2EHSA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehsA00
1HQBA 3LMOA 2AFDA 2K0YA 3EJBA 3EJDA 2JGPA 2MY5A 1NQ4A 2JU2A 4BPGA 1F80D 1X3OA 5KP6B 2K2QA 2K92A 4HKGA 2GDXA 2CQ8A 2KOPA 2N5IA 3GZLA 2FQ0A 2VSQA 2KGDA 2KR5A 4IZ6A 2KWLA 2CGQA 2CNRA 2L0QA 4H2XC 2N98A 4DG9A 2FVAA 2L9FA 4MRTC 2LPKA 2CG5B 2KORA 2FADA 5KP8B 4R0MA 1HY8A 1DV5A 2LIWA 3RG2A 4H2YC 2KOOA 2FVEA 2MVUA 2LOLA 1DNYA 5KP7B 2FHSC 1L0IA 3CE7A 2KGEA 2MD9A 2KW2A 1VKUA 2GDWA 2KG8A 4NEOA 2LIUA 2AF8A 2AVAA 1AF8A 2KOQA 2MF4A 2EHTA 2LTEA 2ROQA 2FQ2A 4PWVB 2GDYA 5CZDB 2LMLA 1L0HA 2KG6A 2XZ1C 2LL8A 4BPFA 1T8KA 2K93A 2KGAA 2MR7A 4CA3A 2KOSA 5HVCA 2MR8A 4H2WC 2KGCA 2PNGA 2L22A 2KG9A 3EJEA 2K94A 2AFEA 2X2BA 3GZMA 2FAEA 2L4BA 5HV8A 5EJDA 3NY7B 2JQ4A 2FQ1A 2FVFA 2N50A 4BPHA 2M5RA 1KLPA 2N5HA 2K0XA 2FACA 2DNWA 2MVVA 2JU1A 2LKIA 2N6ZA 2EHSA 2XZ0D 4PXHB 2N6YA 1ACPA 1OR5A 2QNWA
chains in the Genus database with same CATH superfamily
2EG5A 3CCMP 3LMOA 2K0YA 3EJDA 1ZNVA 2PEQA 4U0AA 2OTLP 1NQ4A 2JU2A 2K92A 4IPYA 4HKGA 2N5IA 3GZLA 2K5XA 2WPTA 5DCKA 2L0QA 4H2XC 4PH0A 2E1MA 3I55P 2LPKA 5KP8B 1DV5A 4U0FA 4H2YC 3G0VA 2LOLA 1BXIA 3CCQP 2FHSC 5BS1A 2KGEA 1YJNP 1EOQA 2VLNA 1M6NA 2PENA 1VQ7P 4PWVB 1KD1Q 1VQ8P 4XFZA 1UNKA 1VQMP 4GR6A 3G26A 4PH1A 1RNIA 2KGAA 2MR7A 3CD6P 2OARA 2PEOA 5HVCA 2MR8A 3DS1A 2PNGA 2K94A 3CCLP 2ONTA 5HV8A 4GR2A 5I4TG 1Q81Q 3NTEA 3CMEP 2FVFA 2GZFA 2M5RA 3CCJP 2XV6A 2PEMA 2GZIA 2JU1A 2N6ZA 2EHSA 4PXHB 2DGYA 1BAJA 1HQBA 1KC8Q 4WYMA 2JGPA 1YJWP 5BS2A 4BPGA 1F80D 2PY8A 2K0DX 1X3OA 5KP6B 2QEXP 2GDXA 2CQ8A 1VQKP 3CCVP 2VLOA 1VQPP 3G6EP 2CWOA 4XROA 2GZJA 2P9XA 2KGDA 2KR5A 2CGQA 3H4EA 1VHNA 2JAZA 2FVAA 1IMQA 2FADA 3P05A 1W2BO 1Q7YQ 5HGOA 2Z44A 3Q20A 3RG2A 1GXHA 1YHQP 4UHPB 1Q82Q 5KP7B 1K8AQ 2VLQA 3G71P 3CE7A 2MD9A 1K73Q 2KW2A 2GDWA 3WBHA 2KG8A 4NEOA 4XRQA 1CEIA 3LRYA 2NO8A 1AF8A 3CC2P 2LTEA 1VQ6P 1K30A 2ROQA 2FQ2A 2GDYA 2LMLA 3CC4P 2XT1A 4BPFA 3M1MA 3DPHA 4U0DA 2BHVA 5HGMA 2Z45A 3DS4A 5F2KA 3CPWO 1GPJA 4H2WC 2KGCA 1VQNP 2JO0A 2FAEA 2EFJA 2PEIA 1M90Q 1YIJP 3OW2O 4BPHA 2K0XA 2DNWA 5EW5E 2L6EA 3CCUP 3DS2A 2N6YA 4F37A 1ACPA 4COCA 2AFDA 3EJBA 1QRJA 1N8RQ 2K2QA 1IMPA 1MZ8A 1UJZA 5F2NA 1M6EX 1GXGA 2FQ0A 1VQ9P 3B5IA 2GZEA 4IZ6A 2CNRA 2N98A 1M74A 4DG9A 2KORA 3HZQA 1AUMA 2QA4P 2VLPA 2FVEA 1VKUA 3CXCO 1RO0A 1ZMBA 1EMVA 2EIAA 2AVAA 2MF4A 2M8NA 7CEIA 5CZDB 2M8PA 1L0HA 2ERHA 2XZ1C 1EIAA 2LL8A 1YJ9P 1D1DA 2JB0A 5F2OA 3G21A 4QKOA 3CCRP 5HGLA 2KOSA 3H0DA 3H47A 2AFEA 3GZMA 2L4BA 3CCEP 2N50A 3G1IA 3DTJA 1KLPA 2FACA 3B4QA 2LKIA 3DS0A 1OR5A 2MY5A 1RO2A 2LF4A 1YI2P 4U0EA 2GZGA 4XFYA 1IUQA 2PEKA 2KOPA 3CCSP 3RG6C 2PEJA 2VSQA 3I56P 3E2DA 2JBGA 5HGNA 3U43A 3MGEA 3VRLC 3G1GA 2KWLA 1E6JP 2L9FA 4MRTC 2CG5B 4R0MA 4QNBA 1E0HA 1HY8A 2LIWA 1VQOP 1S72P 2JYLA 2KOOA 1NJIQ 3CMAP 2MVUA 4U0CA 1DNYA 1Z6MA 2OTJP 1L0IA 5JPAA 1YITP 4U0BA 1QVFO 1K9MQ 3DS5A 2LIUA 1VQ5P 2AF8A 2KOQA 2EHTA 2KG6A 3GJNA 1T8KA 4COPA 1Q86Q 2K93A 1KQSO 4CA3A 1JJ2O 1VQ4P 4M0IA 3CC7P 2M8LA 2L22A 2BUOA 2KG9A 3EJEA 2X2BA 2XXMA 3G28A 3G29A 3HYBA 2GYKA 2Z46A 5EJDA 3NY7B 1M1KQ 2JQ4A 2JYGA 2FQ1A 3DS3A 1QVGO 1AYIA 1A43A 1FR2A 2N5HA 1A8OA 2MVVA 1VQLP 4XFXA 2XZ0D 3GKLC 2KODA 2QNWA 3G4SP
chains in the Genus database with same CATH topology
1HQBA 3LMOA 2AFDA 2K0YA 3EJBA 3EJDA 2JGPA 2MY5A 1NQ4A 2JU2A 4BPGA 1F80D 1X3OA 5KP6B 2K2QA 2K92A 4HKGA 2GDXA 2CQ8A 2KOPA 2N5IA 3GZLA 2FQ0A 2VSQA 2KGDA 2KR5A 4IZ6A 2KWLA 2CGQA 2CNRA 2L0QA 4H2XC 2N98A 4DG9A 2FVAA 2L9FA 4MRTC 2LPKA 2CG5B 2KORA 2FADA 5KP8B 4R0MA 1HY8A 1DV5A 2LIWA 3RG2A 4H2YC 2KOOA 2FVEA 2MVUA 2LOLA 1DNYA 5KP7B 2FHSC 1L0IA 3CE7A 2KGEA 2MD9A 2KW2A 1VKUA 2GDWA 2KG8A 4NEOA 2LIUA 2AF8A 2AVAA 1AF8A 2KOQA 2MF4A 2EHTA 2LTEA 2ROQA 2FQ2A 4PWVB 2GDYA 5CZDB 2LMLA 1L0HA 2KG6A 2XZ1C 2LL8A 4BPFA 1T8KA 2K93A 2KGAA 2MR7A 4CA3A 2KOSA 5HVCA 2MR8A 4H2WC 2KGCA 2PNGA 2L22A 2KG9A 3EJEA 2K94A 2AFEA 2X2BA 3GZMA 2FAEA 2L4BA 5HV8A 5EJDA 3NY7B 2JQ4A 2FQ1A 2FVFA 2N50A 4BPHA 2M5RA 1KLPA 2N5HA 2K0XA 2FACA 2DNWA 2MVVA 2JU1A 2LKIA 2N6ZA 2EHSA 2XZ0D 4PXHB 2N6YA 1ACPA 1OR5A 2QNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  3LMO A;  2AFD A;  2K0Y A;  3EJB A;  3EJD A;  2JGP A;  2MY5 A;  1NQ4 A;  2JU2 A;  4BPG A;  1F80 D;  1X3O A;  5KP6 B;  2K2Q A;  2K92 A;  4HKG A;  2GDX A;  2CQ8 A;  2KOP A;  2N5I A;  3GZL A;  2FQ0 A;  2VSQ A;  2KGD A;  2KR5 A;  4IZ6 A;  2KWL A;  2CGQ A;  2CNR A;  2L0Q A;  4H2X C;  2N98 A;  4DG9 A;  2FVA A;  2L9F A;  4MRT C;  2LPK A;  2CG5 B;  2KOR A;  2FAD A;  5KP8 B;  4R0M A;  1HY8 A;  1DV5 A;  2LIW A;  3RG2 A;  4H2Y C;  2KOO A;  2FVE A;  2MVU A;  2LOL A;  1DNY A;  5KP7 B;  2FHS C;  1L0I A;  3CE7 A;  2KGE A;  2MD9 A;  2KW2 A;  1VKU A;  2GDW A;  2KG8 A;  4NEO A;  2LIU A;  2AF8 A;  2AVA A;  1AF8 A;  2KOQ A;  2MF4 A;  2EHT A;  2LTE A;  2ROQ A;  2FQ2 A;  4PWV B;  2GDY A;  5CZD B;  2LML A;  1L0H A;  2KG6 A;  2XZ1 C;  2LL8 A;  4BPF A;  1T8K A;  2K93 A;  2KGA A;  2MR7 A;  4CA3 A;  2KOS A;  5HVC A;  2MR8 A;  4H2W C;  2KGC A;  2PNG A;  2L22 A;  2KG9 A;  3EJE A;  2K94 A;  2AFE A;  2X2B A;  3GZM A;  2FAE A;  2L4B A;  5HV8 A;  5EJD A;  3NY7 B;  2JQ4 A;  2FQ1 A;  2FVF A;  2N50 A;  4BPH A;  2M5R A;  1KLP A;  2N5H A;  2K0X A;  2FAC A;  2DNW A;  2MVV A;  2JU1 A;  2LKI A;  2N6Z A;  2EHS A;  2XZ0 D;  4PXH B;  2N6Y A;  1ACP A;  1OR5 A;  2QNW A; 
#chains in the Genus database with same CATH topology
 2EG5 A;  3CCM P;  3LMO A;  2K0Y A;  3EJD A;  1ZNV A;  2PEQ A;  4U0A A;  2OTL P;  1NQ4 A;  2JU2 A;  2K92 A;  4IPY A;  4HKG A;  2N5I A;  3GZL A;  2K5X A;  2WPT A;  5DCK A;  2L0Q A;  4H2X C;  4PH0 A;  2E1M A;  3I55 P;  2LPK A;  5KP8 B;  1DV5 A;  4U0F A;  4H2Y C;  3G0V A;  2LOL A;  1BXI A;  3CCQ P;  2FHS C;  5BS1 A;  2KGE A;  1YJN P;  1EOQ A;  2VLN A;  1M6N A;  2PEN A;  1VQ7 P;  4PWV B;  1KD1 Q;  1VQ8 P;  4XFZ A;  1UNK A;  1VQM P;  4GR6 A;  3G26 A;  4PH1 A;  1RNI A;  2KGA A;  2MR7 A;  3CD6 P;  2OAR A;  2PEO A;  5HVC A;  2MR8 A;  3DS1 A;  2PNG A;  2K94 A;  3CCL P;  2ONT A;  5HV8 A;  4GR2 A;  5I4T G;  1Q81 Q;  3NTE A;  3CME P;  2FVF A;  2GZF A;  2M5R A;  3CCJ P;  2XV6 A;  2PEM A;  2GZI A;  2JU1 A;  2N6Z A;  2EHS A;  4PXH B;  2DGY A;  1BAJ A;  1HQB A;  1KC8 Q;  4WYM A;  2JGP A;  1YJW P;  5BS2 A;  4BPG A;  1F80 D;  2PY8 A;  2K0D X;  1X3O A;  5KP6 B;  2QEX P;  2GDX A;  2CQ8 A;  1VQK P;  3CCV P;  2VLO A;  1VQP P;  3G6E P;  2CWO A;  4XRO A;  2GZJ A;  2P9X A;  2KGD A;  2KR5 A;  2CGQ A;  3H4E A;  1VHN A;  2JAZ A;  2FVA A;  1IMQ A;  2FAD A;  3P05 A;  1W2B O;  1Q7Y Q;  5HGO A;  2Z44 A;  3Q20 A;  3RG2 A;  1GXH A;  1YHQ P;  4UHP B;  1Q82 Q;  5KP7 B;  1K8A Q;  2VLQ A;  3G71 P;  3CE7 A;  2MD9 A;  1K73 Q;  2KW2 A;  2GDW A;  3WBH A;  2KG8 A;  4NEO A;  4XRQ A;  1CEI A;  3LRY A;  2NO8 A;  1AF8 A;  3CC2 P;  2LTE A;  1VQ6 P;  1K30 A;  2ROQ A;  2FQ2 A;  2GDY A;  2LML A;  3CC4 P;  2XT1 A;  4BPF A;  3M1M A;  3DPH A;  4U0D A;  2BHV A;  5HGM A;  2Z45 A;  3DS4 A;  5F2K A;  3CPW O;  1GPJ A;  4H2W C;  2KGC A;  1VQN P;  2JO0 A;  2FAE A;  2EFJ A;  2PEI A;  1M90 Q;  1YIJ P;  3OW2 O;  4BPH A;  2K0X A;  2DNW A;  5EW5 E;  2L6E A;  3CCU P;  3DS2 A;  2N6Y A;  4F37 A;  1ACP A;  4COC A;  2AFD A;  3EJB A;  1QRJ A;  1N8R Q;  2K2Q A;  1IMP A;  1MZ8 A;  1UJZ A;  5F2N A;  1M6E X;  1GXG A;  2FQ0 A;  1VQ9 P;  3B5I A;  2GZE A;  4IZ6 A;  2CNR A;  2N98 A;  1M74 A;  4DG9 A;  2KOR A;  3HZQ A;  1AUM A;  2QA4 P;  2VLP A;  2FVE A;  1VKU A;  3CXC O;  1RO0 A;  1ZMB A;  1EMV A;  2EIA A;  2AVA A;  2MF4 A;  2M8N A;  7CEI A;  5CZD B;  2M8P A;  1L0H A;  2ERH A;  2XZ1 C;  1EIA A;  2LL8 A;  1YJ9 P;  1D1D A;  2JB0 A;  5F2O A;  3G21 A;  4QKO A;  3CCR P;  5HGL A;  2KOS A;  3H0D A;  3H47 A;  2AFE A;  3GZM A;  2L4B A;  3CCE P;  2N50 A;  3G1I A;  3DTJ A;  1KLP A;  2FAC A;  3B4Q A;  2LKI A;  3DS0 A;  1OR5 A;  2MY5 A;  1RO2 A;  2LF4 A;  1YI2 P;  4U0E A;  2GZG A;  4XFY A;  1IUQ A;  2PEK A;  2KOP A;  3CCS P;  3RG6 C;  2PEJ A;  2VSQ A;  3I56 P;  3E2D A;  2JBG A;  5HGN A;  3U43 A;  3MGE A;  3VRL C;  3G1G A;  2KWL A;  1E6J P;  2L9F A;  4MRT C;  2CG5 B;  4R0M A;  4QNB A;  1E0H A;  1HY8 A;  2LIW A;  1VQO P;  1S72 P;  2JYL A;  2KOO A;  1NJI Q;  3CMA P;  2MVU A;  4U0C A;  1DNY A;  1Z6M A;  2OTJ P;  1L0I A;  5JPA A;  1YIT P;  4U0B A;  1QVF O;  1K9M Q;  3DS5 A;  2LIU A;  1VQ5 P;  2AF8 A;  2KOQ A;  2EHT A;  2KG6 A;  3GJN A;  1T8K A;  4COP A;  1Q86 Q;  2K93 A;  1KQS O;  4CA3 A;  1JJ2 O;  1VQ4 P;  4M0I A;  3CC7 P;  2M8L A;  2L22 A;  2BUO A;  2KG9 A;  3EJE A;  2X2B A;  2XXM A;  3G28 A;  3G29 A;  3HYB A;  2GYK A;  2Z46 A;  5EJD A;  3NY7 B;  1M1K Q;  2JQ4 A;  2JYG A;  2FQ1 A;  3DS3 A;  1QVG O;  1AYI A;  1A43 A;  1FR2 A;  2N5H A;  1A8O A;  2MVV A;  1VQL P;  4XFX A;  2XZ0 D;  3GKL C;  2KOD A;  2QNW A;  3G4S P; 
#chains in the Genus database with same CATH homology
 1HQB A;  3LMO A;  2AFD A;  2K0Y A;  3EJB A;  3EJD A;  2JGP A;  2MY5 A;  1NQ4 A;  2JU2 A;  4BPG A;  1F80 D;  1X3O A;  5KP6 B;  2K2Q A;  2K92 A;  4HKG A;  2GDX A;  2CQ8 A;  2KOP A;  2N5I A;  3GZL A;  2FQ0 A;  2VSQ A;  2KGD A;  2KR5 A;  4IZ6 A;  2KWL A;  2CGQ A;  2CNR A;  2L0Q A;  4H2X C;  2N98 A;  4DG9 A;  2FVA A;  2L9F A;  4MRT C;  2LPK A;  2CG5 B;  2KOR A;  2FAD A;  5KP8 B;  4R0M A;  1HY8 A;  1DV5 A;  2LIW A;  3RG2 A;  4H2Y C;  2KOO A;  2FVE A;  2MVU A;  2LOL A;  1DNY A;  5KP7 B;  2FHS C;  1L0I A;  3CE7 A;  2KGE A;  2MD9 A;  2KW2 A;  1VKU A;  2GDW A;  2KG8 A;  4NEO A;  2LIU A;  2AF8 A;  2AVA A;  1AF8 A;  2KOQ A;  2MF4 A;  2EHT A;  2LTE A;  2ROQ A;  2FQ2 A;  4PWV B;  2GDY A;  5CZD B;  2LML A;  1L0H A;  2KG6 A;  2XZ1 C;  2LL8 A;  4BPF A;  1T8K A;  2K93 A;  2KGA A;  2MR7 A;  4CA3 A;  2KOS A;  5HVC A;  2MR8 A;  4H2W C;  2KGC A;  2PNG A;  2L22 A;  2KG9 A;  3EJE A;  2K94 A;  2AFE A;  2X2B A;  3GZM A;  2FAE A;  2L4B A;  5HV8 A;  5EJD A;  3NY7 B;  2JQ4 A;  2FQ1 A;  2FVF A;  2N50 A;  4BPH A;  2M5R A;  1KLP A;  2N5H A;  2K0X A;  2FAC A;  2DNW A;  2MVV A;  2JU1 A;  2LKI A;  2N6Z A;  2EHS A;  2XZ0 D;  4PXH B;  2N6Y A;  1ACP A;  1OR5 A;  2QNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...