2EHSA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 1)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
75
structure length
75
Chain Sequence
b'SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lipid transport
total genus 26
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehsA00
2JQ4A 4DG9A 2N98A 4BPFA 1DV5A 2FACA 2K2QA 2KG8A 2JU1A 4BPGA 2N5IA 2L9FA 2FVAA 4HKGA 5EJDA 2KR5A 2CQ8A 2KG9A 2LTEA 5KP8B 2CG5B 2K94A 2M5RA 3EJDA 5KP7B 2K0YA 1L0IA 2VSQA 2KOSA 2MR7A 2LPKA 2K92A 2N5HA 3GZMA 2KOOA 2FQ0A 2FVFA 2N6ZA 2KWLA 2LOLA 2AVAA 2GDXA 3NY7B 4H2XC 1HQBA 2QNWA 1T8KA 2N6YA 2MVVA 2DNWA 2CGQA 2FQ2A 2LKIA 4H2WC 2MF4A 2AFDA 2KOPA 1OR5A 1KLPA 2MD9A 3LMOA 3EJBA 2X2BA 2EHTA 2MY5A 2N50A 3EJEA 4PXHB 2KOQA 1AF8A 2LIUA 2K93A 3RG2A 2FHSC 2L4BA 4H2YC 1F80D 4NEOA 2MVUA 2XZ0D 2LMLA 2KGEA 2KGDA 4IZ6A 2JU2A 2K0XA 2CNRA 4PWVB 1DNYA 1ACPA 2FADA 2PNGA 2KGAA 2FQ1A 2EHSA 2AF8A 3CE7A 5CZDB 2LIWA 4BPHA 2KG6A 5KP6B 2GDWA 1X3OA 1HY8A 2GDYA 2L22A 2MR8A 2KW2A 4R0MA 2L0QA 2FAEA 3GZLA 5HV8A 2KGCA 4MRTC 1L0HA 1VKUA 2AFEA 2ROQA 2FVEA 2KORA 1NQ4A 4CA3A 5HVCA 2JGPA 2XZ1C 2LL8A
chains in the Genus database with same CATH superfamily
3GJNA 1K9MQ 1VQMP 2NO8A 1YJWP 2N98A 2FACA 3VRLC 4F37A 1VQNP 5JPAA 2QA4P 4XFYA 2JAZA 2N5HA 4U0EA 2KOOA 2FVFA 1KQSO 2AVAA 2GDXA 4H2XC 2DNWA 4U0AA 2CGQA 3DTJA 2LKIA 3Q20A 2L6EA 1RO2A 1OR5A 1YITP 2MD9A 1YI2P 2ERHA 2GYKA 2JYGA 1YJ9P 1AF8A 2LIUA 1K73Q 2K93A 2L4BA 4H2YC 2MVUA 2KODA 3B4QA 3CCLP 2JU2A 3CMEP 2BUOA 3CCSP 2PEOA 5CZDB 2KG6A 1VQ7P 3CCQP 5KP6B 5F2OA 3WBHA 2L22A 1K8AQ 2K0DX 2L0QA 1VQLP 2M8NA 5HV8A 5F2KA 5HGMA 1AUMA 3H4EA 3DS3A 1N8RQ 2XT1A 2K5XA 4CA3A 5HVCA 2JGPA 2VLNA 4DG9A 1E0HA 4WYMA 3DS4A 4COCA 2KR5A 5DCKA 3H0DA 1EIAA 2M5RA 3CXCO 4XROA 1L0IA 5I4TG 1VQOP 2FQ0A 2LOLA 3NY7B 2VLOA 3CCEP 1T8KA 2M8PA 4COPA 1M90Q 2MVVA 2GZIA 2Z45A 2M8LA 4H2WC 1IMQA 2MF4A 1AYIA 2E1MA 1M1KQ 2ONTA 4GR2A 1BXIA 3EJBA 2X2BA 4PH1A 2CWOA 2EHTA 2MY5A 4PXHB 1KC8Q 2WPTA 1W2BO 2QEXP 3CPWO 2JO0A 2PEMA 2GZJA 2KGDA 1FR2A 2CNRA 2EIAA 1ACPA 1YHQP 1A8OA 2KGAA 2EHSA 2AF8A 3CE7A 1IMPA 4BPHA 2PY8A 2JYLA 1VQ5P 2GDWA 2BHVA 1A43A 1UJZA 2KW2A 4QNBA 1L0HA 2AFEA 1NQ4A 1M6EX 3RG2A 2XZ1C 2LL8A 3CD6P 3CCRP 2Z46A 1JJ2O 3HYBA 4BPFA 2K2QA 2L9FA 2FVAA 3U43A 3CCUP 1VQPP 2CQ8A 2LTEA 5KP8B 1EMVA 2CG5B 1QVGO 3EJDA 1VQ9P 3CC2P 3G26A 4QKOA 2KOSA 2MR7A 4GR6A 1E6JP 1BAJA 2N6ZA 2KWLA 2QNWA 1RNIA 1ZMBA 2DGYA 4XRQA 2FQ2A 1UNKA 3M1MA 1Q81Q 4XFXA 3CCJP 2AFDA 4M0IA 1KLPA 5HGNA 5F2NA 3G1GA 1VQ8P 2N50A 3EJEA 1VHNA 3GKLC 2LF4A 5BS1A 3DS5A 2KOQA 5HGOA 1YJNP 4U0DA 1MZ8A 1NJIQ 1Z6MA 3RG6C 2LMLA 3HZQA 3H47A 1M74A 1DNYA 3CMAP 2Z44A 3G1IA 2OTLP 3LRYA 2LIWA 1QRJA 1D1DA 1X3OA 1HY8A 4R0MA 2FAEA 4UHPB 3G4SP 2GZGA 2PEQA 1VKUA 1KD1Q 2FVEA 2JQ4A 2GZEA 2P9XA 1K30A 1DV5A 3CC4P 2KG8A 2PEKA 2JB0A 2JU1A 4BPGA 2N5IA 2PENA 4HKGA 5EJDA 3CC7P 2KG9A 5EW5E 2K94A 3E2DA 5KP7B 2K0YA 2JBGA 3DPHA 2VSQA 1ZNVA 7CEIA 2LPKA 2K92A 3GZMA 4XFZA 3P05A 1Q82Q 3B5IA 1GXGA 1Q86Q 4PH0A 2EG5A 1EOQA 1HQBA 2EFJA 2N6YA 3G28A 2XXMA 2VLPA 1M6NA 4U0CA 3I55P 5HGLA 2KOPA 1GXHA 3LMOA 1CEIA 2OTJP 4U0FA 4U0BA 1Q7YQ 1QVFO 3G6EP 1IUQA 3G29A 3OW2O 2FHSC 4IPYA 4NEOA 1F80D 3G71P 2XZ0D 1GPJA 1YIJP 2KGEA 2OARA 4IZ6A 2K0XA 4PWVB 1VQ4P 1RO0A 2FADA 2PNGA 1VQ6P 2FQ1A 2PEIA 3G21A 3G0VA 3I56P 3MGEA 3NTEA 3DS0A 2GDYA 2MR8A 2VLQA 1VQKP 5BS2A 3GZLA 3DS2A 2PEJA 1S72P 2XV6A 2KGCA 4MRTC 2ROQA 2KORA 3DS1A 2GZFA 3CCVP 3CCMP
chains in the Genus database with same CATH topology
2JQ4A 4DG9A 2N98A 4BPFA 1DV5A 2FACA 2K2QA 2KG8A 2JU1A 4BPGA 2N5IA 2L9FA 2FVAA 4HKGA 5EJDA 2KR5A 2CQ8A 2KG9A 2LTEA 5KP8B 2CG5B 2K94A 2M5RA 3EJDA 5KP7B 2K0YA 1L0IA 2VSQA 2KOSA 2MR7A 2LPKA 2K92A 2N5HA 3GZMA 2KOOA 2FQ0A 2FVFA 2N6ZA 2KWLA 2LOLA 2AVAA 2GDXA 3NY7B 4H2XC 1HQBA 2QNWA 1T8KA 2N6YA 2MVVA 2DNWA 2CGQA 2FQ2A 2LKIA 4H2WC 2MF4A 2AFDA 2KOPA 1OR5A 1KLPA 2MD9A 3LMOA 3EJBA 2X2BA 2EHTA 2MY5A 2N50A 3EJEA 4PXHB 2KOQA 1AF8A 2LIUA 2K93A 3RG2A 2FHSC 2L4BA 4H2YC 1F80D 4NEOA 2MVUA 2XZ0D 2LMLA 2KGEA 2KGDA 4IZ6A 2JU2A 2K0XA 2CNRA 4PWVB 1DNYA 1ACPA 2FADA 2PNGA 2KGAA 2FQ1A 2EHSA 2AF8A 3CE7A 5CZDB 2LIWA 4BPHA 2KG6A 5KP6B 2GDWA 1X3OA 1HY8A 2GDYA 2L22A 2MR8A 2KW2A 4R0MA 2L0QA 2FAEA 3GZLA 5HV8A 2KGCA 4MRTC 1L0HA 1VKUA 2AFEA 2ROQA 2FVEA 2KORA 1NQ4A 4CA3A 5HVCA 2JGPA 2XZ1C 2LL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ4 A;  4DG9 A;  2N98 A;  4BPF A;  1DV5 A;  2FAC A;  2K2Q A;  2KG8 A;  2JU1 A;  4BPG A;  2N5I A;  2L9F A;  2FVA A;  4HKG A;  5EJD A;  2KR5 A;  2CQ8 A;  2KG9 A;  2LTE A;  5KP8 B;  2CG5 B;  2K94 A;  2M5R A;  3EJD A;  5KP7 B;  2K0Y A;  1L0I A;  2VSQ A;  2KOS A;  2MR7 A;  2LPK A;  2K92 A;  2N5H A;  3GZM A;  2KOO A;  2FQ0 A;  2FVF A;  2N6Z A;  2KWL A;  2LOL A;  2AVA A;  2GDX A;  3NY7 B;  4H2X C;  1HQB A;  2QNW A;  1T8K A;  2N6Y A;  2MVV A;  2DNW A;  2CGQ A;  2FQ2 A;  2LKI A;  4H2W C;  2MF4 A;  2AFD A;  2KOP A;  1OR5 A;  1KLP A;  2MD9 A;  3LMO A;  3EJB A;  2X2B A;  2EHT A;  2MY5 A;  2N50 A;  3EJE A;  4PXH B;  2KOQ A;  1AF8 A;  2LIU A;  2K93 A;  3RG2 A;  2FHS C;  2L4B A;  4H2Y C;  1F80 D;  4NEO A;  2MVU A;  2XZ0 D;  2LML A;  2KGE A;  2KGD A;  4IZ6 A;  2JU2 A;  2K0X A;  2CNR A;  4PWV B;  1DNY A;  1ACP A;  2FAD A;  2PNG A;  2KGA A;  2FQ1 A;  2EHS A;  2AF8 A;  3CE7 A;  5CZD B;  2LIW A;  4BPH A;  2KG6 A;  5KP6 B;  2GDW A;  1X3O A;  1HY8 A;  2GDY A;  2L22 A;  2MR8 A;  2KW2 A;  4R0M A;  2L0Q A;  2FAE A;  3GZL A;  5HV8 A;  2KGC A;  4MRT C;  1L0H A;  1VKU A;  2AFE A;  2ROQ A;  2FVE A;  2KOR A;  1NQ4 A;  4CA3 A;  5HVC A;  2JGP A;  2XZ1 C;  2LL8 A; 
#chains in the Genus database with same CATH topology
 3GJN A;  1K9M Q;  1VQM P;  2NO8 A;  1YJW P;  2N98 A;  2FAC A;  3VRL C;  4F37 A;  1VQN P;  5JPA A;  2QA4 P;  4XFY A;  2JAZ A;  2N5H A;  4U0E A;  2KOO A;  2FVF A;  1KQS O;  2AVA A;  2GDX A;  4H2X C;  2DNW A;  4U0A A;  2CGQ A;  3DTJ A;  2LKI A;  3Q20 A;  2L6E A;  1RO2 A;  1OR5 A;  1YIT P;  2MD9 A;  1YI2 P;  2ERH A;  2GYK A;  2JYG A;  1YJ9 P;  1AF8 A;  2LIU A;  1K73 Q;  2K93 A;  2L4B A;  4H2Y C;  2MVU A;  2KOD A;  3B4Q A;  3CCL P;  2JU2 A;  3CME P;  2BUO A;  3CCS P;  2PEO A;  5CZD B;  2KG6 A;  1VQ7 P;  3CCQ P;  5KP6 B;  5F2O A;  3WBH A;  2L22 A;  1K8A Q;  2K0D X;  2L0Q A;  1VQL P;  2M8N A;  5HV8 A;  5F2K A;  5HGM A;  1AUM A;  3H4E A;  3DS3 A;  1N8R Q;  2XT1 A;  2K5X A;  4CA3 A;  5HVC A;  2JGP A;  2VLN A;  4DG9 A;  1E0H A;  4WYM A;  3DS4 A;  4COC A;  2KR5 A;  5DCK A;  3H0D A;  1EIA A;  2M5R A;  3CXC O;  4XRO A;  1L0I A;  5I4T G;  1VQO P;  2FQ0 A;  2LOL A;  3NY7 B;  2VLO A;  3CCE P;  1T8K A;  2M8P A;  4COP A;  1M90 Q;  2MVV A;  2GZI A;  2Z45 A;  2M8L A;  4H2W C;  1IMQ A;  2MF4 A;  1AYI A;  2E1M A;  1M1K Q;  2ONT A;  4GR2 A;  1BXI A;  3EJB A;  2X2B A;  4PH1 A;  2CWO A;  2EHT A;  2MY5 A;  4PXH B;  1KC8 Q;  2WPT A;  1W2B O;  2QEX P;  3CPW O;  2JO0 A;  2PEM A;  2GZJ A;  2KGD A;  1FR2 A;  2CNR A;  2EIA A;  1ACP A;  1YHQ P;  1A8O A;  2KGA A;  2EHS A;  2AF8 A;  3CE7 A;  1IMP A;  4BPH A;  2PY8 A;  2JYL A;  1VQ5 P;  2GDW A;  2BHV A;  1A43 A;  1UJZ A;  2KW2 A;  4QNB A;  1L0H A;  2AFE A;  1NQ4 A;  1M6E X;  3RG2 A;  2XZ1 C;  2LL8 A;  3CD6 P;  3CCR P;  2Z46 A;  1JJ2 O;  3HYB A;  4BPF A;  2K2Q A;  2L9F A;  2FVA A;  3U43 A;  3CCU P;  1VQP P;  2CQ8 A;  2LTE A;  5KP8 B;  1EMV A;  2CG5 B;  1QVG O;  3EJD A;  1VQ9 P;  3CC2 P;  3G26 A;  4QKO A;  2KOS A;  2MR7 A;  4GR6 A;  1E6J P;  1BAJ A;  2N6Z A;  2KWL A;  2QNW A;  1RNI A;  1ZMB A;  2DGY A;  4XRQ A;  2FQ2 A;  1UNK A;  3M1M A;  1Q81 Q;  4XFX A;  3CCJ P;  2AFD A;  4M0I A;  1KLP A;  5HGN A;  5F2N A;  3G1G A;  1VQ8 P;  2N50 A;  3EJE A;  1VHN A;  3GKL C;  2LF4 A;  5BS1 A;  3DS5 A;  2KOQ A;  5HGO A;  1YJN P;  4U0D A;  1MZ8 A;  1NJI Q;  1Z6M A;  3RG6 C;  2LML A;  3HZQ A;  3H47 A;  1M74 A;  1DNY A;  3CMA P;  2Z44 A;  3G1I A;  2OTL P;  3LRY A;  2LIW A;  1QRJ A;  1D1D A;  1X3O A;  1HY8 A;  4R0M A;  2FAE A;  4UHP B;  3G4S P;  2GZG A;  2PEQ A;  1VKU A;  1KD1 Q;  2FVE A;  2JQ4 A;  2GZE A;  2P9X A;  1K30 A;  1DV5 A;  3CC4 P;  2KG8 A;  2PEK A;  2JB0 A;  2JU1 A;  4BPG A;  2N5I A;  2PEN A;  4HKG A;  5EJD A;  3CC7 P;  2KG9 A;  5EW5 E;  2K94 A;  3E2D A;  5KP7 B;  2K0Y A;  2JBG A;  3DPH A;  2VSQ A;  1ZNV A;  7CEI A;  2LPK A;  2K92 A;  3GZM A;  4XFZ A;  3P05 A;  1Q82 Q;  3B5I A;  1GXG A;  1Q86 Q;  4PH0 A;  2EG5 A;  1EOQ A;  1HQB A;  2EFJ A;  2N6Y A;  3G28 A;  2XXM A;  2VLP A;  1M6N A;  4U0C A;  3I55 P;  5HGL A;  2KOP A;  1GXH A;  3LMO A;  1CEI A;  2OTJ P;  4U0F A;  4U0B A;  1Q7Y Q;  1QVF O;  3G6E P;  1IUQ A;  3G29 A;  3OW2 O;  2FHS C;  4IPY A;  4NEO A;  1F80 D;  3G71 P;  2XZ0 D;  1GPJ A;  1YIJ P;  2KGE A;  2OAR A;  4IZ6 A;  2K0X A;  4PWV B;  1VQ4 P;  1RO0 A;  2FAD A;  2PNG A;  1VQ6 P;  2FQ1 A;  2PEI A;  3G21 A;  3G0V A;  3I56 P;  3MGE A;  3NTE A;  3DS0 A;  2GDY A;  2MR8 A;  2VLQ A;  1VQK P;  5BS2 A;  3GZL A;  3DS2 A;  2PEJ A;  1S72 P;  2XV6 A;  2KGC A;  4MRT C;  2ROQ A;  2KOR A;  3DS1 A;  2GZF A;  3CCV P;  3CCM P; 
#chains in the Genus database with same CATH homology
 2JQ4 A;  4DG9 A;  2N98 A;  4BPF A;  1DV5 A;  2FAC A;  2K2Q A;  2KG8 A;  2JU1 A;  4BPG A;  2N5I A;  2L9F A;  2FVA A;  4HKG A;  5EJD A;  2KR5 A;  2CQ8 A;  2KG9 A;  2LTE A;  5KP8 B;  2CG5 B;  2K94 A;  2M5R A;  3EJD A;  5KP7 B;  2K0Y A;  1L0I A;  2VSQ A;  2KOS A;  2MR7 A;  2LPK A;  2K92 A;  2N5H A;  3GZM A;  2KOO A;  2FQ0 A;  2FVF A;  2N6Z A;  2KWL A;  2LOL A;  2AVA A;  2GDX A;  3NY7 B;  4H2X C;  1HQB A;  2QNW A;  1T8K A;  2N6Y A;  2MVV A;  2DNW A;  2CGQ A;  2FQ2 A;  2LKI A;  4H2W C;  2MF4 A;  2AFD A;  2KOP A;  1OR5 A;  1KLP A;  2MD9 A;  3LMO A;  3EJB A;  2X2B A;  2EHT A;  2MY5 A;  2N50 A;  3EJE A;  4PXH B;  2KOQ A;  1AF8 A;  2LIU A;  2K93 A;  3RG2 A;  2FHS C;  2L4B A;  4H2Y C;  1F80 D;  4NEO A;  2MVU A;  2XZ0 D;  2LML A;  2KGE A;  2KGD A;  4IZ6 A;  2JU2 A;  2K0X A;  2CNR A;  4PWV B;  1DNY A;  1ACP A;  2FAD A;  2PNG A;  2KGA A;  2FQ1 A;  2EHS A;  2AF8 A;  3CE7 A;  5CZD B;  2LIW A;  4BPH A;  2KG6 A;  5KP6 B;  2GDW A;  1X3O A;  1HY8 A;  2GDY A;  2L22 A;  2MR8 A;  2KW2 A;  4R0M A;  2L0Q A;  2FAE A;  3GZL A;  5HV8 A;  2KGC A;  4MRT C;  1L0H A;  1VKU A;  2AFE A;  2ROQ A;  2FVE A;  2KOR A;  1NQ4 A;  4CA3 A;  5HVC A;  2JGP A;  2XZ1 C;  2LL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...