CZD B;  2ROQ A;  2KOS A;  1GXH A;  2MVV A;  1L0I A;  1UNK A;  1M74 A;  4U0F A;  2KG9 A;  1X3O A;  3H47 A;  1YJW P;  3RG6 C;  1D1D A;  2JYG A;  4BPH A;  2EIA A;  2KG6 A;  2L9F A;  2P9X A;  1VQ9 P;  1VQ4 P;  1VQ8 P;  2K94 A;  2XZ1 C;  5DCK A;  1Q81 Q;  4GR2 A;  1K9M Q;  1ACP A;  2XZ0 D;  2AFD A;  3DS2 A;  1YHQ P;  1VQN P;  1K73 Q;  5BS1 A;  1EMV A;  2DNW A;  4DG9 A;  1NQ4 A;  2KGC A;  1KD1 Q;  2LTE A;  2KGD A;  2LF4 A;  1K30 A;  2FQ2 A;  2FQ1 A;  2M8N A;  1VQL P;  2KOR A;  2EG5 A;  2MF4 A;  2MD9 A;  2GDY A;  1AYI A;  4M0I A;  1QVF O;  2NO8 A;  2OTJ P;  3B4Q A;  4PXH B;  1BAJ A;  1E6J P;  3CCQ P;  2ERH A;  4CA3 A;  4H2W C;  2XT1 A;  2VLQ A;  2M8P A;  2KR5 A;  1YIT P;  1YJN P;  2VSQ A;  1M6E X;  2GZG A;  3CCU P;  3EJD A;  4QNB A;  1CEI A;  2E1M A;  2GYK A;  4U0C A;  1YIJ P;  4XRQ A;  3MGE A;  3LMO A;  2L0Q A;  1OR5 A;  4U0A A;  2JO0 A;  2FVE A;  1FR2 A;  2K0D X;  2X2B A;  1RO2 A;  1F80 D;  3DPH A;  3G1G A;  3HYB A;  2N6Y A;  1VHN A;  2MVU A;  2EHS A;  3EJB A;  1IMP A;  4COC A;  1T8K A;  2EHT A;  4XFZ A;  3OW2 O;  4IPY A;  3CPW O;  2N5H A;  1VQP P;  1AUM A;  2ONT A;  4BPF A;  1Z6M A;  2BHV A;  2GZF A;  4XRO A;  3RG2 A;  2XXM A;  1S72 P;  1W2B O;  3HZQ A;  1KC8 Q;  2FAE A;  2VLO A;  2K2Q A;  3G4S P;  2PEN A;  3EJE A;  2KW2 A;  2WPT A;  1DNY A;  2KWL A;  2K0X A;  2CGQ A;  1VQ7 P;  3B5I A;  1JJ2 O;  2DGY A;  4XFY A;  3GKL C;  2GDW A;  2PEK A;  2K0Y A;  2GDX A;  2MR7 A;  2N6Z A;  2CQ8 A;  2MR8 A;  2JYL A;  2KOQ A;  2LIU A;  3E2D A;  2LML A;  4U0D A;  4PH1 A;  1GPJ A;  3DS0 A;  3CCM P;  3H4E A;  3G6E P;  3NY7 B;  5HGL A;  2KOO A;  3U43 A;  1KQS O;  2Z46 A;  1HY8 A;  1VKU A;  3G21 A;  5EW5 E;  3GZM A;  3I56 P;  4NEO A;  3DS3 A;  2PEI A;  2VLN A;  1VQM P;  1AF8 A;  5F2K A;  2MY5 A;  4U0B A;  1E0H A;  1VQO P;  5HGO A;  2PEJ A;  3NTE A;  3G29 A;  7CEI A;  5F2O A;  4U0E A;  3CC4 P;  3CD6 P;  2Z44 A;  2JU1 A;  2BUO A;  1N8R Q;  4UHP B;  2EFJ A;  1IMQ A;  4HKG A;  3CC7 P;  3CXC O;  2KOD A;  2N5I A;  3CMA P;  5HGM A;  3I55 P;  2K92 A;  1BXI A;  4R0M A; 
#chains in the Genus database with same CATH homology
 2KOP A;  1NQ4 A;  3CE7 A;  2KGC A;  2LTE A;  2N50 A;  2KGD A;  5KP7 B;  2FAE A;  2FVF A;  2K2Q A;  2KGA A;  2LKI A;  2FQ2 A;  2FAC A;  2KW2 A;  2FQ1 A;  3EJE A;  3GZL A;  2LPK A;  2FQ0 A;  1DNY A;  2L22 A;  2KWL A;  4IZ6 A;  2KOR A;  2K0X A;  4PWV B;  2CG5 B;  2CGQ A;  2MF4 A;  2MD9 A;  2KG8 A;  4MRT C;  2GDY A;  2GDW A;  2K0Y A;  2GDX A;  2MR7 A;  5HV8 A;  4H2X C;  2N6Z A;  2CNR A;  2CQ8 A;  2MR8 A;  5HVC A;  1KLP A;  4PXH B;  2KOQ A;  2LIU A;  2LML A;  5KP8 B;  2AVA A;  4H2W C;  4CA3 A;  2KR5 A;  2M5R A;  3NY7 B;  2FVA A;  5EJD A;  2KOO A;  1DV5 A;  2LOL A;  2LL8 A;  1HY8 A;  1VKU A;  1L0H A;  2N98 A;  2VSQ A;  2LIW A;  2AFE A;  3EJD A;  2PNG A;  2KGE A;  3GZM A;  5KP6 B;  4NEO A;  3LMO A;  2FAD A;  2JQ4 A;  2L0Q A;  5CZD B;  1OR5 A;  2ROQ A;  1AF8 A;  2MY5 A;  2KOS A;  2MVV A;  2FVE A;  1L0I A;  2JU2 A;  2X2B A;  2AF8 A;  1F80 D;  2KG9 A;  1X3O A;  2QNW A;  2N6Y A;  4BPH A;  2MVU A;  2EHS A;  2JU1 A;  2KG6 A;  3EJB A;  2L9F A;  4H2Y C;  1T8K A;  1HQB A;  2EHT A;  2JGP A;  2K94 A;  2N5H A;  2XZ1 C;  4HKG A;  4BPF A;  1ACP A;  2XZ0 D;  2AFD A;  2L4B A;  4BPG A;  2FHS C;  2N5I A;  2K92 A;  3RG2 A;  2DNW A;  2K93 A;  4R0M A;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...