2EHSA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lipid transport
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehsA00
5HVCA 2DNWA 4PWVB 2N6ZA 2KG6A 2CQ8A 2LKIA 2FAEA 2MVVA 2KG9A 4PXHB 2GDYA 2KWLA 3GZMA 2AFDA 2FVFA 2KOSA 3EJDA 2AVAA 2JQ4A 2L22A 2N98A 4HKGA 2JU2A 2GDWA 2LL8A 5CZDB 5EJDA 2CNRA 4R0MA 2EHSA 2MVUA 2MY5A 2K0YA 2KGDA 1KLPA 2CG5B 2K92A 2KOPA 2K2QA 2FADA 2JU1A 1L0HA 2LIWA 2JGPA 2VSQA 2FVEA 3EJEA 2X2BA 4MRTC 5KP7B 2KOOA 2K94A 2LOLA 1NQ4A 2FVAA 2N5HA 2KG8A 1ACPA 4H2WC 2MD9A 2FQ1A 3GZLA 2L4BA 1F80D 2N6YA 2K93A 5HV8A 2ROQA 4CA3A 1X3OA 4BPHA 2KGEA 1AF8A 2AF8A 1HY8A 2N5IA 2GDXA 4IZ6A 2LMLA 3NY7B 1HQBA 2FQ2A 4H2YC 2FACA 2MR7A 1DNYA 2LTEA 5KP8B 2PNGA 2MR8A 3EJBA 2AFEA 3LMOA 2FHSC 3CE7A 2KW2A 2QNWA 2MF4A 2K0XA 2XZ1C 2L9FA 4BPGA 2LPKA 4H2XC 2XZ0D 2KGCA 4DG9A 1DV5A 1VKUA 2KR5A 2FQ0A 2CGQA 2LIUA 4NEOA 1OR5A 1T8KA 5KP6B 2N50A 3RG2A 2L0QA 2KORA 2KGAA 2KOQA 1L0IA 4BPFA 2EHTA 2M5RA
chains in the Genus database with same CATH superfamily
5HVCA 2M8PA 3LRYA 2EG5A 2MVVA 3GZMA 3CCMP 4U0FA 1JJ2O 2L22A 5DCKA 4HKGA 3CCQP 2JU2A 1ZMBA 3GKLC 2PEQA 1GPJA 2GDWA 2JYLA 1EIAA 1N8RQ 2MY5A 2K0YA 3CPWO 2KGDA 2CG5B 2PEOA 2KOPA 2K2QA 3CC2P 2JU1A 1IMPA 4MRTC 4IPYA 2GZGA 2JB0A 3CC7P 1A43A 4COPA 5I4TG 2ROQA 2NO8A 1Q82Q 2KGEA 2PEMA 2GDXA 4U0DA 4IZ6A 2LMLA 1KD1Q 2GZFA 3NY7B 4XFZA 2JAZA 2FACA 2GZIA 1DNYA 4QNBA 1QVFO 3CE7A 5EW5E 2XZ1C 1FR2A 1KC8Q 1IUQA 3B5IA 4F37A 1DV5A 2ERHA 3G29A 3P05A 2LIUA 2ONTA 1OR5A 2XXMA 3DS1A 2KORA 2KOQA 1L0IA 2PEIA 1K8AQ 1M1KQ 2PEKA 3CMAP 2JBGA 2VLNA 2KG6A 2FAEA 3WBHA 2KG9A 2K5XA 3HYBA 1AYIA 1D1DA 2AFDA 2K0DX 1YITP 2N98A 1E6JP 2M8LA 1YJWP 2LL8A 2Z45A 4R0MA 4XFYA 2EHSA 2MVUA 3G4SP 2Z44A 1VQNP 2K92A 1NJIQ 2FADA 3HZQA 2XV6A 2FVEA 2Z46A 2X2BA 5KP7B 1VQLP 2N5HA 3OW2O 3DS5A 3CD6P 5JPAA 4COCA 2K93A 3B4QA 2LF4A 5HV8A 2PEJA 1QVGO 5HGNA 2DGYA 3RG6C 1VQ5P 3CCRP 3DPHA 3H0DA 3GJNA 4M0IA 2VLQA 4XROA 3H47A 2WPTA 2MR8A 2PY8A 2AFEA 3I55P 2FHSC 2K0XA 2L9FA 4XRQA 3G26A 3U43A 5F2KA 1GXHA 1IMQA 4NEOA 1RNIA 2OTLP 4BPFA 3DS3A 3CCEP 1VQ9P 3CCVP 3M1MA 1Q7YQ 2EFJA 4PWVB 1E0HA 3I56P 4U0CA 1YI2P 4PXHB 2KWLA 3EJDA 2AVAA 1S72P 1VQMP 1M6NA 5CZDB 3E2DA 1KQSO 3CCLP 2CNRA 4GR6A 1EOQA 1BAJA 1RO2A 1VQPP 1EMVA 4PH1A 1W2BO 2JGPA 2VSQA 3EJEA 2KOOA 4U0BA 4QKOA 1NQ4A 5HGMA 3CCJP 1A8OA 2KG8A 2QEXP 2VLOA 2MD9A 3GZLA 4UHPB 1F80D 2N6YA 1QRJA 3CCUP 2OTJP 5HGOA 2BUOA 1AF8A 1VQOP 2AF8A 1HY8A 1VQ8P 3G1GA 2P9XA 1HQBA 2FQ2A 4H2YC 1K9MQ 2MR7A 5BS1A 2KODA 5KP8B 3EJBA 3LMOA 2BHVA 2MF4A 2GZJA 4PH0A 2LPKA 4WYMA 4H2XC 2KGCA 2L6EA 2GYKA 2OARA 2KR5A 1M90Q 2FQ0A 5KP6B 2N50A 3RG2A 1YJ9P 2M5RA 3G0VA 1CEIA 5HGLA 1RO0A 3G21A 2DNWA 2N6ZA 3CXCO 2LKIA 2CQ8A 2M8NA 3DS4A 3H4EA 7CEIA 1VQ7P 2GDYA 1YJNP 1BXIA 4U0AA 1YHQP 2FVFA 2KOSA 2JQ4A 3Q20A 1VQKP 1K73Q 1Q81Q 1Q86Q 5EJDA 1GXGA 4GR2A 3G28A 3CMEP 3G1IA 3MGEA 1KLPA 1UJZA 2GZEA 2JYGA 1L0HA 5F2OA 2LIWA 3CC4P 2K94A 2LOLA 3DTJA 1VQ6P 2FVAA 3CCSP 1ACPA 4H2WC 4XFXA 2FQ1A 2L4BA 1VQ4P 4CA3A 2JO0A 1X3OA 2XT1A 4BPHA 1Z6MA 1MZ8A 2N5IA 1UNKA 2CWOA 3G71P 3DS0A 5F2NA 4U0EA 1M74A 2LTEA 2PNGA 3DS2A 2VLPA 2KW2A 2E1MA 2QNWA 4BPGA 1K30A 3NTEA 5BS2A 2QA4P 2XZ0D 3VRLC 4DG9A 1VHNA 1ZNVA 2PENA 1VKUA 2EIAA 2CGQA 1T8KA 3G6EP 1YIJP 1AUMA 1M6EX 2L0QA 2KGAA 2EHTA
chains in the Genus database with same CATH topology
5HVCA 2DNWA 4PWVB 2N6ZA 2KG6A 2CQ8A 2LKIA 2FAEA 2MVVA 2KG9A 4PXHB 2GDYA 2KWLA 3GZMA 2AFDA 2FVFA 2KOSA 3EJDA 2AVAA 2JQ4A 2L22A 2N98A 4HKGA 2JU2A 2GDWA 2LL8A 5CZDB 5EJDA 2CNRA 4R0MA 2EHSA 2MVUA 2MY5A 2K0YA 2KGDA 1KLPA 2CG5B 2K92A 2KOPA 2K2QA 2FADA 2JU1A 1L0HA 2LIWA 2JGPA 2VSQA 2FVEA 3EJEA 2X2BA 4MRTC 5KP7B 2KOOA 2K94A 2LOLA 1NQ4A 2FVAA 2N5HA 2KG8A 1ACPA 4H2WC 2MD9A 2FQ1A 3GZLA 2L4BA 1F80D 2N6YA 2K93A 5HV8A 2ROQA 4CA3A 1X3OA 4BPHA 2KGEA 1AF8A 2AF8A 1HY8A 2N5IA 2GDXA 4IZ6A 2LMLA 3NY7B 1HQBA 2FQ2A 4H2YC 2FACA 2MR7A 1DNYA 2LTEA 5KP8B 2PNGA 2MR8A 3EJBA 2AFEA 3LMOA 2FHSC 3CE7A 2KW2A 2QNWA 2MF4A 2K0XA 2XZ1C 2L9FA 4BPGA 2LPKA 4H2XC 2XZ0D 2KGCA 4DG9A 1DV5A 1VKUA 2KR5A 2FQ0A 2CGQA 2LIUA 4NEOA 1OR5A 1T8KA 5KP6B 2N50A 3RG2A 2L0QA 2KORA 2KGAA 2KOQA 1L0IA 4BPFA 2EHTA 2M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HVC A;  2DNW A;  4PWV B;  2N6Z A;  2KG6 A;  2CQ8 A;  2LKI A;  2FAE A;  2MVV A;  2KG9 A;  4PXH B;  2GDY A;  2KWL A;  3GZM A;  2AFD A;  2FVF A;  2KOS A;  3EJD A;  2AVA A;  2JQ4 A;  2L22 A;  2N98 A;  4HKG A;  2JU2 A;  2GDW A;  2LL8 A;  5CZD B;  5EJD A;  2CNR A;  4R0M A;  2EHS A;  2MVU A;  2MY5 A;  2K0Y A;  2KGD A;  1KLP A;  2CG5 B;  2K92 A;  2KOP A;  2K2Q A;  2FAD A;  2JU1 A;  1L0H A;  2LIW A;  2JGP A;  2VSQ A;  2FVE A;  3EJE A;  2X2B A;  4MRT C;  5KP7 B;  2KOO A;  2K94 A;  2LOL A;  1NQ4 A;  2FVA A;  2N5H A;  2KG8 A;  1ACP A;  4H2W C;  2MD9 A;  2FQ1 A;  3GZL A;  2L4B A;  1F80 D;  2N6Y A;  2K93 A;  5HV8 A;  2ROQ A;  4CA3 A;  1X3O A;  4BPH A;  2KGE A;  1AF8 A;  2AF8 A;  1HY8 A;  2N5I A;  2GDX A;  4IZ6 A;  2LML A;  3NY7 B;  1HQB A;  2FQ2 A;  4H2Y C;  2FAC A;  2MR7 A;  1DNY A;  2LTE A;  5KP8 B;  2PNG A;  2MR8 A;  3EJB A;  2AFE A;  3LMO A;  2FHS C;  3CE7 A;  2KW2 A;  2QNW A;  2MF4 A;  2K0X A;  2XZ1 C;  2L9F A;  4BPG A;  2LPK A;  4H2X C;  2XZ0 D;  2KGC A;  4DG9 A;  1DV5 A;  1VKU A;  2KR5 A;  2FQ0 A;  2CGQ A;  2LIU A;  4NEO A;  1OR5 A;  1T8K A;  5KP6 B;  2N50 A;  3RG2 A;  2L0Q A;  2KOR A;  2KGA A;  2KOQ A;  1L0I A;  4BPF A;  2EHT A;  2M5R A; 
#chains in the Genus database with same CATH topology
 5HVC A;  2M8P A;  3LRY A;  2EG5 A;  2MVV A;  3GZM A;  3CCM P;  4U0F A;  1JJ2 O;  2L22 A;  5DCK A;  4HKG A;  3CCQ P;  2JU2 A;  1ZMB A;  3GKL C;  2PEQ A;  1GPJ A;  2GDW A;  2JYL A;  1EIA A;  1N8R Q;  2MY5 A;  2K0Y A;  3CPW O;  2KGD A;  2CG5 B;  2PEO A;  2KOP A;  2K2Q A;  3CC2 P;  2JU1 A;  1IMP A;  4MRT C;  4IPY A;  2GZG A;  2JB0 A;  3CC7 P;  1A43 A;  4COP A;  5I4T G;  2ROQ A;  2NO8 A;  1Q82 Q;  2KGE A;  2PEM A;  2GDX A;  4U0D A;  4IZ6 A;  2LML A;  1KD1 Q;  2GZF A;  3NY7 B;  4XFZ A;  2JAZ A;  2FAC A;  2GZI A;  1DNY A;  4QNB A;  1QVF O;  3CE7 A;  5EW5 E;  2XZ1 C;  1FR2 A;  1KC8 Q;  1IUQ A;  3B5I A;  4F37 A;  1DV5 A;  2ERH A;  3G29 A;  3P05 A;  2LIU A;  2ONT A;  1OR5 A;  2XXM A;  3DS1 A;  2KOR A;  2KOQ A;  1L0I A;  2PEI A;  1K8A Q;  1M1K Q;  2PEK A;  3CMA P;  2JBG A;  2VLN A;  2KG6 A;  2FAE A;  3WBH A;  2KG9 A;  2K5X A;  3HYB A;  1AYI A;  1D1D A;  2AFD A;  2K0D X;  1YIT P;  2N98 A;  1E6J P;  2M8L A;  1YJW P;  2LL8 A;  2Z45 A;  4R0M A;  4XFY A;  2EHS A;  2MVU A;  3G4S P;  2Z44 A;  1VQN P;  2K92 A;  1NJI Q;  2FAD A;  3HZQ A;  2XV6 A;  2FVE A;  2Z46 A;  2X2B A;  5KP7 B;  1VQL P;  2N5H A;  3OW2 O;  3DS5 A;  3CD6 P;  5JPA A;  4COC A;  2K93 A;  3B4Q A;  2LF4 A;  5HV8 A;  2PEJ A;  1QVG O;  5HGN A;  2DGY A;  3RG6 C;  1VQ5 P;  3CCR P;  3DPH A;  3H0D A;  3GJN A;  4M0I A;  2VLQ A;  4XRO A;  3H47 A;  2WPT A;  2MR8 A;  2PY8 A;  2AFE A;  3I55 P;  2FHS C;  2K0X A;  2L9F A;  4XRQ A;  3G26 A;  3U43 A;  5F2K A;  1GXH A;  1IMQ A;  4NEO A;  1RNI A;  2OTL P;  4BPF A;  3DS3 A;  3CCE P;  1VQ9 P;  3CCV P;  3M1M A;  1Q7Y Q;  2EFJ A;  4PWV B;  1E0H A;  3I56 P;  4U0C A;  1YI2 P;  4PXH B;  2KWL A;  3EJD A;  2AVA A;  1S72 P;  1VQM P;  1M6N A;  5CZD B;  3E2D A;  1KQS O;  3CCL P;  2CNR A;  4GR6 A;  1EOQ A;  1BAJ A;  1RO2 A;  1VQP P;  1EMV A;  4PH1 A;  1W2B O;  2JGP A;  2VSQ A;  3EJE A;  2KOO A;  4U0B A;  4QKO A;  1NQ4 A;  5HGM A;  3CCJ P;  1A8O A;  2KG8 A;  2QEX P;  2VLO A;  2MD9 A;  3GZL A;  4UHP B;  1F80 D;  2N6Y A;  1QRJ A;  3CCU P;  2OTJ P;  5HGO A;  2BUO A;  1AF8 A;  1VQO P;  2AF8 A;  1HY8 A;  1VQ8 P;  3G1G A;  2P9X A;  1HQB A;  2FQ2 A;  4H2Y C;  1K9M Q;  2MR7 A;  5BS1 A;  2KOD A;  5KP8 B;  3EJB A;  3LMO A;  2BHV A;  2MF4 A;  2GZJ A;  4PH0 A;  2LPK A;  4WYM A;  4H2X C;  2KGC A;  2L6E A;  2GYK A;  2OAR A;  2KR5 A;  1M90 Q;  2FQ0 A;  5KP6 B;  2N50 A;  3RG2 A;  1YJ9 P;  2M5R A;  3G0V A;  1CEI A;  5HGL A;  1RO0 A;  3G21 A;  2DNW A;  2N6Z A;  3CXC O;  2LKI A;  2CQ8 A;  2M8N A;  3DS4 A;  3H4E A;  7CEI A;  1VQ7 P;  2GDY A;  1YJN P;  1BXI A;  4U0A A;  1YHQ P;  2FVF A;  2KOS A;  2JQ4 A;  3Q20 A;  1VQK P;  1K73 Q;  1Q81 Q;  1Q86 Q;  5EJD A;  1GXG A;  4GR2 A;  3G28 A;  3CME P;  3G1I A;  3MGE A;  1KLP A;  1UJZ A;  2GZE A;  2JYG A;  1L0H A;  5F2O A;  2LIW A;  3CC4 P;  2K94 A;  2LOL A;  3DTJ A;  1VQ6 P;  2FVA A;  3CCS P;  1ACP A;  4H2W C;  4XFX A;  2FQ1 A;  2L4B A;  1VQ4 P;  4CA3 A;  2JO0 A;  1X3O A;  2XT1 A;  4BPH A;  1Z6M A;  1MZ8 A;  2N5I A;  1UNK A;  2CWO A;  3G71 P;  3DS0 A;  5F2N A;  4U0E A;  1M74 A;  2LTE A;  2PNG A;  3DS2 A;  2VLP A;  2KW2 A;  2E1M A;  2QNW A;  4BPG A;  1K30 A;  3NTE A;  5BS2 A;  2QA4 P;  2XZ0 D;  3VRL C;  4DG9 A;  1VHN A;  1ZNV A;  2PEN A;  1VKU A;  2EIA A;  2CGQ A;  1T8K A;  3G6E P;  1YIJ P;  1AUM A;  1M6E X;  2L0Q A;  2KGA A;  2EHT A; 
#chains in the Genus database with same CATH homology
 5HVC A;  2DNW A;  4PWV B;  2N6Z A;  2KG6 A;  2CQ8 A;  2LKI A;  2FAE A;  2MVV A;  2KG9 A;  4PXH B;  2GDY A;  2KWL A;  3GZM A;  2AFD A;  2FVF A;  2KOS A;  3EJD A;  2AVA A;  2JQ4 A;  2L22 A;  2N98 A;  4HKG A;  2JU2 A;  2GDW A;  2LL8 A;  5CZD B;  5EJD A;  2CNR A;  4R0M A;  2EHS A;  2MVU A;  2MY5 A;  2K0Y A;  2KGD A;  1KLP A;  2CG5 B;  2K92 A;  2KOP A;  2K2Q A;  2FAD A;  2JU1 A;  1L0H A;  2LIW A;  2JGP A;  2VSQ A;  2FVE A;  3EJE A;  2X2B A;  4MRT C;  5KP7 B;  2KOO A;  2K94 A;  2LOL A;  1NQ4 A;  2FVA A;  2N5H A;  2KG8 A;  1ACP A;  4H2W C;  2MD9 A;  2FQ1 A;  3GZL A;  2L4B A;  1F80 D;  2N6Y A;  2K93 A;  5HV8 A;  2ROQ A;  4CA3 A;  1X3O A;  4BPH A;  2KGE A;  1AF8 A;  2AF8 A;  1HY8 A;  2N5I A;  2GDX A;  4IZ6 A;  2LML A;  3NY7 B;  1HQB A;  2FQ2 A;  4H2Y C;  2FAC A;  2MR7 A;  1DNY A;  2LTE A;  5KP8 B;  2PNG A;  2MR8 A;  3EJB A;  2AFE A;  3LMO A;  2FHS C;  3CE7 A;  2KW2 A;  2QNW A;  2MF4 A;  2K0X A;  2XZ1 C;  2L9F A;  4BPG A;  2LPK A;  4H2X C;  2XZ0 D;  2KGC A;  4DG9 A;  1DV5 A;  1VKU A;  2KR5 A;  2FQ0 A;  2CGQ A;  2LIU A;  4NEO A;  1OR5 A;  1T8K A;  5KP6 B;  2N50 A;  3RG2 A;  2L0Q A;  2KOR A;  2KGA A;  2KOQ A;  1L0I A;  4BPF A;  2EHT A;  2M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...