2GZJA

Crystal structure of the e9 dnase domain with a mutant immunity protein im9 (d51a)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
LKHSISDYTEAEFLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSALIYYPKEGDDDSPSGIVNTVKQWRAANGKSGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E9 immunity protein
publication title Crystal Structure of the Complex of the Colicin E9 DNase Domain with a Mutant Immunity Protein, IM9 (D51A)
rcsb
source organism Escherichia coli k12
molecule tags Antibiotic/antibiotic inhibitor
total genus 29
structure length 83
sequence length 83
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2gzjA00
2NO8A 5EW5E 1E0HA 1IMQA 1FR2A 3U43A 2ERHA 2GZFA 1MZ8A 2VLOA 4QKOA 1UNKA 3GJNA 1UJZA 1BXIA 2GYKA 2JB0A 2GZGA 2GZIA 1ZNVA 2GZJA 1GXGA 1EMVA 2K0DX 1CEIA 2GZEA 2WPTA 2VLQA 2JBGA 7CEIA 2K5XA 1GXHA 3GKLC 2JAZA 2VLPA 2VLNA 1IMPA 1AYIA 4F37A 4UHPB
chains in the Genus database with same CATH superfamily
3E2DA 2MVUA 3DS5A 2LTEA 3G21A 1L0IA 1NQ4A 2Z44A 1VQOP 2FAEA 2KG8A 3DPHA 2K93A 2CQ8A 4U0AA 1KD1Q 2JQ4A 1JJ2O 2PEMA 2KOSA 1HQBA 1Q82Q 2FVFA 1N8RQ 1K8AQ 3H47A 3I55P 4U0EA 1DNYA 1M1KQ 1A8OA 2L4BA 2P9XA 3GKLC 2CG5B 3RG6C 2KW2A 3CPWO 1L0HA 1IMQA 2QA4P 2ONTA 4R0MA 2EHSA 1M6EX 1Q81Q 2DNWA 1AF8A 2OTLP 4PXHB 2PEQA 4PH1A 5HV8A 2VLQA 2PY8A 2MF4A 4XFXA 3CC7P 2KGCA 2CNRA 2FQ0A 2LIWA 5KP8B 4H2WC 1S72P 1YJNP 2Z45A 3U43A 2KG6A 1RO0A 4XFZA 1W2BO 2KOOA 2CGQA 1BXIA 3G1IA 1ACPA 2KODA 2KG9A 4GR2A 7CEIA 4U0DA 2JAZA 2LF4A 2LPKA 3MGEA 3DTJA 5I4TG 2FHSC 4DG9A 2LMLA 1DV5A 2MY5A 1MZ8A 2MD9A 2OARA 2PEJA 1YHQP 3CCMP 4U0CA 2EG5A 2AVAA 2LOLA 3EJDA 2JO0A 4H2XC 1GXGA 2K0XA 5BS2A 1VQPP 2VLPA 4BPFA 1A43A 1BAJA 3CC2P 5KP6B 2MVVA 4CA3A 2M8PA 4COCA 3DS1A 3CCJP 2MR7A 3VRLC 5EJDA 2JYGA 1NJIQ 2XZ0D 1Z6MA 3I56P 1GXHA 3DS2A 4UHPB 2M5RA 1VKUA 1K73Q 2K2QA 5JPAA 5EW5E 3OW2O 1KC8Q 1K30A 2JU1A 1YITP 1VQ4P 3G6EP 5CZDB 2WPTA 3P05A 2GDXA 1VQNP 5BS1A 2KGEA 1E0HA 1VQ8P 3CMAP 2BHVA 2JGPA 2DGYA 2ERHA 2GZFA 4IZ6A 4COPA 3G0VA 4H2YC 4U0BA 2GYKA 2JB0A 3GZMA 3DS0A 2L6EA 1VQ5P 2K92A 3DS4A 2L9FA 1AYIA 2NO8A 5DCKA 3Q20A 3HZQA 1VQ6P 2GDWA 2KWLA 2VSQA 3EJEA 1UJZA 4U0FA 2Z46A 1QRJA 1QVGO 4PH0A 1QVFO 1IMPA 1E6JP 4QNBA 1AUMA 1RNIA 2EIAA 1F80D 1RO2A 1HY8A 2JU2A 1GPJA 2PEKA 3RG2A 2L22A 2OTJP 5HGOA 3DS3A 1M74A 3G4SP 1Q86Q 2GZGA 1VQ9P 1OR5A 2GZEA 2N6YA 4GR6A 2K5XA 4PWVB 4WYMA 4F37A 2LIUA 2PNGA 4XRQA 3LMOA 2XV6A 2M8LA 2JYLA 1KLPA 3CCQP 1UNKA 5HGMA 2N6ZA 2KGDA 2BUOA 4BPHA 2EHTA 5HVCA 2K0DX 5F2NA 2PENA 3CC4P 2FQ1A 2XT1A 1X3OA 1EOQA 3GZLA 5F2OA 3G28A 1M6NA 4QKOA 2KOPA 3B5IA 1T8KA 3NY7B 2GZIA 1ZNVA 3B4QA 2JBGA 3CXCO 1D1DA 1IUQA 3CCUP 3M1MA 1EMVA 2LL8A 2AFDA 1FR2A 3CE7A 3LRYA 2KR5A 3GJNA 2GDYA 2M8NA 2X2BA 1K9MQ 1VQLP 1YJWP 5HGNA 3CMEP 1CEIA 3CD6P 4MRTC 3CCRP 2K0YA 2QNWA 4HKGA 3G26A 2EFJA 2FVEA 3H4EA 4NEOA 1KQSO 3H0DA 2FADA 1Q7YQ 4M0IA 1VHNA 2N98A 3G29A 3HYBA 2FACA 2KOQA 1EIAA 3CCVP 2AF8A 1VQ7P 2GZJA 2KORA 3WBHA 2L0QA 4IPYA 2PEIA 1ZMBA 2N5IA 1YI2P 4XFYA 4BPGA 1VQKP 2CWOA 2FVAA 3CCEP 2PEOA 2N5HA 3G1GA 2FQ2A 2K94A 1YJ9P 1VQMP 2VLNA 2KGAA 3NTEA 3CCSP 3G71P 3CCLP 1YIJP 2E1MA 4XROA 2QEXP 2VLOA 2N50A 5F2KA 2MR8A 2XXMA 1M90Q 2XZ1C 2ROQA 3EJBA 2AFEA 2LKIA 5HGLA 5KP7B
chains in the Genus database with same CATH topology
2NO8A 5EW5E 1E0HA 1IMQA 1FR2A 3U43A 2ERHA 2GZFA 1MZ8A 2VLOA 4QKOA 1UNKA 3GJNA 1UJZA 1BXIA 2GYKA 2JB0A 2GZGA 2GZIA 1ZNVA 2GZJA 1GXGA 1EMVA 2K0DX 1CEIA 2GZEA 2WPTA 2VLQA 2JBGA 7CEIA 2K5XA 1GXHA 3GKLC 2JAZA 2VLPA 2VLNA 1IMPA 1AYIA 4F37A 4UHPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NO8 A;  5EW5 E;  1E0H A;  1IMQ A;  1FR2 A;  3U43 A;  2ERH A;  2GZF A;  1MZ8 A;  2VLO A;  4QKO A;  1UNK A;  3GJN A;  1UJZ A;  1BXI A;  2GYK A;  2JB0 A;  2GZG A;  2GZI A;  1ZNV A;  2GZJ A;  1GXG A;  1EMV A;  2K0D X;  1CEI A;  2GZE A;  2WPT A;  2VLQ A;  2JBG A;  7CEI A;  2K5X A;  1GXH A;  3GKL C;  2JAZ A;  2VLP A;  2VLN A;  1IMP A;  1AYI A;  4F37 A;  4UHP B; 
#chains in the Genus database with same CATH topology
 3E2D A;  2MVU A;  3DS5 A;  2LTE A;  3G21 A;  1L0I A;  1NQ4 A;  2Z44 A;  1VQO P;  2FAE A;  2KG8 A;  3DPH A;  2K93 A;  2CQ8 A;  4U0A A;  1KD1 Q;  2JQ4 A;  1JJ2 O;  2PEM A;  2KOS A;  1HQB A;  1Q82 Q;  2FVF A;  1N8R Q;  1K8A Q;  3H47 A;  3I55 P;  4U0E A;  1DNY A;  1M1K Q;  1A8O A;  2L4B A;  2P9X A;  3GKL C;  2CG5 B;  3RG6 C;  2KW2 A;  3CPW O;  1L0H A;  1IMQ A;  2QA4 P;  2ONT A;  4R0M A;  2EHS A;  1M6E X;  1Q81 Q;  2DNW A;  1AF8 A;  2OTL P;  4PXH B;  2PEQ A;  4PH1 A;  5HV8 A;  2VLQ A;  2PY8 A;  2MF4 A;  4XFX A;  3CC7 P;  2KGC A;  2CNR A;  2FQ0 A;  2LIW A;  5KP8 B;  4H2W C;  1S72 P;  1YJN P;  2Z45 A;  3U43 A;  2KG6 A;  1RO0 A;  4XFZ A;  1W2B O;  2KOO A;  2CGQ A;  1BXI A;  3G1I A;  1ACP A;  2KOD A;  2KG9 A;  4GR2 A;  7CEI A;  4U0D A;  2JAZ A;  2LF4 A;  2LPK A;  3MGE A;  3DTJ A;  5I4T G;  2FHS C;  4DG9 A;  2LML A;  1DV5 A;  2MY5 A;  1MZ8 A;  2MD9 A;  2OAR A;  2PEJ A;  1YHQ P;  3CCM P;  4U0C A;  2EG5 A;  2AVA A;  2LOL A;  3EJD A;  2JO0 A;  4H2X C;  1GXG A;  2K0X A;  5BS2 A;  1VQP P;  2VLP A;  4BPF A;  1A43 A;  1BAJ A;  3CC2 P;  5KP6 B;  2MVV A;  4CA3 A;  2M8P A;  4COC A;  3DS1 A;  3CCJ P;  2MR7 A;  3VRL C;  5EJD A;  2JYG A;  1NJI Q;  2XZ0 D;  1Z6M A;  3I56 P;  1GXH A;  3DS2 A;  4UHP B;  2M5R A;  1VKU A;  1K73 Q;  2K2Q A;  5JPA A;  5EW5 E;  3OW2 O;  1KC8 Q;  1K30 A;  2JU1 A;  1YIT P;  1VQ4 P;  3G6E P;  5CZD B;  2WPT A;  3P05 A;  2GDX A;  1VQN P;  5BS1 A;  2KGE A;  1E0H A;  1VQ8 P;  3CMA P;  2BHV A;  2JGP A;  2DGY A;  2ERH A;  2GZF A;  4IZ6 A;  4COP A;  3G0V A;  4H2Y C;  4U0B A;  2GYK A;  2JB0 A;  3GZM A;  3DS0 A;  2L6E A;  1VQ5 P;  2K92 A;  3DS4 A;  2L9F A;  1AYI A;  2NO8 A;  5DCK A;  3Q20 A;  3HZQ A;  1VQ6 P;  2GDW A;  2KWL A;  2VSQ A;  3EJE A;  1UJZ A;  4U0F A;  2Z46 A;  1QRJ A;  1QVG O;  4PH0 A;  1QVF O;  1IMP A;  1E6J P;  4QNB A;  1AUM A;  1RNI A;  2EIA A;  1F80 D;  1RO2 A;  1HY8 A;  2JU2 A;  1GPJ A;  2PEK A;  3RG2 A;  2L22 A;  2OTJ P;  5HGO A;  3DS3 A;  1M74 A;  3G4S P;  1Q86 Q;  2GZG A;  1VQ9 P;  1OR5 A;  2GZE A;  2N6Y A;  4GR6 A;  2K5X A;  4PWV B;  4WYM A;  4F37 A;  2LIU A;  2PNG A;  4XRQ A;  3LMO A;  2XV6 A;  2M8L A;  2JYL A;  1KLP A;  3CCQ P;  1UNK A;  5HGM A;  2N6Z A;  2KGD A;  2BUO A;  4BPH A;  2EHT A;  5HVC A;  2K0D X;  5F2N A;  2PEN A;  3CC4 P;  2FQ1 A;  2XT1 A;  1X3O A;  1EOQ A;  3GZL A;  5F2O A;  3G28 A;  1M6N A;  4QKO A;  2KOP A;  3B5I A;  1T8K A;  3NY7 B;  2GZI A;  1ZNV A;  3B4Q A;  2JBG A;  3CXC O;  1D1D A;  1IUQ A;  3CCU P;  3M1M A;  1EMV A;  2LL8 A;  2AFD A;  1FR2 A;  3CE7 A;  3LRY A;  2KR5 A;  3GJN A;  2GDY A;  2M8N A;  2X2B A;  1K9M Q;  1VQL P;  1YJW P;  5HGN A;  3CME P;  1CEI A;  3CD6 P;  4MRT C;  3CCR P;  2K0Y A;  2QNW A;  4HKG A;  3G26 A;  2EFJ A;  2FVE A;  3H4E A;  4NEO A;  1KQS O;  3H0D A;  2FAD A;  1Q7Y Q;  4M0I A;  1VHN A;  2N98 A;  3G29 A;  3HYB A;  2FAC A;  2KOQ A;  1EIA A;  3CCV P;  2AF8 A;  1VQ7 P;  2GZJ A;  2KOR A;  3WBH A;  2L0Q A;  4IPY A;  2PEI A;  1ZMB A;  2N5I A;  1YI2 P;  4XFY A;  4BPG A;  1VQK P;  2CWO A;  2FVA A;  3CCE P;  2PEO A;  2N5H A;  3G1G A;  2FQ2 A;  2K94 A;  1YJ9 P;  1VQM P;  2VLN A;  2KGA A;  3NTE A;  3CCS P;  3G71 P;  3CCL P;  1YIJ P;  2E1M A;  4XRO A;  2QEX P;  2VLO A;  2N50 A;  5F2K A;  2MR8 A;  2XXM A;  1M90 Q;  2XZ1 C;  2ROQ A;  3EJB A;  2AFE A;  2LKI A;  5HGL A;  5KP7 B; 
#chains in the Genus database with same CATH homology
 2NO8 A;  5EW5 E;  1E0H A;  1IMQ A;  1FR2 A;  3U43 A;  2ERH A;  2GZF A;  1MZ8 A;  2VLO A;  4QKO A;  1UNK A;  3GJN A;  1UJZ A;  1BXI A;  2GYK A;  2JB0 A;  2GZG A;  2GZI A;  1ZNV A;  2GZJ A;  1GXG A;  1EMV A;  2K0D X;  1CEI A;  2GZE A;  2WPT A;  2VLQ A;  2JBG A;  7CEI A;  2K5X A;  1GXH A;  3GKL C;  2JAZ A;  2VLP A;  2VLN A;  1IMP A;  1AYI A;  4F37 A;  4UHP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...