3G6EP

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g6eP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g6eP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g6eP02
1YHQP 1K8AQ 1YI2P 3CCRP 1VQ6P 1VQOP 3CCSP 1VQPP 1YITP 1YJWP 3CC2P 3G6EP 3CCEP 1K9MQ 1KQSO 3CC4P 3OW2O 1S72P 1VQ5P 1YIJP 3CXCO 1KD1Q 1QVFO 1YJ9P 1Q82Q 2OTLP 1W2BO 1VQ8P 1VQNP 1VQ9P 2QEXP 1YJNP 1QVGO 1N8RQ 1K73Q 1VQKP 3G4SP 3G71P 3I55P 1JJ2O 3CCQP 3CD6P 1M90Q 1Q86Q 1Q7YQ 1NJIQ 1M1KQ 3CCLP 3CMEP 3CMAP 2QA4P 3I56P 3CCJP 3CCUP 1VQMP 3CPWO 2OTJP 1VQ7P 3CC7P 1VQLP 1KC8Q 1Q81Q 1VQ4P 3CCVP 3CCMP
chains in the Genus database with same CATH superfamily
2YXRB 3M9HA 5HGNA 3S4RA 1JTHA 3BATA 2JEEA 1FZGA 1M1JC 1GL2D 1XTGB 1GU5A 1PEMA 1RF0A 2N1TB 1NTMG 2JKVA 3AEDC 3Q20A 3V6IA 4N78E 5CCGC 1ZOYC 3N4XA 3E2DA 5AW1B 3SFDC 3L73G 2JAZA 1LT1A 3GHGB 4N6JA 1EOQA 3K5BA 3L75E 2QIWA 2E74B 3QH9A 1X0TA 2O1JA 2ONTA 5APYA 1PPJD 3KZIH 1VQ7P 4DJGA 2KOGA 2JQ4A 2X2BA 1GXGA 1BXIA 1A43A 3H32B 4ZKUA 3AE5C 2Q1KA 1OWAA 3U1CA 1GK6A 1CEIA 3BRVB 1PFIA 3PHLA 1T3JA 1EC5A 1JY3O 1Q2NA 4I7ZB 2KUBA 5CCHA 4HJGH 3G1GA 3L74G 2I8DA 4WYMA 1USDA 1SQXG 1BSHA 2A45I 3I5CA 4COCA 1JY3N 4LGDE 2RN0A 5F2NA 3V2PA 3MUDC 1VQLP 4L73A 2HODB 5F2KA 3MIWA 1D1DA 3ZDMA 2LPKA 1NAYA 4PH1A 3AEEC 3RG2A 3RK2C 5AVTB 3AEGC 1TU3F 3AEFC 2KGEA 1JY2N 2KODA 2KOSA 2OGUA 2LXBA 5AVYB 2C0XA 4WWIA 5L8RJ 1GD2E 4N78D 1X3OA 1LWUC 3MGNA 2Z46A 1LNQA 2QJPC 5GTHH 3TK1A 1NTKD 4PD4E 5I4TG 1K73Q 1FZCC 3LRYA 1KILD 2QJKB 1PEQA 1X79B 3H6PA 1IC2A 2KNCA 3U43A 2OARA 2H88C 2P2UA 3Q2YA 3GF7A 1PPJE 3BASA 4H2XC 3CC2P 1PL5A 3Q5SA 5BU8B 2K5XA 3O6QB 2YKQA 1M74A 3WMM0 4GOFA 1SQBJ 4BXLA 1CZQA 1OR5A 4BPGA 2I1JA 1EDLA 2XU6A 4I7ZC 3IF4A 2XT1A 1K30A 3FGAD 2N6YA 3E7KA 1AF8A 4PD4H 1RE4C 4C46A 3M9QA 2NO8A 1ZRTE 2LOLA 1N8RQ 2AF8A 3CXHE 2FQ0A 1AQTA 3I55P 3VP9A 3VMYA 1NU1D 5AW3B 2OYHC 3L35A 5AW5B 2PRRA 3CWBG 1UIXA 2FYNB 4PJ0H 1S5LE 2B9BA 1KLPA 5F2OA 3CL3D 4OWFA 3MZWB 4A7PA 1RY3A 1T2KC 3HZQA 1LT9B 1KYOI 5AVUB 4K3AA 3CCRP 3NTNA 2L9FA 2ZVNB 4O9BA 1T3UA 1L0NE 1KQSO 3CC4P 1GXHA 1SQPD 1EDKA 2XZ1C 3RK2B 4RJTA 3B5ND 2DNWA 3KDPB 2AEMA 4C7NA 2HYNA 1LT9A 2Q9IA 5KLVD 4AUWA 3CCVP 3L72J 2FKWB 1WMKA 4ZNCA 5K5GB 3DS2A 2KG9A 1OMIA 3L70J 4H2WC 1FZCB 2WSEH 1P84I 2BCCE 1NTKJ 3CCLP 2KORA 4YXWH 1LTBC 1KQLA 4EDFA 1U7JA 3G9RA 3PJSK 2ZT9D 3JC22 2IYOA 1JNMA 1YTZI 3W67A 2OYIB 3SFEC 2AXTH 3B5NA 4DOJA 5CCHC 5APVA 4UB6H 2Y9ZA 2FYUE 4W7YA 5AW8B 2LIUA 4OGQD 3HD7C 2WPRA 3L70G 4U0FA 3C8VA 4H44D 3U1AA 2FVAA 3LW5J 1Q82Q 2QJYB 1NGMB 1KILC 2GDWA 5AW2B 2XDJA 2C9NY 4EI2A 2AEJA 4H0LD 3GLMA 1IUQA 1KB9E 2FVFA 3CE7A 5EJDA 2Y9YA 2E5TA 2BCCG 1SQVG 4IFMA 1FS0E 5APQA 2L22A 4H13B 2ITAA 1YIJP 1RO2A 2ZYGA 1KV4A 3VOPA 4M0IA 1FU1A 1LTAC 1NTMK 1SLQA 2FACA 3L74D 3CXHH 3H1KG 3GF3A 2ZXEB 2LTEA 3CCMP 1N7SC 1U7MA 1SQQG 3E1RA 3FWLA 3HYBA 4HH2A 2GZEA 2MF4A 2K2QA 1A8OA 1ZNVA 4B86A 3MUDA 1YQ3C 1OVUA 1L0HA 2FBWC 2HPCA 5E79H 2WT7A 3KXDA 1F80D 4JBZA 1ZXGA 3SWFA 1VQ4P 2WSFH 4XFZA 1H0TB 2DW3A 5GTIE 2N1TC 3A0BH 2E43A 2POHA 1MFTA 3EJBA 3EQ2A 3USSA 5EFWB 1ZW0A 4U0BA 2QA4P 2M5AB 3C9IA 2KR5A 2AVAA 1KYOH 2QRXA 1DX7A 3G6EP 1M1JA 2Z5HA 1NOHA 4GKGA 5HGLA 1NTMD 1R5SA 4WY4C 1Q90D 5H2FE 2M8LA 2KSJA 3H25A 1S9KE 5AW4B 3IAOA 3CX5D 3PTZA 4UB8H 3H1KJ 2C9LY 3NFQA 1LTGC 4DT0A 3CXCO 1U57A 2BEQD 4R4MA 1RHZB 3W68A 4OVNF 3P32A 3DS1A 1NHLA 2A45G 1QL2A 5KAIE 1BAJA 1SFCC 5AW9B 3L74E 3M0DC 5KLIB 5AVXB 2N1TA 2BCCJ 2VRSA 2KS1A 3HTKA 1PPJG 2QNWA 1R5LA 2ERHA 4XA4A 3V4QA 1YBKA 1L0LG 3G4SP 3G1IA 3GHGC 1GZLA 1NYHA 3CLQA 5HGMA 3GHGA 2GZJA 3A0HE 4GIFA 1J1EB 3L74J 1T8ZA 2PAJA 4I2LC 1OVVA 2L4BA 1WT6A 3V2RA 3LIDA 1EXJA 5BVZA 2Q3IA 2NPSB 2QEXP 1D7MA 1N73B 3HE4B 2QVAA 1Q86Q 3P8CE 1DV5A 1PIXA 5CCGD 4U3FJ 2GZGA 2N1TD 2K88A 3MTUE 1E0HA 3H32A 1RO0A 1JMBA 2D2CD 1QGKB 3AE3C 4LC1A 1BE3J 2W6JH 5AVZB 3AE4C 3DS3A 1RE3C 1HJBA 4IZ6A 3AEBC 1IFPA 4BPHA 4IPYA 1FZAA 1G2CA 1S9KD 3L72G 2JU1A 4XROA 2M8RA 3CI9A 3Q5RA 1NTZD 3TNUA 3L37A 1L4AD 1SS1A 2WQYC 2IBZE 4QNBA 2WVRA 3VMAA 1J1DC 1NTKE 2WPTA 1DNYA 2R32A 1NTMJ 4TT3H 3A0BE 1AYIA 1JOCA 4U0DA 2N5HA 2HPCB 1JY2O 2PEIA 3F5HA 3Q1MA 2M3BA 3AEAC 3F89A 2N98A 1G2CB 2XNDH 3MD0A 4YPCA 2QM7A 1KYOE 1VQ5P 1FDIA 5APWA 1LTSC 3G28A 3H1KD 5CBNA 2N6ZA 1QEXA 3H1IJ 1PGPA 5KJ7D 1PGQA 1KQGB 1L0NJ 1VF5B 1GMJA 2OTKE 4WB4A 4IL6X 1VPCA 3RK3B 3G21A 1RF1C 4D6TE 2QE7H 2CK3H 1KTMA 3N7NA 4XRQA 1LTIC 2BQ1E 3KPEA 1GW3A 5APXA 1JEKA 1ZRTD 5KKZB 2HG5D 1M8OB 5BU5A 4MRTC 3CCUP 3L75G 3OAKA 1OW8A 3G26A 2YXQB 3S9OA 1AQ5A 1UNKA 4PV1D 2R5DA 2ZT9C 1VQ9P 3WUTA 3HE5A 2PEOA 2Q3EA 4TLFA 5CJ4A 4M3LA 1L0LD 1EZVD 1LTTC 2DGYA 2A06E 3PRJA 3H0DA 2PENA 5E79E 1K05A 1SQQD 3AE8C 3L75D 3DS5A 1NTZE 3CWBD 2VLOA 2LXCB 2W83C 1T6AA 1SQPE 1BCCJ 3HE5B 1IO4A 2OYOA 1IZNB 2JWDA 2WMMA 1VF5D 1URQD 2MVVA 1SQXE 3CMEP 2H89C 1SQBE 1KN7A 2W6AA 5KLVE 2WSFJ 4HKZH 1L0IA 4COPA 4IL6E 2HR3A 1KB9I 3M1MA 1BE3E 3A5TA 2FXMA 1KFMA 3U59A 1N73A 3H1JG 1NJIQ 2I1KA 2JYGA 5CBOA 4WBAA 3MGEA 4U3FE 1P84D 4QKOA 3HUSA 1QLED 1YJWP 4D6TD 1SQXJ 4H13D 4GT1A 4JQ0D 2WSEJ 2WITA 5CCGA 2GA1A 1SQVJ 3H1ID 1RE4A 1FC2C 1HQBA 2A45H 2J58A 3CCSP 2KWLA 1S72P 3AE9C 3M91A 4GDOA 2KZJA 1JMMA 2AXCA 2H7HA 1CW5A 1EQ7A 2GZIA 1Q7YQ 5APSA 1YTZT 2CPBA 4PV1C 4OGQC 4BPFA 3SSUA 4ZKPA 1EZVE 3R2PA 1W2EA 2ZAEB 2JO0A 1IK9A 3NTEA 1YI2P 2A06D 3A7OA 3NXSA 1FZFA 4NPFX 3KZIE 3RL0C 1Y8AA 2IYPA 2QG4A 2WPVB 2BEZF 1FZBA 2V7QH 3VP8A 5AVVB 2KS1B 2IZ1A 3EFFK 2FFDC 2JGPA 1PGOA 2IFMA 1N7SA 1VL2A 2Q5UA 1Y9BA 2P1JA 4QMAA 5KP7B 1IFJA 1PZQA 1GL2C 3UIAA 4U0AA 2O3JA 5TISH 2E74C 2KB7P 1SQBD 4NEOA 3GZLA 3B5NC 2YMKA 1VQ8P 1SQQK 1KFNA 1KB9H 2E75B 3L75J 3H1JE 1SVFA 1KORA 1G1IA 2O01J 2QM8A 5KAFE 3B8EB 3EFGA 1YITP 2R3SA 1BSNA 4GODA 2P9XA 4U3FD 3M9BA 1K04A 1LP1A 4RESB 3Q3DA 4PJ0E 1HGZA 1HH0A 1AJYA 1N7LA 1S5LX 1N2DC 2WSCH 4ASWA 2XZ0D 1HTLC 1SQVK 1S3JA 5TJHA 2LL8A 1Q81Q 2K93A 2LIWA 5KP6B 4F37A 3KQGA 1S2EA 3H1LD 1VQNP 3BCCG 4U7JA 3BCCE 3D71A 1H88A 5CHXA 1YYCA 4H44B 1JJ2O 5DCKA 2JBGA 1USEA 2FFDA 1L4AA 2W27A 2IPPA 2KP8A 2E42A 1GTWA 1ZMBA 1MZ8A 3CX5E 4GR2A 4JYBA 1CI6A 2KOPA 1FZEA 3QWOC 1OW6A 1HJ0A 2E5YA 2Z44A 2E76C 1XTCC 1RF1A 2Y0DA 1M7LA 2RMZA 2CNRA 1SQVE 3FXEA 1QL1A 1L4AB 2OTJP 3DS4A 3RL0B 1GW4A 4DG9A 2NPSC 5H2FH 4U0CA 5AW6B 3P05A 1NTZK 2FQ2A 1FJPA 2IBZI 2PGDA 1Z56A 3AE7C 1AV1A 1M6EX 3DPHA 1PP9J 1IFIA 3LIEA 1EIAA 2XV5A 1M6NA 1EZVI 3NY7B 3H47A 2H8PD 2CG5B 2YIUC 3RK2D 3HTKB 5C39A 3CXHD 2Q7CA 4JF7A 2K0DX 1DD4A 2XKMA 1NU1E 2E1MA 2Q6QA 2IBZG 3BRTB 3FWNA 2P10A 3IFMA 2EHSA 1KD1Q 2K9YA 2B87B 3C1LA 1N86A 1ZR4A 3H1LE 4EOTA 5B5EH 1ZLLA 4OGQB 3MHVA 2M8NA 3CPWO 2KI7B 2FQ1A 3WUVA 2D2CC 1RE3A 2SPZA 5CMZA 1URQB 2W90A 4I1LA 2E74D 2XNXA 3L4FA 4R0MA 1ZR2A 2KW2A 4LLHA 1PP9G 2PEJA 3CX5I 3RL0g 1LTJA 1SQBG 3D70A 2R3CA 1DEBA 3HUSB 5B5EE 1KYOD 3G71P 3JSVC 2KYVA 3JCUE 2N5IA 4EYYQ 2H43A 3H1LG 2JWAA 2KG8A 1RF0C 2MJZA 4IL6H 1LJ2A 1GPJA 2P7JA 3HRNA 2K94A 4Y28J 1QVGO 2KGCA 5KLVK 3LW5H 3RK3E 5GTHE 1VQKP 5KJ7C 3GJNA 4IOIH 3L73J 5BS2A 3I56P 3L71D 3RBZA 1PEOA 2FXPA 1JO5A 3P8MC 2RH0A 1YHQP 3L70D 1NTME 4RKUJ 1PP9D 1RQVA 3CCEP 4NPEA 3JCUH 3H1IG 2N50A 4UB6E 1NKNA 4PV1B 2KXPB 1L0LK 1L0LE 1LTJC 2M3EA 1RH5B 2E75C 1Z6MA 1MKMA 2O1KA 1OIPA 2IZ0A 4KJMA 1NAFA 2ZYDA 1BDCA 1T2KD 2EFJA 1KILE 3AE1C 2ZYAA 2B89A 3AE6C 5HV8A 2CWOA 1KILA 2VLQA 1NU1J 1EXIA 1M57D 3G29A 2L91A 2ZJSE 2VLNA 4Z1MH 5KLVG 4N3YB 3IN6A 1JTHB 1BE3G 1E6JP 2R44A 3KHUA 1HY8A 3B71A 4OH8B 3T97A 1L2PA 1W5CE 2PNGA 4PWVB 5AVWB 1ZV8A 4U3FG 1NVOA 3TNUB 2WPQA 2GDXA 2K0YA 2KLVA 1HBWA 3M06A 5DJUB 3E1IA 5KAFH 2M8PA 1JCCA 2IDBA 5EW5E 1NTKG 4PH0A 3A2AA 2JYLA 3V4WA 1VQ6P 2GDYA 1NTKK 3VMXA 1GL2B 2MR8A 2YKPA 1PP9E 4L74A 1PV3A 2D2CB 2LF4A 2M0BA 1JY3P 1NU1G 2GYKA 1JY2P 1SFCA 2Z5IA 1DH3A 1GU4A 2YIUB 2UWJE 2O01N 2LMLA 1NTZJ 1S5LH 4Y99B 3L73D 4Y99C 4MN4C 2OTLP 1K8AQ 5GTIH 3RG6C 3L71J 1RF1B 4L76A 1OZHA 2IBZD 5BS1A 1LTJB 1AFOA 2FYUG 3L36A 3G3ZA 3EJEA 1OXZA 3TGUD 3A3YB 1FDOA 1ACPA 4JYCA 1SP4A 3WU2H 4PD4D 1ZN5A 2R5BA 4U0EA 2EIAA 3ABVC 4C7NB 4UB8E 2OYHB 1KC8Q 1H89A 4W80A 1FOSF 1L4AC 2WTYA 2XV6A 3VYIA 3R4YA 3A0HH 1FOSE 1SQPK 4KT0J 2WPSA 1YJNP 1HWTC 2JJLA 3BVHA 1SFCD 5KAIH 1FDMA 1URQC 2RKLA 1QRJA 3CXHI 2BASA 1BGYG 4BRYB 2Z4EA 2KIKA 2P67A 3GG2A 3DS0A 2OYIA 4IFDK 2GM4A 2FAEA 3H1HG 3CMAP 2LR2A 5AVQB 4D6TG 1J1DB 2KNCB 2KOQA 4BRYA 2FYUK 2NRGA 1FAVA 4WY4A 2AXTE 4YXDC 2BHVA 2G8YA 3EWKA 2PEKA 1BGYJ 1A02F 3RGUA 3Q5PA 2Y0CA 1ZP0C 2FXOA 3RK3C 2K9JB 4KHXA 2K0XA 3BCCD 4WVZA 2K92A 1VF5C 5CJ0A 1IFMA 2WSCJ 2N9BA 1JUNA 1GK4A 1JB0J 1SQQJ 2JDIH 2KZIA 1PEUA 1UIIA 4W7ZA 2JO1A 1VQOP 3L73E 4WY4B 1BCCD 5AW0B 1EDJA 2JU2A 3H4EA 1FJKA 3S1KA 3CD6P 3TGUE 1SQPJ 2AEFA 4CA3A 2ZT9B 2K9JA 3DTJA 2Y0EA 3T97B 2ZXXA 1L0NG 3RBXA 1IK7A 1NTZG 1P84H 2G3AA 2E76B 4IFFA 3L72D 3HD7A 1J1EC 1X9VA 1X22A 4K35A 3PP5A 2MKVA 2FFDB 2E76D 2MR7A 1HGVA 2HODA 3H1KE 4R4LA 5CCHD 4XFYA 1VQMP 2NPSD 1P84E 2IFNA 2YMYA 1A02J 3TYYA 1LGHB 1BCCG 2L0QA 2YO3A 2CQ8A 3PH0A 2FYZA 2VLPA 1IJDB 2V4HA 5KLIC 1W2BO 3HD7B 3HUSC 1EMVA 3H1HE 1LWUA 3TSIA 1N7SB 3AECC 2OQQA 4I6MC 1MFZA 4PXHB 1AA0A 2M5AA 2EHTA 2FYUD 2A06G 4GOEA 2AFDA 5HVCA 2J5UA 2FY8A 5AVRB 5AVSB 5M1BA 1RNIA 2XXMA 3OJAB 4H13C 5APTA 2ZVOB 1HUCA 1S1CX 2FVEA 2JB0A 2GZFA 4RO0A 4ASVA 2LKIA 3OA7A 1PGJA 3CC7P 1DIPA 5B66H 1KB9D 2PFXA 3V2QA 2Z45A 2M5RA 3HD7D 3WUUA 1SQQE 2MY5A 1M56D 1BCCE 1YQ4C 7CEIA 3CWBE 1JCDA 1G1JA 3B5NB 1DD3A 2AFEA 1M1KQ 2JP3A 1SQBK 4L75A 5AW7B 2WWWA 5KJ7A 3BCCJ 3VMZA 4XE5B 3NMDA 1VHNA 3GKLC 1VQPP 3VTPC 1L0LJ 3H1JD 2BUOA 3L72E 5APUA 2LKMA 1AVYA 4H2YC 1KZUB 3CCQP 4YTPC 4DCKA 2QSIA 1IFNA 2IX7C 2PEQA 1BE3D 1GDTA 1NO4A 2WSSH 1HF9A 1URQA 1R8EA 4GR6A 3TDKA 3V5BA 1LP1B 3CWBJ 1VKUA 1FR2A 2EG5A 1CI6B 4XFJA 5DJTB 1E5WA 1IMQA 1BGYE 2J59M 2K37A 2CGQA 1GL2A 3P8CD 3MP7B 4HYTB 3H1HD 1NWQA 4AQRD 1N73C 3GZMA 2B88A 1EDIA 2MD9A 1MUUA 1RQUA 3H1LJ 2HLOA 3KYQA 1WRGA 2C0WA 3M0DA 5JPAA 2GUVA 1L0NK 2KK7A 5KKZC 2YKOA 2ZFCA 2W6BA 2KLUA 3TF5A 3TGUJ 2MVUA 3GW6A 1AUMA 1E79H 2N9YB 1FZCA 4D6TJ 3V2NA 2W8ZA 1L0ND 4UHPB 2HFED 3WBHA 1H0TA 1OW7A 2JR8A 4H44C 1YJ9P 2L6EA 2PEMA 3SWYA 3B4SA 4H0LB 3O8ZA 1DEEG 2QJKC 2GUSA 1NU1K 1UJZA 1IFDA 1SQXK 3M0AA 2O01H 3CX5H 3AE2C 2OYIC 2QJPB 1ZMEC 2FHSC 3WU2E 1QVFO 2B87A 2BCCD 3GMAA 4JPZB 2L5GB 4DZOA 2NZ2A 3EJDA 4PD4I 1N7SD 5TISE 2KSEA 2PP6A 2K3RA 3O6QA 4EIJA 2FADA 1SQPG 1KQFB 1QX8A 5KTBA 1KILB 1BDDA 2QJYC 2CPSA 5B66E 1S4XA 1Y47A 1VDFA 2YNYA 1EZVG 2VSQA 1MV8A 3SWKA 1BGYD 3H1JJ 4NPDA 1H8AA 1IMPA 2FYNC 2XZRA 4H0LC 3RL0D 3VN0A 2V7QJ 2KGDA 1K9MQ 1X8YA 3P7KA 4ZMDA 3G0VA 1OFCX 4CPGA 1LT9C 2P58A 1AVOA 1NH4A 3ITKA 2KG6A 3VRLC 4HKGA 3H1HJ 1T8KA 3FXDA 1J2JB 4C7RA 4HB1A 1CSBA 3D6ZA 1OVRA 3D6YA 4BWNA 2WT7B 2NPSA 4XFXA 2YO2A 3HE4A 3TGUG 1SQXD 1NKZB 1FBMA 1HVVA 1SQVD 1OX3A 1SFCB 5HGOA 3OW2O 3FX0A 3IR9A 1JM0A 1MZ9A 3PLNA 5KLVJ 3II6A 3CCJP 1M1JB 1FE6A 5KP8B 1LWUB 3B4QA 5CZDB 2K1AA 3LMOA 2WZ7A 2PY8A 2OYHA 3B5IA 2FYUJ 3RK3D 4AYCA 3L71G 1NQ4A 4WY4D 3L71E 1M90Q 3H1IE 2E75D 2KGAA 2ROQA 2KOOA 3L70E 1KMIZ
chains in the Genus database with same CATH topology
1YHQP 5F2KA 1VQ6P 3CCSP 4U0FA 3G6EP 1RO0A 2BHVA 1D1DA 3CCEP 5HGNA 1K9MQ 5HGLA 1S72P 5F2OA 2PEKA 1RNIA 1KD1Q 5JPAA 2XXMA 1Q82Q 2LF4A 4PH1A 1VQ9P 1VQNP 3G0VA 2PEOA 2M8LA 1JJ2O 5DCKA 3DS3A 1PEMA 2KODA 1Q7YQ 1IUQA 3HZQA 1AUMA 3Q20A 2DGYA 2M8NA 4IPYA 2JO0A 3CPWO 3CC7P 3VRLC 3H0DA 2PENA 2OTLP 1K8AQ 1PEUA 3NTEA 3RG6C 3CCRP 1YI2P 3E2DA 2Z45A 4XROA 1VQOP 3WBHA 1ZMBA 5BS1A 2Z46A 1KQSO 3CC4P 4GR2A 1YIJP 1RO2A 3DS5A 3CXCO 1YJ9P 1EOQA 4QNBA 2EFJA 2L6EA 4M0IA 5I4TG 4XFXA 2Z44A 3H4EA 2PEMA 1K73Q 3LRYA 3CD6P 3DS1A 1PEQA 1M1KQ 2CWOA 4U0EA 4U0DA 2EIAA 3DTJA 1BAJA 2PEIA 2ONTA 1VQ7P 2OARA 1KC8Q 2OTJP 2PEJA 4U0AA 3CCMP 3CCVP 3G29A 3CMEP 3DS4A 1VQPP 3CC2P 3DS2A 2XV6A 5HGOA 3OW2O 4U0CA 4COPA 3HYBA 1VQ5P 1QVFO 1M74A 3P05A 1VQ8P 2BUOA 3G28A 1A43A 1YJNP 3M1MA 3G4SP 3G1IA 3G71P 1A8OA 3CCQP 1QRJA 1E6JP 2PEQA 1NJIQ 3CCLP 2JYGA 3CCJP 4XFYA 1M6EX 3DPHA 1VQMP 5HGMA 2XT1A 4GR6A 3G21A 1VQ4P 3MGEA 1K30A 4XFZA 1EIAA 1M6NA 1YITP 1YJWP 3H47A 2EG5A 2P9XA 2PY8A 4XRQA 3B5IA 3DS0A 3G1GA 1W2BO 2BQ1E 2QEXP 1QVGO 4WYMA 1N8RQ 1VQKP 3I55P 2M8PA 1M90Q 4U0BA 1Q86Q 5BS2A 4COCA 3CMAP 2QA4P 3I56P 3CCUP 5F2NA 2E1MA 4PH0A 3G26A 2JYLA 1PEOA 1VQLP 1Q81Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ P;  1K8A Q;  1YI2 P;  3CCR P;  1VQ6 P;  1VQO P;  3CCS P;  1VQP P;  1YIT P;  1YJW P;  3CC2 P;  3G6E P;  3CCE P;  1K9M Q;  1KQS O;  3CC4 P;  3OW2 O;  1S72 P;  1VQ5 P;  1YIJ P;  3CXC O;  1KD1 Q;  1QVF O;  1YJ9 P;  1Q82 Q;  2OTL P;  1W2B O;  1VQ8 P;  1VQN P;  1VQ9 P;  2QEX P;  1YJN P;  1QVG O;  1N8R Q;  1K73 Q;  1VQK P;  3G4S P;  3G71 P;  3I55 P;  1JJ2 O;  3CCQ P;  3CD6 P;  1M90 Q;  1Q86 Q;  1Q7Y Q;  1NJI Q;  1M1K Q;  3CCL P;  3CME P;  3CMA P;  2QA4 P;  3I56 P;  3CCJ P;  3CCU P;  1VQM P;  3CPW O;  2OTJ P;  1VQ7 P;  3CC7 P;  1VQL P;  1KC8 Q;  1Q81 Q;  1VQ4 P;  3CCV P;  3CCM P; 
#chains in the Genus database with same CATH topology
 2YXR B;  3M9H A;  5HGN A;  3S4R A;  1JTH A;  3BAT A;  2JEE A;  1FZG A;  1M1J C;  1GL2 D;  1XTG B;  1GU5 A;  1PEM A;  1RF0 A;  2N1T B;  1NTM G;  2JKV A;  3AED C;  3Q20 A;  3V6I A;  4N78 E;  5CCG C;  1ZOY C;  3N4X A;  3E2D A;  5AW1 B;  3SFD C;  3L73 G;  2JAZ A;  1LT1 A;  3GHG B;  4N6J A;  1EOQ A;  3K5B A;  3L75 E;  2QIW A;  2E74 B;  3QH9 A;  1X0T A;  2O1J A;  2ONT A;  5APY A;  1PPJ D;  3KZI H;  1VQ7 P;  4DJG A;  2KOG A;  2JQ4 A;  2X2B A;  1GXG A;  1BXI A;  1A43 A;  3H32 B;  4ZKU A;  3AE5 C;  2Q1K A;  1OWA A;  3U1C A;  1GK6 A;  1CEI A;  3BRV B;  1PFI A;  3PHL A;  1T3J A;  1EC5 A;  1JY3 O;  1Q2N A;  4I7Z B;  2KUB A;  5CCH A;  4HJG H;  3G1G A;  3L74 G;  2I8D A;  4WYM A;  1USD A;  1SQX G;  1BSH A;  2A45 I;  3I5C A;  4COC A;  1JY3 N;  4LGD E;  2RN0 A;  5F2N A;  3V2P A;  3MUD C;  1VQL P;  4L73 A;  2HOD B;  5F2K A;  3MIW A;  1D1D A;  3ZDM A;  2LPK A;  1NAY A;  4PH1 A;  3AEE C;  3RG2 A;  3RK2 C;  5AVT B;  3AEG C;  1TU3 F;  3AEF C;  2KGE A;  1JY2 N;  2KOD A;  2KOS A;  2OGU A;  2LXB A;  5AVY B;  2C0X A;  4WWI A;  5L8R J;  1GD2 E;  4N78 D;  1X3O A;  1LWU C;  3MGN A;  2Z46 A;  1LNQ A;  2QJP C;  5GTH H;  3TK1 A;  1NTK D;  4PD4 E;  5I4T G;  1K73 Q;  1FZC C;  3LRY A;  1KIL D;  2QJK B;  1PEQ A;  1X79 B;  3H6P A;  1IC2 A;  2KNC A;  3U43 A;  2OAR A;  2H88 C;  2P2U A;  3Q2Y A;  3GF7 A;  1PPJ E;  3BAS A;  4H2X C;  3CC2 P;  1PL5 A;  3Q5S A;  5BU8 B;  2K5X A;  3O6Q B;  2YKQ A;  1M74 A;  3WMM 0;  4GOF A;  1SQB J;  4BXL A;  1CZQ A;  1OR5 A;  4BPG A;  2I1J A;  1EDL A;  2XU6 A;  4I7Z C;  3IF4 A;  2XT1 A;  1K30 A;  3FGA D;  2N6Y A;  3E7K A;  1AF8 A;  4PD4 H;  1RE4 C;  4C46 A;  3M9Q A;  2NO8 A;  1ZRT E;  2LOL A;  1N8R Q;  2AF8 A;  3CXH E;  2FQ0 A;  1AQT A;  3I55 P;  3VP9 A;  3VMY A;  1NU1 D;  5AW3 B;  2OYH C;  3L35 A;  5AW5 B;  2PRR A;  3CWB G;  1UIX A;  2FYN B;  4PJ0 H;  1S5L E;  2B9B A;  1KLP A;  5F2O A;  3CL3 D;  4OWF A;  3MZW B;  4A7P A;  1RY3 A;  1T2K C;  3HZQ A;  1LT9 B;  1KYO I;  5AVU B;  4K3A A;  3CCR P;  3NTN A;  2L9F A;  2ZVN B;  4O9B A;  1T3U A;  1L0N E;  1KQS O;  3CC4 P;  1GXH A;  1SQP D;  1EDK A;  2XZ1 C;  3RK2 B;  4RJT A;  3B5N D;  2DNW A;  3KDP B;  2AEM A;  4C7N A;  2HYN A;  1LT9 A;  2Q9I A;  5KLV D;  4AUW A;  3CCV P;  3L72 J;  2FKW B;  1WMK A;  4ZNC A;  5K5G B;  3DS2 A;  2KG9 A;  1OMI A;  3L70 J;  4H2W C;  1FZC B;  2WSE H;  1P84 I;  2BCC E;  1NTK J;  3CCL P;  2KOR A;  4YXW H;  1LTB C;  1KQL A;  4EDF A;  1U7J A;  3G9R A;  3PJS K;  2ZT9 D;  3JC2 2;  2IYO A;  1JNM A;  1YTZ I;  3W67 A;  2OYI B;  3SFE C;  2AXT H;  3B5N A;  4DOJ A;  5CCH C;  5APV A;  4UB6 H;  2Y9Z A;  2FYU E;  4W7Y A;  5AW8 B;  2LIU A;  4OGQ D;  3HD7 C;  2WPR A;  3L70 G;  4U0F A;  3C8V A;  4H44 D;  3U1A A;  2FVA A;  3LW5 J;  1Q82 Q;  2QJY B;  1NGM B;  1KIL C;  2GDW A;  5AW2 B;  2XDJ A;  2C9N Y;  4EI2 A;  2AEJ A;  4H0L D;  3GLM A;  1IUQ A;  1KB9 E;  2FVF A;  3CE7 A;  5EJD A;  2Y9Y A;  2E5T A;  2BCC G;  1SQV G;  4IFM A;  1FS0 E;  5APQ A;  2L22 A;  4H13 B;  2ITA A;  1YIJ P;  1RO2 A;  2ZYG A;  1KV4 A;  3VOP A;  4M0I A;  1FU1 A;  1LTA C;  1NTM K;  1SLQ A;  2FAC A;  3L74 D;  3CXH H;  3H1K G;  3GF3 A;  2ZXE B;  2LTE A;  3CCM P;  1N7S C;  1U7M A;  1SQQ G;  3E1R A;  3FWL A;  3HYB A;  4HH2 A;  2GZE A;  2MF4 A;  2K2Q A;  1A8O A;  1ZNV A;  4B86 A;  3MUD A;  1YQ3 C;  1OVU A;  1L0H A;  2FBW C;  2HPC A;  5E79 H;  2WT7 A;  3KXD A;  1F80 D;  4JBZ A;  1ZXG A;  3SWF A;  1VQ4 P;  2WSF H;  4XFZ A;  1H0T B;  2DW3 A;  5GTI E;  2N1T C;  3A0B H;  2E43 A;  2POH A;  1MFT A;  3EJB A;  3EQ2 A;  3USS A;  5EFW B;  1ZW0 A;  4U0B A;  2QA4 P;  2M5A B;  3C9I A;  2KR5 A;  2AVA A;  1KYO H;  2QRX A;  1DX7 A;  3G6E P;  1M1J A;  2Z5H A;  1NOH A;  4GKG A;  5HGL A;  1NTM D;  1R5S A;  4WY4 C;  1Q90 D;  5H2F E;  2M8L A;  2KSJ A;  3H25 A;  1S9K E;  5AW4 B;  3IAO A;  3CX5 D;  3PTZ A;  4UB8 H;  3H1K J;  2C9L Y;  3NFQ A;  1LTG C;  4DT0 A;  3CXC O;  1U57 A;  2BEQ D;  4R4M A;  1RHZ B;  3W68 A;  4OVN F;  3P32 A;  3DS1 A;  1NHL A;  2A45 G;  1QL2 A;  5KAI E;  1BAJ A;  1SFC C;  5AW9 B;  3L74 E;  3M0D C;  5KLI B;  5AVX B;  2N1T A;  2BCC J;  2VRS A;  2KS1 A;  3HTK A;  1PPJ G;  2QNW A;  1R5L A;  2ERH A;  4XA4 A;  3V4Q A;  1YBK A;  1L0L G;  3G4S P;  3G1I A;  3GHG C;  1GZL A;  1NYH A;  3CLQ A;  5HGM A;  3GHG A;  2GZJ A;  3A0H E;  4GIF A;  1J1E B;  3L74 J;  1T8Z A;  2PAJ A;  4I2L C;  1OVV A;  2L4B A;  1WT6 A;  3V2R A;  3LID A;  1EXJ A;  5BVZ A;  2Q3I A;  2NPS B;  2QEX P;  1D7M A;  1N73 B;  3HE4 B;  2QVA A;  1Q86 Q;  3P8C E;  1DV5 A;  1PIX A;  5CCG D;  4U3F J;  2GZG A;  2N1T D;  2K88 A;  3MTU E;  1E0H A;  3H32 A;  1RO0 A;  1JMB A;  2D2C D;  1QGK B;  3AE3 C;  4LC1 A;  1BE3 J;  2W6J H;  5AVZ B;  3AE4 C;  3DS3 A;  1RE3 C;  1HJB A;  4IZ6 A;  3AEB C;  1IFP A;  4BPH A;  4IPY A;  1FZA A;  1G2C A;  1S9K D;  3L72 G;  2JU1 A;  4XRO A;  2M8R A;  3CI9 A;  3Q5R A;  1NTZ D;  3TNU A;  3L37 A;  1L4A D;  1SS1 A;  2WQY C;  2IBZ E;  4QNB A;  2WVR A;  3VMA A;  1J1D C;  1NTK E;  2WPT A;  1DNY A;  2R32 A;  1NTM J;  4TT3 H;  3A0B E;  1AYI A;  1JOC A;  4U0D A;  2N5H A;  2HPC B;  1JY2 O;  2PEI A;  3F5H A;  3Q1M A;  2M3B A;  3AEA C;  3F89 A;  2N98 A;  1G2C B;  2XND H;  3MD0 A;  4YPC A;  2QM7 A;  1KYO E;  1VQ5 P;  1FDI A;  5APW A;  1LTS C;  3G28 A;  3H1K D;  5CBN A;  2N6Z A;  1QEX A;  3H1I J;  1PGP A;  5KJ7 D;  1PGQ A;  1KQG B;  1L0N J;  1VF5 B;  1GMJ A;  2OTK E;  4WB4 A;  4IL6 X;  1VPC A;  3RK3 B;  3G21 A;  1RF1 C;  4D6T E;  2QE7 H;  2CK3 H;  1KTM A;  3N7N A;  4XRQ A;  1LTI C;  2BQ1 E;  3KPE A;  1GW3 A;  5APX A;  1JEK A;  1ZRT D;  5KKZ B;  2HG5 D;  1M8O B;  5BU5 A;  4MRT C;  3CCU P;  3L75 G;  3OAK A;  1OW8 A;  3G26 A;  2YXQ B;  3S9O A;  1AQ5 A;  1UNK A;  4PV1 D;  2R5D A;  2ZT9 C;  1VQ9 P;  3WUT A;  3HE5 A;  2PEO A;  2Q3E A;  4TLF A;  5CJ4 A;  4M3L A;  1L0L D;  1EZV D;  1LTT C;  2DGY A;  2A06 E;  3PRJ A;  3H0D A;  2PEN A;  5E79 E;  1K05 A;  1SQQ D;  3AE8 C;  3L75 D;  3DS5 A;  1NTZ E;  3CWB D;  2VLO A;  2LXC B;  2W83 C;  1T6A A;  1SQP E;  1BCC J;  3HE5 B;  1IO4 A;  2OYO A;  1IZN B;  2JWD A;  2WMM A;  1VF5 D;  1URQ D;  2MVV A;  1SQX E;  3CME P;  2H89 C;  1SQB E;  1KN7 A;  2W6A A;  5KLV E;  2WSF J;  4HKZ H;  1L0I A;  4COP A;  4IL6 E;  2HR3 A;  1KB9 I;  3M1M A;  1BE3 E;  3A5T A;  2FXM A;  1KFM A;  3U59 A;  1N73 A;  3H1J G;  1NJI Q;  2I1K A;  2JYG A;  5CBO A;  4WBA A;  3MGE A;  4U3F E;  1P84 D;  4QKO A;  3HUS A;  1QLE D;  1YJW P;  4D6T D;  1SQX J;  4H13 D;  4GT1 A;  4JQ0 D;  2WSE J;  2WIT A;  5CCG A;  2GA1 A;  1SQV J;  3H1I D;  1RE4 A;  1FC2 C;  1HQB A;  2A45 H;  2J58 A;  3CCS P;  2KWL A;  1S72 P;  3AE9 C;  3M91 A;  4GDO A;  2KZJ A;  1JMM A;  2AXC A;  2H7H A;  1CW5 A;  1EQ7 A;  2GZI A;  1Q7Y Q;  5APS A;  1YTZ T;  2CPB A;  4PV1 C;  4OGQ C;  4BPF A;  3SSU A;  4ZKP A;  1EZV E;  3R2P A;  1W2E A;  2ZAE B;  2JO0 A;  1IK9 A;  3NTE A;  1YI2 P;  2A06 D;  3A7O A;  3NXS A;  1FZF A;  4NPF X;  3KZI E;  3RL0 C;  1Y8A A;  2IYP A;  2QG4 A;  2WPV B;  2BEZ F;  1FZB A;  2V7Q H;  3VP8 A;  5AVV B;  2KS1 B;  2IZ1 A;  3EFF K;  2FFD C;  2JGP A;  1PGO A;  2IFM A;  1N7S A;  1VL2 A;  2Q5U A;  1Y9B A;  2P1J A;  4QMA A;  5KP7 B;  1IFJ A;  1PZQ A;  1GL2 C;  3UIA A;  4U0A A;  2O3J A;  5TIS H;  2E74 C;  2KB7 P;  1SQB D;  4NEO A;  3GZL A;  3B5N C;  2YMK A;  1VQ8 P;  1SQQ K;  1KFN A;  1KB9 H;  2E75 B;  3L75 J;  3H1J E;  1SVF A;  1KOR A;  1G1I A;  2O01 J;  2QM8 A;  5KAF E;  3B8E B;  3EFG A;  1YIT P;  2R3S A;  1BSN A;  4GOD A;  2P9X A;  4U3F D;  3M9B A;  1K04 A;  1LP1 A;  4RES B;  3Q3D A;  4PJ0 E;  1HGZ A;  1HH0 A;  1AJY A;  1N7L A;  1S5L X;  1N2D C;  2WSC H;  4ASW A;  2XZ0 D;  1HTL C;  1SQV K;  1S3J A;  5TJH A;  2LL8 A;  1Q81 Q;  2K93 A;  2LIW A;  5KP6 B;  4F37 A;  3KQG A;  1S2E A;  3H1L D;  1VQN P;  3BCC G;  4U7J A;  3BCC E;  3D71 A;  1H88 A;  5CHX A;  1YYC A;  4H44 B;  1JJ2 O;  5DCK A;  2JBG A;  1USE A;  2FFD A;  1L4A A;  2W27 A;  2IPP A;  2KP8 A;  2E42 A;  1GTW A;  1ZMB A;  1MZ8 A;  3CX5 E;  4GR2 A;  4JYB A;  1CI6 A;  2KOP A;  1FZE A;  3QWO C;  1OW6 A;  1HJ0 A;  2E5Y A;  2Z44 A;  2E76 C;  1XTC C;  1RF1 A;  2Y0D A;  1M7L A;  2RMZ A;  2CNR A;  1SQV E;  3FXE A;  1QL1 A;  1L4A B;  2OTJ P;  3DS4 A;  3RL0 B;  1GW4 A;  4DG9 A;  2NPS C;  5H2F H;  4U0C A;  5AW6 B;  3P05 A;  1NTZ K;  2FQ2 A;  1FJP A;  2IBZ I;  2PGD A;  1Z56 A;  3AE7 C;  1AV1 A;  1M6E X;  3DPH A;  1PP9 J;  1IFI A;  3LIE A;  1EIA A;  2XV5 A;  1M6N A;  1EZV I;  3NY7 B;  3H47 A;  2H8P D;  2CG5 B;  2YIU C;  3RK2 D;  3HTK B;  5C39 A;  3CXH D;  2Q7C A;  4JF7 A;  2K0D X;  1DD4 A;  2XKM A;  1NU1 E;  2E1M A;  2Q6Q A;  2IBZ G;  3BRT B;  3FWN A;  2P10 A;  3IFM A;  2EHS A;  1KD1 Q;  2K9Y A;  2B87 B;  3C1L A;  1N86 A;  1ZR4 A;  3H1L E;  4EOT A;  5B5E H;  1ZLL A;  4OGQ B;  3MHV A;  2M8N A;  3CPW O;  2KI7 B;  2FQ1 A;  3WUV A;  2D2C C;  1RE3 A;  2SPZ A;  5CMZ A;  1URQ B;  2W90 A;  4I1L A;  2E74 D;  2XNX A;  3L4F A;  4R0M A;  1ZR2 A;  2KW2 A;  4LLH A;  1PP9 G;  2PEJ A;  3CX5 I;  3RL0 g;  1LTJ A;  1SQB G;  3D70 A;  2R3C A;  1DEB A;  3HUS B;  5B5E E;  1KYO D;  3G71 P;  3JSV C;  2KYV A;  3JCU E;  2N5I A;  4EYY Q;  2H43 A;  3H1L G;  2JWA A;  2KG8 A;  1RF0 C;  2MJZ A;  4IL6 H;  1LJ2 A;  1GPJ A;  2P7J A;  3HRN A;  2K94 A;  4Y28 J;  1QVG O;  2KGC A;  5KLV K;  3LW5 H;  3RK3 E;  5GTH E;  1VQK P;  5KJ7 C;  3GJN A;  4IOI H;  3L73 J;  5BS2 A;  3I56 P;  3L71 D;  3RBZ A;  1PEO A;  2FXP A;  1JO5 A;  3P8M C;  2RH0 A;  1YHQ P;  3L70 D;  1NTM E;  4RKU J;  1PP9 D;  1RQV A;  3CCE P;  4NPE A;  3JCU H;  3H1I G;  2N50 A;  4UB6 E;  1NKN A;  4PV1 B;  2KXP B;  1L0L K;  1L0L E;  1LTJ C;  2M3E A;  1RH5 B;  2E75 C;  1Z6M A;  1MKM A;  2O1K A;  1OIP A;  2IZ0 A;  4KJM A;  1NAF A;  2ZYD A;  1BDC A;  1T2K D;  2EFJ A;  1KIL E;  3AE1 C;  2ZYA A;  2B89 A;  3AE6 C;  5HV8 A;  2CWO A;  1KIL A;  2VLQ A;  1NU1 J;  1EXI A;  1M57 D;  3G29 A;  2L91 A;  2ZJS E;  2VLN A;  4Z1M H;  5KLV G;  4N3Y B;  3IN6 A;  1JTH B;  1BE3 G;  1E6J P;  2R44 A;  3KHU A;  1HY8 A;  3B71 A;  4OH8 B;  3T97 A;  1L2P A;  1W5C E;  2PNG A;  4PWV B;  5AVW B;  1ZV8 A;  4U3F G;  1NVO A;  3TNU B;  2WPQ A;  2GDX A;  2K0Y A;  2KLV A;  1HBW A;  3M06 A;  5DJU B;  3E1I A;  5KAF H;  2M8P A;  1JCC A;  2IDB A;  5EW5 E;  1NTK G;  4PH0 A;  3A2A A;  2JYL A;  3V4W A;  1VQ6 P;  2GDY A;  1NTK K;  3VMX A;  1GL2 B;  2MR8 A;  2YKP A;  1PP9 E;  4L74 A;  1PV3 A;  2D2C B;  2LF4 A;  2M0B A;  1JY3 P;  1NU1 G;  2GYK A;  1JY2 P;  1SFC A;  2Z5I A;  1DH3 A;  1GU4 A;  2YIU B;  2UWJ E;  2O01 N;  2LML A;  1NTZ J;  1S5L H;  4Y99 B;  3L73 D;  4Y99 C;  4MN4 C;  2OTL P;  1K8A Q;  5GTI H;  3RG6 C;  3L71 J;  1RF1 B;  4L76 A;  1OZH A;  2IBZ D;  5BS1 A;  1LTJ B;  1AFO A;  2FYU G;  3L36 A;  3G3Z A;  3EJE A;  1OXZ A;  3TGU D;  3A3Y B;  1FDO A;  1ACP A;  4JYC A;  1SP4 A;  3WU2 H;  4PD4 D;  1ZN5 A;  2R5B A;  4U0E A;  2EIA A;  3ABV C;  4C7N B;  4UB8 E;  2OYH B;  1KC8 Q;  1H89 A;  4W80 A;  1FOS F;  1L4A C;  2WTY A;  2XV6 A;  3VYI A;  3R4Y A;  3A0H H;  1FOS E;  1SQP K;  4KT0 J;  2WPS A;  1YJN P;  1HWT C;  2JJL A;  3BVH A;  1SFC D;  5KAI H;  1FDM A;  1URQ C;  2RKL A;  1QRJ A;  3CXH I;  2BAS A;  1BGY G;  4BRY B;  2Z4E A;  2KIK A;  2P67 A;  3GG2 A;  3DS0 A;  2OYI A;  4IFD K;  2GM4 A;  2FAE A;  3H1H G;  3CMA P;  2LR2 A;  5AVQ B;  4D6T G;  1J1D B;  2KNC B;  2KOQ A;  4BRY A;  2FYU K;  2NRG A;  1FAV A;  4WY4 A;  2AXT E;  4YXD C;  2BHV A;  2G8Y A;  3EWK A;  2PEK A;  1BGY J;  1A02 F;  3RGU A;  3Q5P A;  2Y0C A;  1ZP0 C;  2FXO A;  3RK3 C;  2K9J B;  4KHX A;  2K0X A;  3BCC D;  4WVZ A;  2K92 A;  1VF5 C;  5CJ0 A;  1IFM A;  2WSC J;  2N9B A;  1JUN A;  1GK4 A;  1JB0 J;  1SQQ J;  2JDI H;  2KZI A;  1PEU A;  1UII A;  4W7Z A;  2JO1 A;  1VQO P;  3L73 E;  4WY4 B;  1BCC D;  5AW0 B;  1EDJ A;  2JU2 A;  3H4E A;  1FJK A;  3S1K A;  3CD6 P;  3TGU E;  1SQP J;  2AEF A;  4CA3 A;  2ZT9 B;  2K9J A;  3DTJ A;  2Y0E A;  3T97 B;  2ZXX A;  1L0N G;  3RBX A;  1IK7 A;  1NTZ G;  1P84 H;  2G3A A;  2E76 B;  4IFF A;  3L72 D;  3HD7 A;  1J1E C;  1X9V A;  1X22 A;  4K35 A;  3PP5 A;  2MKV A;  2FFD B;  2E76 D;  2MR7 A;  1HGV A;  2HOD A;  3H1K E;  4R4L A;  5CCH D;  4XFY A;  1VQM P;  2NPS D;  1P84 E;  2IFN A;  2YMY A;  1A02 J;  3TYY A;  1LGH B;  1BCC G;  2L0Q A;  2YO3 A;  2CQ8 A;  3PH0 A;  2FYZ A;  2VLP A;  1IJD B;  2V4H A;  5KLI C;  1W2B O;  3HD7 B;  3HUS C;  1EMV A;  3H1H E;  1LWU A;  3TSI A;  1N7S B;  3AEC C;  2OQQ A;  4I6M C;  1MFZ A;  4PXH B;  1AA0 A;  2M5A A;  2EHT A;  2FYU D;  2A06 G;  4GOE A;  2AFD A;  5HVC A;  2J5U A;  2FY8 A;  5AVR B;  5AVS B;  5M1B A;  1RNI A;  2XXM A;  3OJA B;  4H13 C;  5APT A;  2ZVO B;  1HUC A;  1S1C X;  2FVE A;  2JB0 A;  2GZF A;  4RO0 A;  4ASV A;  2LKI A;  3OA7 A;  1PGJ A;  3CC7 P;  1DIP A;  5B66 H;  1KB9 D;  2PFX A;  3V2Q A;  2Z45 A;  2M5R A;  3HD7 D;  3WUU A;  1SQQ E;  2MY5 A;  1M56 D;  1BCC E;  1YQ4 C;  7CEI A;  3CWB E;  1JCD A;  1G1J A;  3B5N B;  1DD3 A;  2AFE A;  1M1K Q;  2JP3 A;  1SQB K;  4L75 A;  5AW7 B;  2WWW A;  5KJ7 A;  3BCC J;  3VMZ A;  4XE5 B;  3NMD A;  1VHN A;  3GKL C;  1VQP P;  3VTP C;  1L0L J;  3H1J D;  2BUO A;  3L72 E;  5APU A;  2LKM A;  1AVY A;  4H2Y C;  1KZU B;  3CCQ P;  4YTP C;  4DCK A;  2QSI A;  1IFN A;  2IX7 C;  2PEQ A;  1BE3 D;  1GDT A;  1NO4 A;  2WSS H;  1HF9 A;  1URQ A;  1R8E A;  4GR6 A;  3TDK A;  3V5B A;  1LP1 B;  3CWB J;  1VKU A;  1FR2 A;  2EG5 A;  1CI6 B;  4XFJ A;  5DJT B;  1E5W A;  1IMQ A;  1BGY E;  2J59 M;  2K37 A;  2CGQ A;  1GL2 A;  3P8C D;  3MP7 B;  4HYT B;  3H1H D;  1NWQ A;  4AQR D;  1N73 C;  3GZM A;  2B88 A;  1EDI A;  2MD9 A;  1MUU A;  1RQU A;  3H1L J;  2HLO A;  3KYQ A;  1WRG A;  2C0W A;  3M0D A;  5JPA A;  2GUV A;  1L0N K;  2KK7 A;  5KKZ C;  2YKO A;  2ZFC A;  2W6B A;  2KLU A;  3TF5 A;  3TGU J;  2MVU A;  3GW6 A;  1AUM A;  1E79 H;  2N9Y B;  1FZC A;  4D6T J;  3V2N A;  2W8Z A;  1L0N D;  4UHP B;  2HFE D;  3WBH A;  1H0T A;  1OW7 A;  2JR8 A;  4H44 C;  1YJ9 P;  2L6E A;  2PEM A;  3SWY A;  3B4S A;  4H0L B;  3O8Z A;  1DEE G;  2QJK C;  2GUS A;  1NU1 K;  1UJZ A;  1IFD A;  1SQX K;  3M0A A;  2O01 H;  3CX5 H;  3AE2 C;  2OYI C;  2QJP B;  1ZME C;  2FHS C;  3WU2 E;  1QVF O;  2B87 A;  2BCC D;  3GMA A;  4JPZ B;  2L5G B;  4DZO A;  2NZ2 A;  3EJD A;  4PD4 I;  1N7S D;  5TIS E;  2KSE A;  2PP6 A;  2K3R A;  3O6Q A;  4EIJ A;  2FAD A;  1SQP G;  1KQF B;  1QX8 A;  5KTB A;  1KIL B;  1BDD A;  2QJY C;  2CPS A;  5B66 E;  1S4X A;  1Y47 A;  1VDF A;  2YNY A;  1EZV G;  2VSQ A;  1MV8 A;  3SWK A;  1BGY D;  3H1J J;  4NPD A;  1H8A A;  1IMP A;  2FYN C;  2XZR A;  4H0L C;  3RL0 D;  3VN0 A;  2V7Q J;  2KGD A;  1K9M Q;  1X8Y A;  3P7K A;  4ZMD A;  3G0V A;  1OFC X;  4CPG A;  1LT9 C;  2P58 A;  1AVO A;  1NH4 A;  3ITK A;  2KG6 A;  3VRL C;  4HKG A;  3H1H J;  1T8K A;  3FXD A;  1J2J B;  4C7R A;  4HB1 A;  1CSB A;  3D6Z A;  1OVR A;  3D6Y A;  4BWN A;  2WT7 B;  2NPS A;  4XFX A;  2YO2 A;  3HE4 A;  3TGU G;  1SQX D;  1NKZ B;  1FBM A;  1HVV A;  1SQV D;  1OX3 A;  1SFC B;  5HGO A;  3OW2 O;  3FX0 A;  3IR9 A;  1JM0 A;  1MZ9 A;  3PLN A;  5KLV J;  3II6 A;  3CCJ P;  1M1J B;  1FE6 A;  5KP8 B;  1LWU B;  3B4Q A;  5CZD B;  2K1A A;  3LMO A;  2WZ7 A;  2PY8 A;  2OYH A;  3B5I A;  2FYU J;  3RK3 D;  4AYC A;  3L71 G;  1NQ4 A;  4WY4 D;  3L71 E;  1M90 Q;  3H1I E;  2E75 D;  2KGA A;  2ROQ A;  2KOO A;  3L70 E;  1KMI Z; 
#chains in the Genus database with same CATH homology
 1YHQ P;  5F2K A;  1VQ6 P;  3CCS P;  4U0F A;  3G6E P;  1RO0 A;  2BHV A;  1D1D A;  3CCE P;  5HGN A;  1K9M Q;  5HGL A;  1S72 P;  5F2O A;  2PEK A;  1RNI A;  1KD1 Q;  5JPA A;  2XXM A;  1Q82 Q;  2LF4 A;  4PH1 A;  1VQ9 P;  1VQN P;  3G0V A;  2PEO A;  2M8L A;  1JJ2 O;  5DCK A;  3DS3 A;  1PEM A;  2KOD A;  1Q7Y Q;  1IUQ A;  3HZQ A;  1AUM A;  3Q20 A;  2DGY A;  2M8N A;  4IPY A;  2JO0 A;  3CPW O;  3CC7 P;  3VRL C;  3H0D A;  2PEN A;  2OTL P;  1K8A Q;  1PEU A;  3NTE A;  3RG6 C;  3CCR P;  1YI2 P;  3E2D A;  2Z45 A;  4XRO A;  1VQO P;  3WBH A;  1ZMB A;  5BS1 A;  2Z46 A;  1KQS O;  3CC4 P;  4GR2 A;  1YIJ P;  1RO2 A;  3DS5 A;  3CXC O;  1YJ9 P;  1EOQ A;  4QNB A;  2EFJ A;  2L6E A;  4M0I A;  5I4T G;  4XFX A;  2Z44 A;  3H4E A;  2PEM A;  1K73 Q;  3LRY A;  3CD6 P;  3DS1 A;  1PEQ A;  1M1K Q;  2CWO A;  4U0E A;  4U0D A;  2EIA A;  3DTJ A;  1BAJ A;  2PEI A;  2ONT A;  1VQ7 P;  2OAR A;  1KC8 Q;  2OTJ P;  2PEJ A;  4U0A A;  3CCM P;  3CCV P;  3G29 A;  3CME P;  3DS4 A;  1VQP P;  3CC2 P;  3DS2 A;  2XV6 A;  5HGO A;  3OW2 O;  4U0C A;  4COP A;  3HYB A;  1VQ5 P;  1QVF O;  1M74 A;  3P05 A;  1VQ8 P;  2BUO A;  3G28 A;  1A43 A;  1YJN P;  3M1M A;  3G4S P;  3G1I A;  3G71 P;  1A8O A;  3CCQ P;  1QRJ A;  1E6J P;  2PEQ A;  1NJI Q;  3CCL P;  2JYG A;  3CCJ P;  4XFY A;  1M6E X;  3DPH A;  1VQM P;  5HGM A;  2XT1 A;  4GR6 A;  3G21 A;  1VQ4 P;  3MGE A;  1K30 A;  4XFZ A;  1EIA A;  1M6N A;  1YIT P;  1YJW P;  3H47 A;  2EG5 A;  2P9X A;  2PY8 A;  4XRQ A;  3B5I A;  3DS0 A;  3G1G A;  1W2B O;  2BQ1 E;  2QEX P;  1QVG O;  4WYM A;  1N8R Q;  1VQK P;  3I55 P;  2M8P A;  1M90 Q;  4U0B A;  1Q86 Q;  5BS2 A;  4COC A;  3CMA P;  2QA4 P;  3I56 P;  3CCU P;  5F2N A;  2E1M A;  4PH0 A;  3G26 A;  2JYL A;  1PEO A;  1VQL P;  1Q81 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...