2EHSA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehsA00
2FAEA 1HQBA 2FQ0A 2KORA 3CE7A 2K92A 4BPGA 2KOQA 2LKIA 2JU1A 2FVAA 2K0YA 2XZ0D 4PXHB 2EHTA 2FVEA 2KR5A 3NY7B 4MRTC 2GDWA 2EHSA 5HVCA 2K2QA 5EJDA 2MVVA 2N5HA 2N6ZA 2GDYA 1DV5A 2GDXA 2LMLA 2DNWA 3EJEA 2AFEA 2LL8A 4CA3A 1NQ4A 2FHSC 2L22A 2L0QA 2JGPA 4DG9A 2KOPA 2MY5A 1OR5A 2FQ2A 4BPHA 2LOLA 2AF8A 2L9FA 2K94A 2KOOA 3EJDA 2N98A 2XZ1C 1ACPA 1HY8A 3EJBA 2KW2A 1L0HA 4H2YC 2QNWA 2KG8A 2M5RA 1F80D 2KOSA 2FQ1A 4PWVB 2N6YA 5CZDB 3GZLA 2JU2A 2CQ8A 2FVFA 4R0MA 1VKUA 2L4BA 4BPFA 2LPKA 1X3OA 2MVUA 2CNRA 4NEOA 2KG9A 2N50A 1T8KA 2LIUA 2CG5B 2KWLA 1DNYA 3LMOA 2LTEA 4H2XC 5HV8A 2K93A 3RG2A 2X2BA 2PNGA 2AFDA 5KP6B 2MD9A 2MR7A 2ROQA 2CGQA 2FADA 3GZMA 2KG6A 2K0XA 1AF8A 2KGCA 5KP8B 2JQ4A 2VSQA 2MR8A 5KP7B 1KLPA 2KGEA 4IZ6A 2AVAA 2KGAA 2LIWA 4HKGA 2FACA 2N5IA 2KGDA 2MF4A 1L0IA 4H2WC
chains in the Genus database with same CATH superfamily
3E2DA 3G28A 2FQ0A 4COCA 1VQMP 4BPGA 2KOQA 3WBHA 5BS2A 2VLQA 4U0CA 2XZ0D 1Z6MA 3H47A 5HVCA 1K9MQ 3CCEP 1GXHA 1VQ9P 1DV5A 1Q82Q 1YJ9P 1Q7YQ 2DNWA 7CEIA 5HGMA 1M74A 2AFEA 2LL8A 1NQ4A 2FHSC 2JBGA 2M8PA 1N8RQ 4XFXA 1IUQA 1EIAA 2N98A 3RG6C 2GZGA 5DCKA 1M6NA 2KW2A 1L0HA 5HGLA 3G21A 1FR2A 2E1MA 2M5RA 3CCRP 1F80D 4PWVB 2EIAA 1M90Q 2L4BA 3CPWO 2PEQA 2CNRA 2JYGA 1VQ5P 2KG9A 1Q86Q 4U0FA 2K5XA 3CXCO 5F2NA 1KC8Q 5JPAA 5HV8A 1VQPP 2AFDA 2OTLP 1VQNP 2MR7A 2ROQA 1E6JP 2CGQA 2GZIA 2K0XA 1AF8A 1ZNVA 1YI2P 2MR8A 3GJNA 2M8NA 4IZ6A 1YJNP 2KGAA 3DPHA 1RO2A 3DTJA 1EOQA 1NJIQ 2MF4A 4XFYA 3CD6P 1L0IA 4XFZA 1HQBA 2KORA 1BAJA 2LKIA 5BS1A 2XV6A 2JU1A 2K0YA 1YIJP 1JJ2O 4MRTC 2GDWA 1KQSO 1BXIA 2GDYA 2PEOA 3G26A 3EJEA 4CA3A 2PENA 1K73Q 1OR5A 2DGYA 2L9FA 3G4SP 2K94A 3CCUP 2Z46A 2KOOA 3EJBA 3NTEA 1UJZA 5F2OA 1IMPA 2LF4A 2OARA 1E0HA 2KOSA 2N6YA 3GZLA 1IMQA 2OTJP 2PEKA 1YJWP 4BPFA 2LPKA 3U43A 2MVUA 4NEOA 2N50A 1T8KA 1M6EX 2CG5B 2WPTA 2K0DX 1M1KQ 3G29A 5HGOA 2PNGA 1VQ7P 2FADA 1VQ4P 2KGCA 2JQ4A 3Q20A 1K8AQ 2ERHA 3G6EP 3B4QA 2KGEA 1ZMBA 2AVAA 2PEIA 4WYMA 1VQLP 2N5IA 1Q81Q 3VRLC 2CWOA 4COPA 4GR6A 2GZFA 4H2WC 3DS3A 2KODA 3CC7P 4M0IA 2K92A 2BUOA 2FVAA 3OW2O 3NY7B 4F37A 1AYIA 1A43A 3DS1A 2EHSA 3CC4P 3P05A 5EJDA 2MVVA 2N5HA 2GZJA 2N6ZA 2LMLA 1VQ8P 1K30A 1UNKA 2L0QA 3CCJP 2JGPA 3G1GA 4DG9A 4BPHA 1QVGO 3CMEP 4PH1A 2LOLA 2AF8A 4GR2A 3G1IA 4XROA 1S72P 2XZ1C 3CC2P 2ONTA 1HY8A 1GXGA 4QNBA 5F2KA 4H2YC 2VLPA 1QRJA 3G71P 2FQ1A 5CZDB 2GYKA 2CQ8A 2JU2A 1RO0A 4R0MA 1VKUA 3DS4A 2JAZA 2L6EA 2LIUA 3CMAP 2KWLA 2LTEA 2QEXP 4H2XC 5I4TG 1AUMA 3RG2A 3CCMP 5KP6B 2MD9A 1YHQP 4IPYA 3GZMA 3HZQA 4U0AA 3B5IA 3DS0A 2VSQA 4U0DA 1GPJA 5KP7B 1CEIA 2QA4P 2LIWA 3H0DA 4HKGA 1W2BO 2FACA 1VHNA 2KGDA 2XT1A 1VQKP 2Z44A 2FAEA 1KD1Q 2GZEA 3CE7A 1YITP 2PEJA 2Z45A 1RNIA 4XRQA 4QKOA 4PXHB 2EHTA 2FVEA 2KR5A 1VQ6P 1D1DA 2K2QA 2GDXA 2L22A 2JO0A 2KOPA 2MY5A 3I56P 2FQ2A 3MGEA 3EJDA 3H4EA 1ACPA 3G0VA 2XXMA 2BHVA 2JB0A 2EG5A 2QNWA 2KG8A 4U0BA 3I55P 2EFJA 4U0EA 2NO8A 3M1MA 4PH0A 3CCLP 1EMVA 2FVFA 2VLNA 1A8OA 1X3OA 3DS5A 3CCSP 2P9XA 2PEMA 3LMOA 3GKLC 1DNYA 2PY8A 2K93A 1MZ8A 2X2BA 3CCQP 2JYLA 2VLOA 3CCVP 2KG6A 4UHPB 5KP8B 1QVFO 3LRYA 1VQOP 1KLPA 5EW5E 3HYBA 5HGNA 3DS2A 2M8LA
chains in the Genus database with same CATH topology
2FAEA 1HQBA 2FQ0A 2KORA 3CE7A 2K92A 4BPGA 2KOQA 2LKIA 2JU1A 2FVAA 2K0YA 2XZ0D 4PXHB 2EHTA 2FVEA 2KR5A 3NY7B 4MRTC 2GDWA 2EHSA 5HVCA 2K2QA 5EJDA 2MVVA 2N5HA 2N6ZA 2GDYA 1DV5A 2GDXA 2LMLA 2DNWA 3EJEA 2AFEA 2LL8A 4CA3A 1NQ4A 2FHSC 2L22A 2L0QA 2JGPA 4DG9A 2KOPA 2MY5A 1OR5A 2FQ2A 4BPHA 2LOLA 2AF8A 2L9FA 2K94A 2KOOA 3EJDA 2N98A 2XZ1C 1ACPA 1HY8A 3EJBA 2KW2A 1L0HA 4H2YC 2QNWA 2KG8A 2M5RA 1F80D 2KOSA 2FQ1A 4PWVB 2N6YA 5CZDB 3GZLA 2JU2A 2CQ8A 2FVFA 4R0MA 1VKUA 2L4BA 4BPFA 2LPKA 1X3OA 2MVUA 2CNRA 4NEOA 2KG9A 2N50A 1T8KA 2LIUA 2CG5B 2KWLA 1DNYA 3LMOA 2LTEA 4H2XC 5HV8A 2K93A 3RG2A 2X2BA 2PNGA 2AFDA 5KP6B 2MD9A 2MR7A 2ROQA 2CGQA 2FADA 3GZMA 2KG6A 2K0XA 1AF8A 2KGCA 5KP8B 2JQ4A 2VSQA 2MR8A 5KP7B 1KLPA 2KGEA 4IZ6A 2AVAA 2KGAA 2LIWA 4HKGA 2FACA 2N5IA 2KGDA 2MF4A 1L0IA 4H2WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  1HQB A;  2FQ0 A;  2KOR A;  3CE7 A;  2K92 A;  4BPG A;  2KOQ A;  2LKI A;  2JU1 A;  2FVA A;  2K0Y A;  2XZ0 D;  4PXH B;  2EHT A;  2FVE A;  2KR5 A;  3NY7 B;  4MRT C;  2GDW A;  2EHS A;  5HVC A;  2K2Q A;  5EJD A;  2MVV A;  2N5H A;  2N6Z A;  2GDY A;  1DV5 A;  2GDX A;  2LML A;  2DNW A;  3EJE A;  2AFE A;  2LL8 A;  4CA3 A;  1NQ4 A;  2FHS C;  2L22 A;  2L0Q A;  2JGP A;  4DG9 A;  2KOP A;  2MY5 A;  1OR5 A;  2FQ2 A;  4BPH A;  2LOL A;  2AF8 A;  2L9F A;  2K94 A;  2KOO A;  3EJD A;  2N98 A;  2XZ1 C;  1ACP A;  1HY8 A;  3EJB A;  2KW2 A;  1L0H A;  4H2Y C;  2QNW A;  2KG8 A;  2M5R A;  1F80 D;  2KOS A;  2FQ1 A;  4PWV B;  2N6Y A;  5CZD B;  3GZL A;  2JU2 A;  2CQ8 A;  2FVF A;  4R0M A;  1VKU A;  2L4B A;  4BPF A;  2LPK A;  1X3O A;  2MVU A;  2CNR A;  4NEO A;  2KG9 A;  2N50 A;  1T8K A;  2LIU A;  2CG5 B;  2KWL A;  1DNY A;  3LMO A;  2LTE A;  4H2X C;  5HV8 A;  2K93 A;  3RG2 A;  2X2B A;  2PNG A;  2AFD A;  5KP6 B;  2MD9 A;  2MR7 A;  2ROQ A;  2CGQ A;  2FAD A;  3GZM A;  2KG6 A;  2K0X A;  1AF8 A;  2KGC A;  5KP8 B;  2JQ4 A;  2VSQ A;  2MR8 A;  5KP7 B;  1KLP A;  2KGE A;  4IZ6 A;  2AVA A;  2KGA A;  2LIW A;  4HKG A;  2FAC A;  2N5I A;  2KGD A;  2MF4 A;  1L0I A;  4H2W C; 
#chains in the Genus database with same CATH topology
 3E2D A;  3G28 A;  2FQ0 A;  4COC A;  1VQM P;  4BPG A;  2KOQ A;  3WBH A;  5BS2 A;  2VLQ A;  4U0C A;  2XZ0 D;  1Z6M A;  3H47 A;  5HVC A;  1K9M Q;  3CCE P;  1GXH A;  1VQ9 P;  1DV5 A;  1Q82 Q;  1YJ9 P;  1Q7Y Q;  2DNW A;  7CEI A;  5HGM A;  1M74 A;  2AFE A;  2LL8 A;  1NQ4 A;  2FHS C;  2JBG A;  2M8P A;  1N8R Q;  4XFX A;  1IUQ A;  1EIA A;  2N98 A;  3RG6 C;  2GZG A;  5DCK A;  1M6N A;  2KW2 A;  1L0H A;  5HGL A;  3G21 A;  1FR2 A;  2E1M A;  2M5R A;  3CCR P;  1F80 D;  4PWV B;  2EIA A;  1M90 Q;  2L4B A;  3CPW O;  2PEQ A;  2CNR A;  2JYG A;  1VQ5 P;  2KG9 A;  1Q86 Q;  4U0F A;  2K5X A;  3CXC O;  5F2N A;  1KC8 Q;  5JPA A;  5HV8 A;  1VQP P;  2AFD A;  2OTL P;  1VQN P;  2MR7 A;  2ROQ A;  1E6J P;  2CGQ A;  2GZI A;  2K0X A;  1AF8 A;  1ZNV A;  1YI2 P;  2MR8 A;  3GJN A;  2M8N A;  4IZ6 A;  1YJN P;  2KGA A;  3DPH A;  1RO2 A;  3DTJ A;  1EOQ A;  1NJI Q;  2MF4 A;  4XFY A;  3CD6 P;  1L0I A;  4XFZ A;  1HQB A;  2KOR A;  1BAJ A;  2LKI A;  5BS1 A;  2XV6 A;  2JU1 A;  2K0Y A;  1YIJ P;  1JJ2 O;  4MRT C;  2GDW A;  1KQS O;  1BXI A;  2GDY A;  2PEO A;  3G26 A;  3EJE A;  4CA3 A;  2PEN A;  1K73 Q;  1OR5 A;  2DGY A;  2L9F A;  3G4S P;  2K94 A;  3CCU P;  2Z46 A;  2KOO A;  3EJB A;  3NTE A;  1UJZ A;  5F2O A;  1IMP A;  2LF4 A;  2OAR A;  1E0H A;  2KOS A;  2N6Y A;  3GZL A;  1IMQ A;  2OTJ P;  2PEK A;  1YJW P;  4BPF A;  2LPK A;  3U43 A;  2MVU A;  4NEO A;  2N50 A;  1T8K A;  1M6E X;  2CG5 B;  2WPT A;  2K0D X;  1M1K Q;  3G29 A;  5HGO A;  2PNG A;  1VQ7 P;  2FAD A;  1VQ4 P;  2KGC A;  2JQ4 A;  3Q20 A;  1K8A Q;  2ERH A;  3G6E P;  3B4Q A;  2KGE A;  1ZMB A;  2AVA A;  2PEI A;  4WYM A;  1VQL P;  2N5I A;  1Q81 Q;  3VRL C;  2CWO A;  4COP A;  4GR6 A;  2GZF A;  4H2W C;  3DS3 A;  2KOD A;  3CC7 P;  4M0I A;  2K92 A;  2BUO A;  2FVA A;  3OW2 O;  3NY7 B;  4F37 A;  1AYI A;  1A43 A;  3DS1 A;  2EHS A;  3CC4 P;  3P05 A;  5EJD A;  2MVV A;  2N5H A;  2GZJ A;  2N6Z A;  2LML A;  1VQ8 P;  1K30 A;  1UNK A;  2L0Q A;  3CCJ P;  2JGP A;  3G1G A;  4DG9 A;  4BPH A;  1QVG O;  3CME P;  4PH1 A;  2LOL A;  2AF8 A;  4GR2 A;  3G1I A;  4XRO A;  1S72 P;  2XZ1 C;  3CC2 P;  2ONT A;  1HY8 A;  1GXG A;  4QNB A;  5F2K A;  4H2Y C;  2VLP A;  1QRJ A;  3G71 P;  2FQ1 A;  5CZD B;  2GYK A;  2CQ8 A;  2JU2 A;  1RO0 A;  4R0M A;  1VKU A;  3DS4 A;  2JAZ A;  2L6E A;  2LIU A;  3CMA P;  2KWL A;  2LTE A;  2QEX P;  4H2X C;  5I4T G;  1AUM A;  3RG2 A;  3CCM P;  5KP6 B;  2MD9 A;  1YHQ P;  4IPY A;  3GZM A;  3HZQ A;  4U0A A;  3B5I A;  3DS0 A;  2VSQ A;  4U0D A;  1GPJ A;  5KP7 B;  1CEI A;  2QA4 P;  2LIW A;  3H0D A;  4HKG A;  1W2B O;  2FAC A;  1VHN A;  2KGD A;  2XT1 A;  1VQK P;  2Z44 A;  2FAE A;  1KD1 Q;  2GZE A;  3CE7 A;  1YIT P;  2PEJ A;  2Z45 A;  1RNI A;  4XRQ A;  4QKO A;  4PXH B;  2EHT A;  2FVE A;  2KR5 A;  1VQ6 P;  1D1D A;  2K2Q A;  2GDX A;  2L22 A;  2JO0 A;  2KOP A;  2MY5 A;  3I56 P;  2FQ2 A;  3MGE A;  3EJD A;  3H4E A;  1ACP A;  3G0V A;  2XXM A;  2BHV A;  2JB0 A;  2EG5 A;  2QNW A;  2KG8 A;  4U0B A;  3I55 P;  2EFJ A;  4U0E A;  2NO8 A;  3M1M A;  4PH0 A;  3CCL P;  1EMV A;  2FVF A;  2VLN A;  1A8O A;  1X3O A;  3DS5 A;  3CCS P;  2P9X A;  2PEM A;  3LMO A;  3GKL C;  1DNY A;  2PY8 A;  2K93 A;  1MZ8 A;  2X2B A;  3CCQ P;  2JYL A;  2VLO A;  3CCV P;  2KG6 A;  4UHP B;  5KP8 B;  1QVF O;  3LRY A;  1VQO P;  1KLP A;  5EW5 E;  3HYB A;  5HGN A;  3DS2 A;  2M8L A; 
#chains in the Genus database with same CATH homology
 2FAE A;  1HQB A;  2FQ0 A;  2KOR A;  3CE7 A;  2K92 A;  4BPG A;  2KOQ A;  2LKI A;  2JU1 A;  2FVA A;  2K0Y A;  2XZ0 D;  4PXH B;  2EHT A;  2FVE A;  2KR5 A;  3NY7 B;  4MRT C;  2GDW A;  2EHS A;  5HVC A;  2K2Q A;  5EJD A;  2MVV A;  2N5H A;  2N6Z A;  2GDY A;  1DV5 A;  2GDX A;  2LML A;  2DNW A;  3EJE A;  2AFE A;  2LL8 A;  4CA3 A;  1NQ4 A;  2FHS C;  2L22 A;  2L0Q A;  2JGP A;  4DG9 A;  2KOP A;  2MY5 A;  1OR5 A;  2FQ2 A;  4BPH A;  2LOL A;  2AF8 A;  2L9F A;  2K94 A;  2KOO A;  3EJD A;  2N98 A;  2XZ1 C;  1ACP A;  1HY8 A;  3EJB A;  2KW2 A;  1L0H A;  4H2Y C;  2QNW A;  2KG8 A;  2M5R A;  1F80 D;  2KOS A;  2FQ1 A;  4PWV B;  2N6Y A;  5CZD B;  3GZL A;  2JU2 A;  2CQ8 A;  2FVF A;  4R0M A;  1VKU A;  2L4B A;  4BPF A;  2LPK A;  1X3O A;  2MVU A;  2CNR A;  4NEO A;  2KG9 A;  2N50 A;  1T8K A;  2LIU A;  2CG5 B;  2KWL A;  1DNY A;  3LMO A;  2LTE A;  4H2X C;  5HV8 A;  2K93 A;  3RG2 A;  2X2B A;  2PNG A;  2AFD A;  5KP6 B;  2MD9 A;  2MR7 A;  2ROQ A;  2CGQ A;  2FAD A;  3GZM A;  2KG6 A;  2K0X A;  1AF8 A;  2KGC A;  5KP8 B;  2JQ4 A;  2VSQ A;  2MR8 A;  5KP7 B;  1KLP A;  2KGE A;  4IZ6 A;  2AVA A;  2KGA A;  2LIW A;  4HKG A;  2FAC A;  2N5I A;  2KGD A;  2MF4 A;  1L0I A;  4H2W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...