3G6EP

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g6eP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g6eP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g6eP02
3G71P 3CCMP 3CCSP 2OTJP 1VQ8P 1VQKP 1KD1Q 3CMEP 1QVFO 1Q86Q 3CCEP 3CC7P 1JJ2O 3CCLP 3CPWO 3CCQP 3I56P 1VQ7P 3CMAP 1K8AQ 2OTLP 1YJNP 1VQ6P 3CD6P 1M1KQ 3I55P 2QEXP 3CCUP 1YI2P 1KC8Q 3CC4P 2QA4P 1M90Q 3G4SP 1VQPP 1YJ9P 1QVGO 3CXCO 1VQ9P 1VQMP 1YJWP 1W2BO 1YIJP 3OW2O 1Q82Q 1YITP 1K73Q 3CCRP 3CCVP 3CCJP 1VQ5P 1Q7YQ 1VQ4P 1S72P 1KQSO 1VQNP 1YHQP 1N8RQ 1VQOP 3G6EP 1Q81Q 1K9MQ 3CC2P 1VQLP 1NJIQ
chains in the Genus database with same CATH superfamily
1JMBA 2R32A 1IFJA 2MR8A 1VF5B 3C8VA 1N7LA 3CCEP 3AE8C 2KOQA 1SQVK 4D6TJ 1JM0A 2O01H 2W83C 4UB6E 2W6BA 3FGAD 3KYQA 3IF4A 2N1TD 1SQBG 2FYUK 3M1MA 2MKVA 2G8YA 1LP1B 1M57D 2JJLA 1NTKE 1X9VA 3WU2H 5APWA 2A45I 2DW3A 2WQYC 2EFJA 1KYOE 1JCCA 3EJDA 1N8RQ 2IBZD 3L70G 1PGOA 4R4MA 2RKLA 3LW5H 1FJPA 4W7YA 1JY2N 1OFCX 1SLQA 3CLQA 3H1HD 4WBAA 5HGMA 1LTBC 3CXCO 1KZUB 3U59A 1K73Q 4YPCA 2KS1A 4LC1A 1YBKA 3LIEA 1NU1J 4U3FD 2QJKC 2POHA 3SWYA 1KQGB 1IC2A 5CJ4A 4RKUJ 2ZVOB 3FXEA 4DZOA 2RH0A 2K2QA 1EDIA 2M3BA 2LKIA 1IJDB 2E43A 2FVEA 1QRJA 2CPSA 3L71J 5AW2B 2KS1B 3CWBG 1NTKD 1SQBK 1N73A 2OTJP 2P10A 2KR5A 1UIIA 3TYYA 2KORA 1ZR4A 3SWKA 4COCA 3TF5A 4RO0A 2IBZG 2KGCA 1KC8Q 1EC5A 5AVXB 3A0BE 2KG9A 1E0HA 2C0WA 2WSCJ 3RBXA 3Q3DA 2KP8A 3RBZA 2FYUG 1BE3G 1FC2C 3E7KA 1HJBA 5KJ7C 3EQ2A 3NMDA 1BGYE 1T2KD 1EQ7A 2ITAA 1BCCD 3AE5C 3ZDMA 1FAVA 2N1TB 1LTJB 3DS4A 2W8ZA 1LTTC 1BDCA 3TNUB 5B66H 1E5WA 1SQXE 2P2UA 2RN0A 1DD3A 2JO1A 2HODA 3ABVC 1Z6MA 2K9JA 3M0AA 4XROA 1CI6B 3H32B 2L5GB 4XFXA 1MV8A 1FZEA 3CC7P 5TISE 1T3UA 5HGLA 3C1LA 2N6ZA 4U3FJ 1R8EA 2PEIA 2CK3H 2ZXXA 3KPEA 4EI2A 3L75D 4QNBA 1ZNVA 2GYKA 1SQVJ 2AXCA 1NKNA 1RY3A 4ASWA 2H88C 3NY7B 1S5LX 3H1JG 2OYHC 5KAIE 1H8AA 3RL0B 1PIXA 3L74G 3SWFA 1Q2NA 1JMMA 2E76D 4H44C 3GMAA 4JF7A 4N78D 4U0FA 1J2JB 2AXTH 2PAJA 5I4TG 3G21A 3B5NA 3MZWB 4OGQD 1SQQJ 2XNDH 4NEOA 1PGQA 1NTZJ 1JCDA 3H0DA 1RF1B 2L9FA 4W7ZA 3AE7C 3CI9A 2BCCJ 3HUSA 3GZLA 1PEMA 1KFMA 3O6QB 1ZOYC 3A0HE 4I1LA 1L2PA 1J1DC 3O8ZA 2W27A 2KGDA 3SFDC 2FXPA 2E75D 4PH0A 1IFPA 2N9YB 2E5YA 5C39A 3VMZA 1CZQA 2XV5A 1ZW0A 2IBZI 3V5BA 1NU1K 1YTZI 2XZRA 2GM4A 3RK3D 1PZQA 2KG6A 2MVVA 3KDPB 1KB9E 5GTIE 2KOGA 1IZNB 4GOEA 1VQLP 1HH0A 3B5NB 3T97A 3P32A 2BCCE 1JEKA 1NGMB 1UIXA 3I55P 2ZAEB 2JWDA 2P7JA 1G2CA 1PP9J 2AFEA 2JB0A 5AW9B 3FWNA 1D7MA 4N78E 3G6EP 5E79H 3G71P 4TLFA 3NXSA 2E76C 4H44D 3D71A 1T6AA 3V6IA 3H1IG 1ZLLA 3AE9C 5APYA 1OWAA 3H1LG 2CWOA 2P9XA 1BGYG 2WSFH 2YMYA 1YJ9P 1KB9D 4BPHA 2M8NA 3CCVP 1RE3C 3CE7A 2HYNA 1BGYJ 3Q5RA 2YXRB 4AQRD 2FYNB 2NPSA 3RGUA 1FU1A 2D2CD 4Y99B 2Z45A 5B5EH 1RO2A 1AV1A 1LT9B 2OTKE 2KYVA 1KQLA 5GTHE 3AEDC 1N73B 1LJ2A 1M1JC 5KJ7D 4A7PA 4GOFA 1LWUC 4IOIH 4XE5B 3AEBC 1E79H 1S72P 1PGJA 2PGDA 2WITA 2QSIA 1JY3N 1IFIA 2YO3A 5K5GB 1RE4C 1VF5D 4OGQC 2LMLA 1K30A 2ZYAA 4U0DA 4GIFA 3JCUH 4HKGA 4BRYA 1DH3A 4U0BA 4PD4E 2NZ2A 2M5AB 5KKZC 4YXDC 2DGYA 5AVUB 3CC2P 1W2EA 3RK2B 3M9QA 3B71A 2LKMA 3M9BA 1X0TA 3VMXA 2FQ1A 1SQQK 2ZT9D 5CZDB 4LGDE 5KLIB 2KSEA 3WUUA 1NTZK 2H89C 5EW5E 1KILC 3DPHA 1SS1A 4TT3H 3GHGA 2FYUE 1HUCA 3W67A 2B89A 4EIJA 3A7OA 2FADA 2JO0A 1EZVG 2FACA 1DEBA 3PP5A 3SSUA 2K0DX 1LTJC 1L0NJ 4L76A 1VQMP 5HVCA 1QEXA 1JY3O 3K5BA 1AA0A 5KP8B 1HGVA 5KLIC 1Q90D 3TDKA 1OW6A 3RL0D 3BCCE 2L0QA 1UJZA 4PXHB 4H13C 4R4LA 2A45H 4OVNF 1BGYD 2KIKA 3DS5A 3CX5E 4IFMA 1WRGA 3G3ZA 1VQ9P 3L73D 2GDYA 1KQSO 3OA7A 3BCCG 2KOSA 2R3CA 1M90Q 2ZYDA 1KD1Q 4K3AA 4L75A 2O3JA 1N7SD 3D6YA 2PY8A 1SQPK 3NTNA 2WT7B 1H0TA 2KXPB 1L4AD 1S9KE 4I7ZB 4RJTA 3B5NC 3V4WA 3B8EB 5CBOA 5CJ0A 1RF0C 3U1AA 2LL8A 2OYOA 2VLNA 4WVZA 4NPDA 1M74A 5KLVJ 4C7RA 1EIAA 1URQB 2BHVA 3H1LD 2ZYGA 1GK6A 4BWNA 3TGUD 5KLVE 1HVVA 1L4AA 3AECC 1H89A 4U0CA 1RF1A 4CPGA 3CXHD 4NPEA 2M0BA 5GTHH 1NTKK 1MUUA 3V2NA 3CWBJ 1T3JA 3L71G 3ITKA 1KYOD 3FX0A 1U57A 4H13D 2JEEA 1Q7YQ 2AFDA 5APXA 2Y0DA 3HRNA 1VQ8P 3HD7C 2IFMA 2E75C 1NU1G 4PD4I 1GZLA 1SQBD 2N6YA 2IYPA 4H2XC 4IZ6A 2QRXA 1KYOI 2AXTE 3G1GA 1VQ4P 3HE4A 2N98A 3RK2D 3EJBA 4PD4D 5CCGD 2QJPB 2WZ7A 5CCGA 5AVYB 2Q6QA 2FKWB 4GR2A 1JY2P 2Q1KA 2PRRA 2XV6A 4IFFA 2JYGA 2VLOA 1SQVD 1DIPA 1BE3D 2FAEA 3H1LJ 2IFNA 2FQ2A 3BRTB 2LR2A 2VRSA 3L74E 2GDXA 3TGUJ 1A02J 1N7SC 1A43A 2W90A 3HTKA 3H1KG 3EWKA 3VP9A 4WY4C 4I6MC 1G1IA 2A45G 2W6AA 1L4AB 2GUVA 3H47A 1OZHA 1P84E 2GUSA 2ZT9C 3CX5I 3VTPC 2KLVA 2KWLA 2WTYA 5AVWB 4UB6H 1VQ6P 1RF0A 3CL3D 1K04A 2XZ0D 5KAFE 1ZXGA 1OX3A 3L75J 3CCJP 1QL1A 2H7HA 2LTEA 3TGUG 3LW5J 3B5IA 4C7NB 4DT0A 3FWLA 4BXLA 3BASA 3KHUA 1VDFA 2JP3A 2CQ8A 4MRTC 3EFFK 5HGOA 5F2NA 1M1KQ 1NKZB 5CBNA 2KLUA 2AVAA 3H1JD 2WT7A 1KYOH 5KLVK 1BXIA 4JYCA 5EFWB 4H0LD 1QX8A 1LTAC 1OIPA 1YQ3C 1FZBA 1SQQG 3TNUA 2P1JA 4OH8B 4IFDK 3H1HE 1R5SA 3CX5D 3MUDC 2OTLP 1NTMG 1VKUA 3CCUP 2E74C 2EG5A 5BU8B 3VN0A 1PP9D 2K88A 5BU5A 1SQPE 2M8LA 1Q82Q 3HE4B 1YITP 1NTME 1IO4A 1U7JA 1IFMA 2H8PD 2C0XA 2VSQA 1SQVE 2VLQA 1J1EB 3G29A 3VMYA 4EYYQ 1RHZB 3HE5B 1NAFA 3V2QA 1RNIA 2AEMA 4H0LC 3JCUE 3HD7A 1L0LK 3RG2A 2E5TA 2LPKA 3L71D 2AEFA 2YMKA 3B4SA 3RG6C 3U1CA 1L0LG 1SFCB 2A06G 2QJPC 3Q1MA 3A0BH 1GPJA 2QNWA 3AE6C 2QA4P 2KOOA 2CNRA 3DS0A 2G3AA 3E2DA 2NRGA 4COPA 4R0MA 4IL6H 2YKPA 5KTBA 1WMKA 1AVOA 2Z44A 1IFDA 1LT9A 4CA3A 3N7NA 2N9BA 2Q7CA 7CEIA 2M5AA 3MD0A 2WSFJ 3Q20A 4BRYB 4IPYA 3MGEA 2Z46A 3VYIA 1M8OB 3PHLA 1FR2A 2GZJA 1OW7A 2EHSA 1TU3F 1WT6A 5TISH 1AYIA 4XFYA 4ZMDA 3TGUE 3AEEC 4XA4A 5AW6B 2OYIB 3AE2C 4PWVB 2MF4A 3CX5H 3F89A 1YYCA 3WUVA 1DX7A 5APQA 3L72E 2OYIC 3KZIE 2JQ4A 2QVAA 2O1JA 3MHVA 3H1KD 1ZR2A 1PGPA 3HE5A 1D1DA 1KV4A 1VQ7P 3GHGC 1SQPG 1E6JP 1L0HA 2PEMA 2Y9YA 1RQUA 4DJGA 1H88A 1JOCA 5AVZB 1MZ8A 2FYZA 5AW0B 2ZJSE 2NPSD 1GD2E 5CCHC 3MP7B 1S4XA 3L70E 1XTCC 4IL6X 2ONTA 1M56D 3Q2YA 2CG5B 1GXHA 2K94A 3L72D 3DS3A 1G2CB 2BCCD 2K37A 1QVGO 1FZGA 2L6EA 2OYHA 2Y0CA 2YKOA 3HUSB 2J5UA 1AF8A 3OAKA 2KK7A 3NTEA 1LTSC 1X22A 5AW5B 5JPAA 2FXMA 1NTZE 1PV3A 1MFTA 2B88A 2HODB 2XZ1C 4U3FG 1A8OA 1HY8A 1X79B 1LGHB 1GXGA 3G9RA 3F5HA 1LT1A 1VQKP 3E1RA 1URQA 1PEQA 2NPSC 3AEFC 3DS2A 1EXIA 1T8ZA 1GDTA 1NVOA 2JU2A 3OJAB 5BS1A 1JB0J 1GL2D 1VQNP 2Q3IA 3L73E 1A02F 3B4QA 4L73A 4UB8E 4BPGA 1Y47A 2YO2A 2C9NY 3GW6A 5AW8B 4JBZA 2M5RA 3EFGA 1XTGB 2FYUJ 2WPVB 3H1IE 4EDFA 3HD7D 1EDLA 3IFMA 3JSVC 1AFOA 2BEZF 3T97B 1F80D 2IPPA 1FZFA 3B5ND 2EHTA 5KKZB 4BPFA 2A06D 2WSCH 3RL0g 1N7SB 4GKGA 3D70A 3BCCJ 2FFDB 2WSSH 2FHSC 1G1JA 1YJWP 2OYHB 1IK9A 3GG2A 1EZVE 5F2OA 3PH0A 4LLHA 1LWUB 1RE3A 3CMEP 5AVSB 2IYOA 5EJDA 1NYHA 1SQBE 1PPJD 2KODA 5KJ7A 1GK4A 2WPQA 2FQ0A 1EDKA 1VF5C 2YKQA 3CC4P 1MFZA 5HV8A 4N6JA 4PJ0E 2B9BA 2V7QJ 3EJEA 1FJKA 1FDOA 2BEQD 5B66E 2FVAA 3WU2E 2HPCA 2Z4EA 1QVFO 2LXCB 1H0TB 2PEOA 1PFIA 1OMIA 3I56P 1HWTC 1RH5B 5CMZA 2IX7C 2Q5UA 4RESB 3PLNA 4KT0J 3H1HJ 1NTZG 4QKOA 1ZMBA 3CCSP 1CSBA 1RQVA 2JKVA 2V7QH 2PP6A 3PTZA 1PP9E 1OR5A 1YJNP 1GW4A 2H43A 4C7NA 2GZEA 3L75G 3L37A 1EXJA 2I1JA 3OW2O 2KGAA 2J59M 4AUWA 1SFCC 1AQ5A 4NPFX 3CCMP 3L72G 5CHXA 2D2CC 2E74B 2XXMA 1SP4A 3JC22 1SQVG 1IFNA 1BCCG 4JQ0D 3LMOA 1S1CX 1EMVA 1NU1D 4B86A 1FOSE 1DV5A 1JTHB 3M91A 1CW5A 2K92A 1P84H 1LTJA 5E79E 2LF4A 2QM7A 4ZNCA 2FFDA 2KB7P 2WPSA 4O9BA 2CGQA 2K9YA 1JO5A 3D6ZA 2MR7A 3A5TA 1KILA 2LIWA 2D2CB 1KQFB 1M7LA 3VP8A 2WWWA 1L4AC 2JAZA 1LNQA 1M6NA 1FE6A 1YQ4C 1P84D 4WY4A 3H1IJ 1PPJG 4ZKUA 2KG8A 3H1LE 2L22A 4JYBA 5AVVB 3P8MC 1ZV8A 4F37A 3L35A 3KXDA 2K5XA 1URQC 2L4BA 3DS1A 2MJZA 1BCCJ 4HB1A 3L36A 4I2LC 1U7MA 2Q3EA 3H1JE 3M0DC 2IDBA 2KZJA 1FS0E 3U43A 4L74A 2QEXP 1GU4A 3KZIH 4ASVA 2E74D 2DNWA 4XRQA 3IAOA 3S4RA 5DCKA 1S5LH 4YTPC 3AE4C 2E42A 2PENA 2FY8A 1FDIA 2KGEA 2K3RA 3TK1A 3VMAA 3GJNA 2O01J 3P05A 1GL2B 1KILE 1KN7A 5F2KA 1N7SA 3GKLC 1MKMA 5L8RJ 1KMIZ 2HFED 2LIUA 2PEQA 2ZVNB 1OXZA 2PFXA 1Y9BA 1KORA 1L0ND 4N3YB 2XNXA 3L70J 5H2FH 1SQQE 4OGQB 2XU6A 1FZCA 4K35A 2GZGA 1AQTA 5APTA 1BE3E 4HYTB 1JY3P 1S2EA 3L4FA 1SQXD 2K1AA 3M0DA 2QJYB 1JNMA 1LTGC 5DJTB 1CI6A 5HGNA 4WYMA 4WB4A 3USSA 3TSIA 3QH9A 4AYCA 1IMQA 1GTWA 3H1ID 3AEAC 3V4QA 3VOPA 2QJYC 2R5BA 3RK2C 2VLPA 2QJKB 4D6TG 2Y0EA 1LWUA 2JGPA 2L91A 1L0NK 1USDA 2YIUC 4HJGH 1KB9I 2OYIA 1LT9C 1L0NG 2N5IA 2WPTA 5AVTB 3M06A 1NQ4A 1IUQA 2Y9ZA 1NWQA 1SFCA 1PL5A 5DJUB 2UWJE 1K9MQ 1FZCB 1X8YA 4H0LB 3CWBE 3CXHE 5APVA 3UIAA 3HD7B 2KW2A 2X2BA 2FBWC 1L0IA 3HUSC 4Y28J 5AW1B 5BS2A 3M9HA 1NO4A 2GA1A 2ZXEB 1KILD 1YTZT 1Q86Q 1ZP0C 3L72J 2KOPA 3AE3C 3CMAP 2MD9A 3GF3A 4XFJA 3H25A 2R3SA 3R2PA 5GTIH 3QWOC 4DG9A 2I1KA 3L70D 3L71E 2Z5IA 2IBZE 4GODA 3S9OA 3CPWO 4YXWH 2ERHA 4PJ0H 4JPZB 3NFQA 4M0IA 3H4EA 5APSA 1DD4A 2QIWA 1YIJP 2NO8A 1QGKB 3WMM0 4Z1MH 2JWAA 1YHQP 3A0HH 3RK3E 5KLVG 4U7JA 2K93A 2ZFCA 1Z56A 4KHXA 1NTKG 3H32A 3RK3B 2Z5HA 1HBWA 4KJMA 1DEEG 1P84I 1BSHA 4IL6E 1AVYA 2M8RA 2YIUB 1EDJA 1NOHA 1ZRTE 4H2YC 1Q81Q 2R44A 1GL2C 1SQPJ 3II6A 2KNCB 1FBMA 5APUA 1KILB 4H44B 3KQGA 4GR6A 3N4XA 5H2FE 3L74D 4M3LA 1LP1A 1L0NE 3G26A 3MIWA 1OVRA 2QM8A 1S9KD 2B87B 1IK7A 1HQBA 1FOSF 1N2DC 1HGZA 2KZIA 4EOTA 1M1JB 1N73C 5CCGC 3H6PA 3IR9A 1EZVI 3MGNA 1ZN5A 2V4HA 2WSEJ 1CEIA 1PPJE 1RO0A 3G4SP 3RK3C 3PJSK 2KSJA 3SFEC 1HJ0A 2XT1A 3WUTA 1NTKJ 1JUNA 2W6JH 2N50A 2MVUA 2FXOA 1NU1E 3L73J 1S3JA 5AW3B 3CCQP 5KP7B 1ZMEC 2E75B 1JTHA 1VPCA 4QMAA 1VQPP 3FXDA 2JU1A 2BCCG 2PNGA 1AJYA 3LIDA 3Q5SA 4XFZA 2B87A 1MZ9A 2FFDC 4U0EA 4H2WC 2KUBA 2P67A 3VRLC 1GL2A 1SQXG 1X3OA 5KAIH 2HPCB 1GW3A 3I5CA 1BDDA 3GZMA 1IMPA 1PEOA 2PEJA 1W2BO 2JYLA 4PD4H 5KLVD 1VQOP 3L74J 1LTIC 3DTJA 1QLED 3CCLP 2XDJA 3C9IA 1SQXK 4D6TD 1NTMK 1OVUA 2M8PA 2I8DA 3GHGB 4OWFA 1BCCE 3P7KA 3LRYA 2BASA 5CCHD 3BATA 1NAYA 5AVRB 4UHPB 2OQQA 1VHNA 2M3EA 2EIAA 3CXHI 3V2PA 2WMMA 3P8CE 3V2RA 4W80A 1HTLC 4PV1B 2K0YA 4D6TE 3Q5PA 4U3FE 2A06E 1FDMA 1L0LD 1N86A 3MUDA 3A3YB 4WY4B 1EZVD 3AE1C 2WVRA 1SQQD 3G28A 1KB9H 3HYBA 1NTZD 1NTMD 1BE3J 2WSEH 1YI2P 2P58A 2O1KA 3HZQA 5KP6B 1PP9G 3GF7A 4C46A 2Q9IA 2FYNC 1NHLA 2PEKA 2SPZA 1KTMA 3BVHA 3G1IA 4ZKPA 3P8CD 2HG5D 2LOLA 4I7ZC 3PRJA 4DOJA 2NPSB 1ACPA 1J1EC 2J58A 3H1KJ 2C9LY 1J1DB 5KAFH 1VQ5P 2OARA 2LXBA 3RL0C 1KLPA 3WBHA 1NH4A 2QE7H 1RF1C 2YXQB 2JDIH 2CPBA 3MTUE 4PH1A 1K8AQ 1R5LA 3H1HG 5AW4B 2YNYA 4UB8H 2N1TC 5B5EE 2XKMA 2BUOA 4WY4D 1S5LE 1FZCC 2R5DA 4H13B 3L75E 1SQPD 2KNCA 3G0VA 1KFNA 4PV1D 2BQ1E 5AW7B 1SFCD 2HR3A 1VL2A 2K9JB 1UNKA 1L0LJ 3CXHH 1AUMA 1BSNA 2GDWA 1M6EX 2QG4A 2RMZA 4HH2A 1T8KA 3CWBD 2IZ0A 5AVQB 1RE4A 1BAJA 2K0XA 1OW8A 2GZIA 2MY5A 2N1TA 2AEJA 5BVZA 1SVFA 1L0LE 3HTKB 1EOQA 1GMJA 2AF8A 3H1JJ 1URQD 3S1KA 2FVFA 4GT1A 1Y8AA 1SQBJ 3CCRP 2FYUD 3E1IA 4MN4C 2OGUA 1SQXJ 1NTMJ 3AEGC 1USEA 1W5CE 3R4YA 4U0AA 1JJ2O 4PV1C 2E76B 3CD6P 1OVVA 3W68A 5M1BA 2IZ1A 3IN6A 2GZFA 2KI7B 4DCKA 2ZT9B 3H1KE 2JR8A 1QL2A 1K05A 1NJIQ 2O01N 1FZAA 3L73G 2JBGA 2WPRA 3GLMA 1M1JA 2N5HA 5CCHA 2ROQA 1DNYA 3BRVB 3A2AA 5TJHA 1GU5A 1JY2O 4WWIA 4HKZH 1ZRTD 4GDOA 4Y99C 3O6QA 2E1MA 1PEUA 3BCCD 1T2KC 1HF9A 2HLOA
chains in the Genus database with same CATH topology
2OTJP 2PEQA 1VQ8P 3CMEP 2Z44A 2Z45A 3NTEA 1RO2A 1Q86Q 3CCEP 1AUMA 2EIAA 2KODA 4COCA 3CMAP 5HGOA 5JPAA 3H0DA 3Q20A 1M6EX 5F2NA 1KC8Q 1M1KQ 3DS5A 4IPYA 3MGEA 3CC4P 2Z46A 1RO0A 3G4SP 1BAJA 1VQ9P 1PEMA 3G1GA 2XT1A 1VQ4P 1M6NA 1S72P 1KQSO 1A8OA 4XFYA 1EOQA 4PH0A 3M1MA 1M90Q 1QVFO 1VQKP 1KD1Q 2PEOA 3G28A 1PEQA 3CPWO 3CCQP 3HYBA 3I56P 3DS4A 2PY8A 1K30A 2OTLP 3DS2A 5HGNA 4WYMA 3CCUP 1YI2P 4U0DA 2EG5A 4M0IA 3H4EA 3HZQA 1VQPP 5BS1A 4GR2A 2M8LA 4U0BA 1YIJP 1Q82Q 1YITP 2BQ1E 2XV6A 3CCRP 2JYGA 3DS1A 2EFJA 1VQNP 2DGYA 4XFZA 1YHQP 1N8RQ 2PEKA 1ZMBA 3CC2P 4XROA 1VQLP 3G1IA 3CCSP 4XFXA 4U0AA 1D1DA 4U0EA 3CC7P 1JJ2O 3G29A 1M74A 5HGLA 1VQ7P 1EIAA 1RNIA 1E6JP 1YJNP 3VRLC 3CD6P 3I55P 2QEXP 2PEMA 2BHVA 2PEIA 1A43A 5HGMA 3CXCO 1PEOA 2PEJA 1W2BO 3OW2O 2JYLA 1K73Q 4QNBA 1IUQA 1VQ5P 2OARA 4XRQA 1VQOP 3G6EP 3DPHA 1Q81Q 3WBHA 3RG6C 1K9MQ 3DTJA 3H47A 5DCKA 1NJIQ 3G71P 3CCMP 2ONTA 4U0CA 2PENA 3CCLP 4GR6A 3DS3A 2JO0A 4PH1A 2XXMA 1K8AQ 2CWOA 1VQ6P 2P9XA 2M8PA 2QA4P 2BUOA 1YJ9P 1QVGO 3P05A 3DS0A 3LRYA 3E2DA 1VQMP 1YJWP 4U0FA 1QRJA 2M8NA 5F2KA 3CCJP 3CCVP 2L6EA 2E1MA 3G26A 5F2OA 4COPA 1Q7YQ 2LF4A 1PEUA 5BS2A 3G0VA 5I4TG 3G21A 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  3CCM P;  3CCS P;  2OTJ P;  1VQ8 P;  1VQK P;  1KD1 Q;  3CME P;  1QVF O;  1Q86 Q;  3CCE P;  3CC7 P;  1JJ2 O;  3CCL P;  3CPW O;  3CCQ P;  3I56 P;  1VQ7 P;  3CMA P;  1K8A Q;  2OTL P;  1YJN P;  1VQ6 P;  3CD6 P;  1M1K Q;  3I55 P;  2QEX P;  3CCU P;  1YI2 P;  1KC8 Q;  3CC4 P;  2QA4 P;  1M90 Q;  3G4S P;  1VQP P;  1YJ9 P;  1QVG O;  3CXC O;  1VQ9 P;  1VQM P;  1YJW P;  1W2B O;  1YIJ P;  3OW2 O;  1Q82 Q;  1YIT P;  1K73 Q;  3CCR P;  3CCV P;  3CCJ P;  1VQ5 P;  1Q7Y Q;  1VQ4 P;  1S72 P;  1KQS O;  1VQN P;  1YHQ P;  1N8R Q;  1VQO P;  3G6E P;  1Q81 Q;  1K9M Q;  3CC2 P;  1VQL P;  1NJI Q; 
#chains in the Genus database with same CATH topology
 1JMB A;  2R32 A;  1IFJ A;  2MR8 A;  1VF5 B;  3C8V A;  1N7L A;  3CCE P;  3AE8 C;  2KOQ A;  1SQV K;  4D6T J;  1JM0 A;  2O01 H;  2W83 C;  4UB6 E;  2W6B A;  3FGA D;  3KYQ A;  3IF4 A;  2N1T D;  1SQB G;  2FYU K;  3M1M A;  2MKV A;  2G8Y A;  1LP1 B;  1M57 D;  2JJL A;  1NTK E;  1X9V A;  3WU2 H;  5APW A;  2A45 I;  2DW3 A;  2WQY C;  2EFJ A;  1KYO E;  1JCC A;  3EJD A;  1N8R Q;  2IBZ D;  3L70 G;  1PGO A;  4R4M A;  2RKL A;  3LW5 H;  1FJP A;  4W7Y A;  1JY2 N;  1OFC X;  1SLQ A;  3CLQ A;  3H1H D;  4WBA A;  5HGM A;  1LTB C;  3CXC O;  1KZU B;  3U59 A;  1K73 Q;  4YPC A;  2KS1 A;  4LC1 A;  1YBK A;  3LIE A;  1NU1 J;  4U3F D;  2QJK C;  2POH A;  3SWY A;  1KQG B;  1IC2 A;  5CJ4 A;  4RKU J;  2ZVO B;  3FXE A;  4DZO A;  2RH0 A;  2K2Q A;  1EDI A;  2M3B A;  2LKI A;  1IJD B;  2E43 A;  2FVE A;  1QRJ A;  2CPS A;  3L71 J;  5AW2 B;  2KS1 B;  3CWB G;  1NTK D;  1SQB K;  1N73 A;  2OTJ P;  2P10 A;  2KR5 A;  1UII A;  3TYY A;  2KOR A;  1ZR4 A;  3SWK A;  4COC A;  3TF5 A;  4RO0 A;  2IBZ G;  2KGC A;  1KC8 Q;  1EC5 A;  5AVX B;  3A0B E;  2KG9 A;  1E0H A;  2C0W A;  2WSC J;  3RBX A;  3Q3D A;  2KP8 A;  3RBZ A;  2FYU G;  1BE3 G;  1FC2 C;  3E7K A;  1HJB A;  5KJ7 C;  3EQ2 A;  3NMD A;  1BGY E;  1T2K D;  1EQ7 A;  2ITA A;  1BCC D;  3AE5 C;  3ZDM A;  1FAV A;  2N1T B;  1LTJ B;  3DS4 A;  2W8Z A;  1LTT C;  1BDC A;  3TNU B;  5B66 H;  1E5W A;  1SQX E;  2P2U A;  2RN0 A;  1DD3 A;  2JO1 A;  2HOD A;  3ABV C;  1Z6M A;  2K9J A;  3M0A A;  4XRO A;  1CI6 B;  3H32 B;  2L5G B;  4XFX A;  1MV8 A;  1FZE A;  3CC7 P;  5TIS E;  1T3U A;  5HGL A;  3C1L A;  2N6Z A;  4U3F J;  1R8E A;  2PEI A;  2CK3 H;  2ZXX A;  3KPE A;  4EI2 A;  3L75 D;  4QNB A;  1ZNV A;  2GYK A;  1SQV J;  2AXC A;  1NKN A;  1RY3 A;  4ASW A;  2H88 C;  3NY7 B;  1S5L X;  3H1J G;  2OYH C;  5KAI E;  1H8A A;  3RL0 B;  1PIX A;  3L74 G;  3SWF A;  1Q2N A;  1JMM A;  2E76 D;  4H44 C;  3GMA A;  4JF7 A;  4N78 D;  4U0F A;  1J2J B;  2AXT H;  2PAJ A;  5I4T G;  3G21 A;  3B5N A;  3MZW B;  4OGQ D;  1SQQ J;  2XND H;  4NEO A;  1PGQ A;  1NTZ J;  1JCD A;  3H0D A;  1RF1 B;  2L9F A;  4W7Z A;  3AE7 C;  3CI9 A;  2BCC J;  3HUS A;  3GZL A;  1PEM A;  1KFM A;  3O6Q B;  1ZOY C;  3A0H E;  4I1L A;  1L2P A;  1J1D C;  3O8Z A;  2W27 A;  2KGD A;  3SFD C;  2FXP A;  2E75 D;  4PH0 A;  1IFP A;  2N9Y B;  2E5Y A;  5C39 A;  3VMZ A;  1CZQ A;  2XV5 A;  1ZW0 A;  2IBZ I;  3V5B A;  1NU1 K;  1YTZ I;  2XZR A;  2GM4 A;  3RK3 D;  1PZQ A;  2KG6 A;  2MVV A;  3KDP B;  1KB9 E;  5GTI E;  2KOG A;  1IZN B;  4GOE A;  1VQL P;  1HH0 A;  3B5N B;  3T97 A;  3P32 A;  2BCC E;  1JEK A;  1NGM B;  1UIX A;  3I55 P;  2ZAE B;  2JWD A;  2P7J A;  1G2C A;  1PP9 J;  2AFE A;  2JB0 A;  5AW9 B;  3FWN A;  1D7M A;  4N78 E;  3G6E P;  5E79 H;  3G71 P;  4TLF A;  3NXS A;  2E76 C;  4H44 D;  3D71 A;  1T6A A;  3V6I A;  3H1I G;  1ZLL A;  3AE9 C;  5APY A;  1OWA A;  3H1L G;  2CWO A;  2P9X A;  1BGY G;  2WSF H;  2YMY A;  1YJ9 P;  1KB9 D;  4BPH A;  2M8N A;  3CCV P;  1RE3 C;  3CE7 A;  2HYN A;  1BGY J;  3Q5R A;  2YXR B;  4AQR D;  2FYN B;  2NPS A;  3RGU A;  1FU1 A;  2D2C D;  4Y99 B;  2Z45 A;  5B5E H;  1RO2 A;  1AV1 A;  1LT9 B;  2OTK E;  2KYV A;  1KQL A;  5GTH E;  3AED C;  1N73 B;  1LJ2 A;  1M1J C;  5KJ7 D;  4A7P A;  4GOF A;  1LWU C;  4IOI H;  4XE5 B;  3AEB C;  1E79 H;  1S72 P;  1PGJ A;  2PGD A;  2WIT A;  2QSI A;  1JY3 N;  1IFI A;  2YO3 A;  5K5G B;  1RE4 C;  1VF5 D;  4OGQ C;  2LML A;  1K30 A;  2ZYA A;  4U0D A;  4GIF A;  3JCU H;  4HKG A;  4BRY A;  1DH3 A;  4U0B A;  4PD4 E;  2NZ2 A;  2M5A B;  5KKZ C;  4YXD C;  2DGY A;  5AVU B;  3CC2 P;  1W2E A;  3RK2 B;  3M9Q A;  3B71 A;  2LKM A;  3M9B A;  1X0T A;  3VMX A;  2FQ1 A;  1SQQ K;  2ZT9 D;  5CZD B;  4LGD E;  5KLI B;  2KSE A;  3WUU A;  1NTZ K;  2H89 C;  5EW5 E;  1KIL C;  3DPH A;  1SS1 A;  4TT3 H;  3GHG A;  2FYU E;  1HUC A;  3W67 A;  2B89 A;  4EIJ A;  3A7O A;  2FAD A;  2JO0 A;  1EZV G;  2FAC A;  1DEB A;  3PP5 A;  3SSU A;  2K0D X;  1LTJ C;  1L0N J;  4L76 A;  1VQM P;  5HVC A;  1QEX A;  1JY3 O;  3K5B A;  1AA0 A;  5KP8 B;  1HGV A;  5KLI C;  1Q90 D;  3TDK A;  1OW6 A;  3RL0 D;  3BCC E;  2L0Q A;  1UJZ A;  4PXH B;  4H13 C;  4R4L A;  2A45 H;  4OVN F;  1BGY D;  2KIK A;  3DS5 A;  3CX5 E;  4IFM A;  1WRG A;  3G3Z A;  1VQ9 P;  3L73 D;  2GDY A;  1KQS O;  3OA7 A;  3BCC G;  2KOS A;  2R3C A;  1M90 Q;  2ZYD A;  1KD1 Q;  4K3A A;  4L75 A;  2O3J A;  1N7S D;  3D6Y A;  2PY8 A;  1SQP K;  3NTN A;  2WT7 B;  1H0T A;  2KXP B;  1L4A D;  1S9K E;  4I7Z B;  4RJT A;  3B5N C;  3V4W A;  3B8E B;  5CBO A;  5CJ0 A;  1RF0 C;  3U1A A;  2LL8 A;  2OYO A;  2VLN A;  4WVZ A;  4NPD A;  1M74 A;  5KLV J;  4C7R A;  1EIA A;  1URQ B;  2BHV A;  3H1L D;  2ZYG A;  1GK6 A;  4BWN A;  3TGU D;  5KLV E;  1HVV A;  1L4A A;  3AEC C;  1H89 A;  4U0C A;  1RF1 A;  4CPG A;  3CXH D;  4NPE A;  2M0B A;  5GTH H;  1NTK K;  1MUU A;  3V2N A;  3CWB J;  1T3J A;  3L71 G;  3ITK A;  1KYO D;  3FX0 A;  1U57 A;  4H13 D;  2JEE A;  1Q7Y Q;  2AFD A;  5APX A;  2Y0D A;  3HRN A;  1VQ8 P;  3HD7 C;  2IFM A;  2E75 C;  1NU1 G;  4PD4 I;  1GZL A;  1SQB D;  2N6Y A;  2IYP A;  4H2X C;  4IZ6 A;  2QRX A;  1KYO I;  2AXT E;  3G1G A;  1VQ4 P;  3HE4 A;  2N98 A;  3RK2 D;  3EJB A;  4PD4 D;  5CCG D;  2QJP B;  2WZ7 A;  5CCG A;  5AVY B;  2Q6Q A;  2FKW B;  4GR2 A;  1JY2 P;  2Q1K A;  2PRR A;  2XV6 A;  4IFF A;  2JYG A;  2VLO A;  1SQV D;  1DIP A;  1BE3 D;  2FAE A;  3H1L J;  2IFN A;  2FQ2 A;  3BRT B;  2LR2 A;  2VRS A;  3L74 E;  2GDX A;  3TGU J;  1A02 J;  1N7S C;  1A43 A;  2W90 A;  3HTK A;  3H1K G;  3EWK A;  3VP9 A;  4WY4 C;  4I6M C;  1G1I A;  2A45 G;  2W6A A;  1L4A B;  2GUV A;  3H47 A;  1OZH A;  1P84 E;  2GUS A;  2ZT9 C;  3CX5 I;  3VTP C;  2KLV A;  2KWL A;  2WTY A;  5AVW B;  4UB6 H;  1VQ6 P;  1RF0 A;  3CL3 D;  1K04 A;  2XZ0 D;  5KAF E;  1ZXG A;  1OX3 A;  3L75 J;  3CCJ P;  1QL1 A;  2H7H A;  2LTE A;  3TGU G;  3LW5 J;  3B5I A;  4C7N B;  4DT0 A;  3FWL A;  4BXL A;  3BAS A;  3KHU A;  1VDF A;  2JP3 A;  2CQ8 A;  4MRT C;  3EFF K;  5HGO A;  5F2N A;  1M1K Q;  1NKZ B;  5CBN A;  2KLU A;  2AVA A;  3H1J D;  2WT7 A;  1KYO H;  5KLV K;  1BXI A;  4JYC A;  5EFW B;  4H0L D;  1QX8 A;  1LTA C;  1OIP A;  1YQ3 C;  1FZB A;  1SQQ G;  3TNU A;  2P1J A;  4OH8 B;  4IFD K;  3H1H E;  1R5S A;  3CX5 D;  3MUD C;  2OTL P;  1NTM G;  1VKU A;  3CCU P;  2E74 C;  2EG5 A;  5BU8 B;  3VN0 A;  1PP9 D;  2K88 A;  5BU5 A;  1SQP E;  2M8L A;  1Q82 Q;  3HE4 B;  1YIT P;  1NTM E;  1IO4 A;  1U7J A;  1IFM A;  2H8P D;  2C0X A;  2VSQ A;  1SQV E;  2VLQ A;  1J1E B;  3G29 A;  3VMY A;  4EYY Q;  1RHZ B;  3HE5 B;  1NAF A;  3V2Q A;  1RNI A;  2AEM A;  4H0L C;  3JCU E;  3HD7 A;  1L0L K;  3RG2 A;  2E5T A;  2LPK A;  3L71 D;  2AEF A;  2YMK A;  3B4S A;  3RG6 C;  3U1C A;  1L0L G;  1SFC B;  2A06 G;  2QJP C;  3Q1M A;  3A0B H;  1GPJ A;  2QNW A;  3AE6 C;  2QA4 P;  2KOO A;  2CNR A;  3DS0 A;  2G3A A;  3E2D A;  2NRG A;  4COP A;  4R0M A;  4IL6 H;  2YKP A;  5KTB A;  1WMK A;  1AVO A;  2Z44 A;  1IFD A;  1LT9 A;  4CA3 A;  3N7N A;  2N9B A;  2Q7C A;  7CEI A;  2M5A A;  3MD0 A;  2WSF J;  3Q20 A;  4BRY B;  4IPY A;  3MGE A;  2Z46 A;  3VYI A;  1M8O B;  3PHL A;  1FR2 A;  2GZJ A;  1OW7 A;  2EHS A;  1TU3 F;  1WT6 A;  5TIS H;  1AYI A;  4XFY A;  4ZMD A;  3TGU E;  3AEE C;  4XA4 A;  5AW6 B;  2OYI B;  3AE2 C;  4PWV B;  2MF4 A;  3CX5 H;  3F89 A;  1YYC A;  3WUV A;  1DX7 A;  5APQ A;  3L72 E;  2OYI C;  3KZI E;  2JQ4 A;  2QVA A;  2O1J A;  3MHV A;  3H1K D;  1ZR2 A;  1PGP A;  3HE5 A;  1D1D A;  1KV4 A;  1VQ7 P;  3GHG C;  1SQP G;  1E6J P;  1L0H A;  2PEM A;  2Y9Y A;  1RQU A;  4DJG A;  1H88 A;  1JOC A;  5AVZ B;  1MZ8 A;  2FYZ A;  5AW0 B;  2ZJS E;  2NPS D;  1GD2 E;  5CCH C;  3MP7 B;  1S4X A;  3L70 E;  1XTC C;  4IL6 X;  2ONT A;  1M56 D;  3Q2Y A;  2CG5 B;  1GXH A;  2K94 A;  3L72 D;  3DS3 A;  1G2C B;  2BCC D;  2K37 A;  1QVG O;  1FZG A;  2L6E A;  2OYH A;  2Y0C A;  2YKO A;  3HUS B;  2J5U A;  1AF8 A;  3OAK A;  2KK7 A;  3NTE A;  1LTS C;  1X22 A;  5AW5 B;  5JPA A;  2FXM A;  1NTZ E;  1PV3 A;  1MFT A;  2B88 A;  2HOD B;  2XZ1 C;  4U3F G;  1A8O A;  1HY8 A;  1X79 B;  1LGH B;  1GXG A;  3G9R A;  3F5H A;  1LT1 A;  1VQK P;  3E1R A;  1URQ A;  1PEQ A;  2NPS C;  3AEF C;  3DS2 A;  1EXI A;  1T8Z A;  1GDT A;  1NVO A;  2JU2 A;  3OJA B;  5BS1 A;  1JB0 J;  1GL2 D;  1VQN P;  2Q3I A;  3L73 E;  1A02 F;  3B4Q A;  4L73 A;  4UB8 E;  4BPG A;  1Y47 A;  2YO2 A;  2C9N Y;  3GW6 A;  5AW8 B;  4JBZ A;  2M5R A;  3EFG A;  1XTG B;  2FYU J;  2WPV B;  3H1I E;  4EDF A;  3HD7 D;  1EDL A;  3IFM A;  3JSV C;  1AFO A;  2BEZ F;  3T97 B;  1F80 D;  2IPP A;  1FZF A;  3B5N D;  2EHT A;  5KKZ B;  4BPF A;  2A06 D;  2WSC H;  3RL0 g;  1N7S B;  4GKG A;  3D70 A;  3BCC J;  2FFD B;  2WSS H;  2FHS C;  1G1J A;  1YJW P;  2OYH B;  1IK9 A;  3GG2 A;  1EZV E;  5F2O A;  3PH0 A;  4LLH A;  1LWU B;  1RE3 A;  3CME P;  5AVS B;  2IYO A;  5EJD A;  1NYH A;  1SQB E;  1PPJ D;  2KOD A;  5KJ7 A;  1GK4 A;  2WPQ A;  2FQ0 A;  1EDK A;  1VF5 C;  2YKQ A;  3CC4 P;  1MFZ A;  5HV8 A;  4N6J A;  4PJ0 E;  2B9B A;  2V7Q J;  3EJE A;  1FJK A;  1FDO A;  2BEQ D;  5B66 E;  2FVA A;  3WU2 E;  2HPC A;  2Z4E A;  1QVF O;  2LXC B;  1H0T B;  2PEO A;  1PFI A;  1OMI A;  3I56 P;  1HWT C;  1RH5 B;  5CMZ A;  2IX7 C;  2Q5U A;  4RES B;  3PLN A;  4KT0 J;  3H1H J;  1NTZ G;  4QKO A;  1ZMB A;  3CCS P;  1CSB A;  1RQV A;  2JKV A;  2V7Q H;  2PP6 A;  3PTZ A;  1PP9 E;  1OR5 A;  1YJN P;  1GW4 A;  2H43 A;  4C7N A;  2GZE A;  3L75 G;  3L37 A;  1EXJ A;  2I1J A;  3OW2 O;  2KGA A;  2J59 M;  4AUW A;  1SFC C;  1AQ5 A;  4NPF X;  3CCM P;  3L72 G;  5CHX A;  2D2C C;  2E74 B;  2XXM A;  1SP4 A;  3JC2 2;  1SQV G;  1IFN A;  1BCC G;  4JQ0 D;  3LMO A;  1S1C X;  1EMV A;  1NU1 D;  4B86 A;  1FOS E;  1DV5 A;  1JTH B;  3M91 A;  1CW5 A;  2K92 A;  1P84 H;  1LTJ A;  5E79 E;  2LF4 A;  2QM7 A;  4ZNC A;  2FFD A;  2KB7 P;  2WPS A;  4O9B A;  2CGQ A;  2K9Y A;  1JO5 A;  3D6Z A;  2MR7 A;  3A5T A;  1KIL A;  2LIW A;  2D2C B;  1KQF B;  1M7L A;  3VP8 A;  2WWW A;  1L4A C;  2JAZ A;  1LNQ A;  1M6N A;  1FE6 A;  1YQ4 C;  1P84 D;  4WY4 A;  3H1I J;  1PPJ G;  4ZKU A;  2KG8 A;  3H1L E;  2L22 A;  4JYB A;  5AVV B;  3P8M C;  1ZV8 A;  4F37 A;  3L35 A;  3KXD A;  2K5X A;  1URQ C;  2L4B A;  3DS1 A;  2MJZ A;  1BCC J;  4HB1 A;  3L36 A;  4I2L C;  1U7M A;  2Q3E A;  3H1J E;  3M0D C;  2IDB A;  2KZJ A;  1FS0 E;  3U43 A;  4L74 A;  2QEX P;  1GU4 A;  3KZI H;  4ASV A;  2E74 D;  2DNW A;  4XRQ A;  3IAO A;  3S4R A;  5DCK A;  1S5L H;  4YTP C;  3AE4 C;  2E42 A;  2PEN A;  2FY8 A;  1FDI A;  2KGE A;  2K3R A;  3TK1 A;  3VMA A;  3GJN A;  2O01 J;  3P05 A;  1GL2 B;  1KIL E;  1KN7 A;  5F2K A;  1N7S A;  3GKL C;  1MKM A;  5L8R J;  1KMI Z;  2HFE D;  2LIU A;  2PEQ A;  2ZVN B;  1OXZ A;  2PFX A;  1Y9B A;  1KOR A;  1L0N D;  4N3Y B;  2XNX A;  3L70 J;  5H2F H;  1SQQ E;  4OGQ B;  2XU6 A;  1FZC A;  4K35 A;  2GZG A;  1AQT A;  5APT A;  1BE3 E;  4HYT B;  1JY3 P;  1S2E A;  3L4F A;  1SQX D;  2K1A A;  3M0D A;  2QJY B;  1JNM A;  1LTG C;  5DJT B;  1CI6 A;  5HGN A;  4WYM A;  4WB4 A;  3USS A;  3TSI A;  3QH9 A;  4AYC A;  1IMQ A;  1GTW A;  3H1I D;  3AEA C;  3V4Q A;  3VOP A;  2QJY C;  2R5B A;  3RK2 C;  2VLP A;  2QJK B;  4D6T G;  2Y0E A;  1LWU A;  2JGP A;  2L91 A;  1L0N K;  1USD A;  2YIU C;  4HJG H;  1KB9 I;  2OYI A;  1LT9 C;  1L0N G;  2N5I A;  2WPT A;  5AVT B;  3M06 A;  1NQ4 A;  1IUQ A;  2Y9Z A;  1NWQ A;  1SFC A;  1PL5 A;  5DJU B;  2UWJ E;  1K9M Q;  1FZC B;  1X8Y A;  4H0L B;  3CWB E;  3CXH E;  5APV A;  3UIA A;  3HD7 B;  2KW2 A;  2X2B A;  2FBW C;  1L0I A;  3HUS C;  4Y28 J;  5AW1 B;  5BS2 A;  3M9H A;  1NO4 A;  2GA1 A;  2ZXE B;  1KIL D;  1YTZ T;  1Q86 Q;  1ZP0 C;  3L72 J;  2KOP A;  3AE3 C;  3CMA P;  2MD9 A;  3GF3 A;  4XFJ A;  3H25 A;  2R3S A;  3R2P A;  5GTI H;  3QWO C;  4DG9 A;  2I1K A;  3L70 D;  3L71 E;  2Z5I A;  2IBZ E;  4GOD A;  3S9O A;  3CPW O;  4YXW H;  2ERH A;  4PJ0 H;  4JPZ B;  3NFQ A;  4M0I A;  3H4E A;  5APS A;  1DD4 A;  2QIW A;  1YIJ P;  2NO8 A;  1QGK B;  3WMM 0;  4Z1M H;  2JWA A;  1YHQ P;  3A0H H;  3RK3 E;  5KLV G;  4U7J A;  2K93 A;  2ZFC A;  1Z56 A;  4KHX A;  1NTK G;  3H32 A;  3RK3 B;  2Z5H A;  1HBW A;  4KJM A;  1DEE G;  1P84 I;  1BSH A;  4IL6 E;  1AVY A;  2M8R A;  2YIU B;  1EDJ A;  1NOH A;  1ZRT E;  4H2Y C;  1Q81 Q;  2R44 A;  1GL2 C;  1SQP J;  3II6 A;  2KNC B;  1FBM A;  5APU A;  1KIL B;  4H44 B;  3KQG A;  4GR6 A;  3N4X A;  5H2F E;  3L74 D;  4M3L A;  1LP1 A;  1L0N E;  3G26 A;  3MIW A;  1OVR A;  2QM8 A;  1S9K D;  2B87 B;  1IK7 A;  1HQB A;  1FOS F;  1N2D C;  1HGZ A;  2KZI A;  4EOT A;  1M1J B;  1N73 C;  5CCG C;  3H6P A;  3IR9 A;  1EZV I;  3MGN A;  1ZN5 A;  2V4H A;  2WSE J;  1CEI A;  1PPJ E;  1RO0 A;  3G4S P;  3RK3 C;  3PJS K;  2KSJ A;  3SFE C;  1HJ0 A;  2XT1 A;  3WUT A;  1NTK J;  1JUN A;  2W6J H;  2N50 A;  2MVU A;  2FXO A;  1NU1 E;  3L73 J;  1S3J A;  5AW3 B;  3CCQ P;  5KP7 B;  1ZME C;  2E75 B;  1JTH A;  1VPC A;  4QMA A;  1VQP P;  3FXD A;  2JU1 A;  2BCC G;  2PNG A;  1AJY A;  3LID A;  3Q5S A;  4XFZ A;  2B87 A;  1MZ9 A;  2FFD C;  4U0E A;  4H2W C;  2KUB A;  2P67 A;  3VRL C;  1GL2 A;  1SQX G;  1X3O A;  5KAI H;  2HPC B;  1GW3 A;  3I5C A;  1BDD A;  3GZM A;  1IMP A;  1PEO A;  2PEJ A;  1W2B O;  2JYL A;  4PD4 H;  5KLV D;  1VQO P;  3L74 J;  1LTI C;  3DTJ A;  1QLE D;  3CCL P;  2XDJ A;  3C9I A;  1SQX K;  4D6T D;  1NTM K;  1OVU A;  2M8P A;  2I8D A;  3GHG B;  4OWF A;  1BCC E;  3P7K A;  3LRY A;  2BAS A;  5CCH D;  3BAT A;  1NAY A;  5AVR B;  4UHP B;  2OQQ A;  1VHN A;  2M3E A;  2EIA A;  3CXH I;  3V2P A;  2WMM A;  3P8C E;  3V2R A;  4W80 A;  1HTL C;  4PV1 B;  2K0Y A;  4D6T E;  3Q5P A;  4U3F E;  2A06 E;  1FDM A;  1L0L D;  1N86 A;  3MUD A;  3A3Y B;  4WY4 B;  1EZV D;  3AE1 C;  2WVR A;  1SQQ D;  3G28 A;  1KB9 H;  3HYB A;  1NTZ D;  1NTM D;  1BE3 J;  2WSE H;  1YI2 P;  2P58 A;  2O1K A;  3HZQ A;  5KP6 B;  1PP9 G;  3GF7 A;  4C46 A;  2Q9I A;  2FYN C;  1NHL A;  2PEK A;  2SPZ A;  1KTM A;  3BVH A;  3G1I A;  4ZKP A;  3P8C D;  2HG5 D;  2LOL A;  4I7Z C;  3PRJ A;  4DOJ A;  2NPS B;  1ACP A;  1J1E C;  2J58 A;  3H1K J;  2C9L Y;  1J1D B;  5KAF H;  1VQ5 P;  2OAR A;  2LXB A;  3RL0 C;  1KLP A;  3WBH A;  1NH4 A;  2QE7 H;  1RF1 C;  2YXQ B;  2JDI H;  2CPB A;  3MTU E;  4PH1 A;  1K8A Q;  1R5L A;  3H1H G;  5AW4 B;  2YNY A;  4UB8 H;  2N1T C;  5B5E E;  2XKM A;  2BUO A;  4WY4 D;  1S5L E;  1FZC C;  2R5D A;  4H13 B;  3L75 E;  1SQP D;  2KNC A;  3G0V A;  1KFN A;  4PV1 D;  2BQ1 E;  5AW7 B;  1SFC D;  2HR3 A;  1VL2 A;  2K9J B;  1UNK A;  1L0L J;  3CXH H;  1AUM A;  1BSN A;  2GDW A;  1M6E X;  2QG4 A;  2RMZ A;  4HH2 A;  1T8K A;  3CWB D;  2IZ0 A;  5AVQ B;  1RE4 A;  1BAJ A;  2K0X A;  1OW8 A;  2GZI A;  2MY5 A;  2N1T A;  2AEJ A;  5BVZ A;  1SVF A;  1L0L E;  3HTK B;  1EOQ A;  1GMJ A;  2AF8 A;  3H1J J;  1URQ D;  3S1K A;  2FVF A;  4GT1 A;  1Y8A A;  1SQB J;  3CCR P;  2FYU D;  3E1I A;  4MN4 C;  2OGU A;  1SQX J;  1NTM J;  3AEG C;  1USE A;  1W5C E;  3R4Y A;  4U0A A;  1JJ2 O;  4PV1 C;  2E76 B;  3CD6 P;  1OVV A;  3W68 A;  5M1B A;  2IZ1 A;  3IN6 A;  2GZF A;  2KI7 B;  4DCK A;  2ZT9 B;  3H1K E;  2JR8 A;  1QL2 A;  1K05 A;  1NJI Q;  2O01 N;  1FZA A;  3L73 G;  2JBG A;  2WPR A;  3GLM A;  1M1J A;  2N5H A;  5CCH A;  2ROQ A;  1DNY A;  3BRV B;  3A2A A;  5TJH A;  1GU5 A;  1JY2 O;  4WWI A;  4HKZ H;  1ZRT D;  4GDO A;  4Y99 C;  3O6Q A;  2E1M A;  1PEU A;  3BCC D;  1T2K C;  1HF9 A;  2HLO A; 
#chains in the Genus database with same CATH homology
 2OTJ P;  2PEQ A;  1VQ8 P;  3CME P;  2Z44 A;  2Z45 A;  3NTE A;  1RO2 A;  1Q86 Q;  3CCE P;  1AUM A;  2EIA A;  2KOD A;  4COC A;  3CMA P;  5HGO A;  5JPA A;  3H0D A;  3Q20 A;  1M6E X;  5F2N A;  1KC8 Q;  1M1K Q;  3DS5 A;  4IPY A;  3MGE A;  3CC4 P;  2Z46 A;  1RO0 A;  3G4S P;  1BAJ A;  1VQ9 P;  1PEM A;  3G1G A;  2XT1 A;  1VQ4 P;  1M6N A;  1S72 P;  1KQS O;  1A8O A;  4XFY A;  1EOQ A;  4PH0 A;  3M1M A;  1M90 Q;  1QVF O;  1VQK P;  1KD1 Q;  2PEO A;  3G28 A;  1PEQ A;  3CPW O;  3CCQ P;  3HYB A;  3I56 P;  3DS4 A;  2PY8 A;  1K30 A;  2OTL P;  3DS2 A;  5HGN A;  4WYM A;  3CCU P;  1YI2 P;  4U0D A;  2EG5 A;  4M0I A;  3H4E A;  3HZQ A;  1VQP P;  5BS1 A;  4GR2 A;  2M8L A;  4U0B A;  1YIJ P;  1Q82 Q;  1YIT P;  2BQ1 E;  2XV6 A;  3CCR P;  2JYG A;  3DS1 A;  2EFJ A;  1VQN P;  2DGY A;  4XFZ A;  1YHQ P;  1N8R Q;  2PEK A;  1ZMB A;  3CC2 P;  4XRO A;  1VQL P;  3G1I A;  3CCS P;  4XFX A;  4U0A A;  1D1D A;  4U0E A;  3CC7 P;  1JJ2 O;  3G29 A;  1M74 A;  5HGL A;  1VQ7 P;  1EIA A;  1RNI A;  1E6J P;  1YJN P;  3VRL C;  3CD6 P;  3I55 P;  2QEX P;  2PEM A;  2BHV A;  2PEI A;  1A43 A;  5HGM A;  3CXC O;  1PEO A;  2PEJ A;  1W2B O;  3OW2 O;  2JYL A;  1K73 Q;  4QNB A;  1IUQ A;  1VQ5 P;  2OAR A;  4XRQ A;  1VQO P;  3G6E P;  3DPH A;  1Q81 Q;  3WBH A;  3RG6 C;  1K9M Q;  3DTJ A;  3H47 A;  5DCK A;  1NJI Q;  3G71 P;  3CCM P;  2ONT A;  4U0C A;  2PEN A;  3CCL P;  4GR6 A;  3DS3 A;  2JO0 A;  4PH1 A;  2XXM A;  1K8A Q;  2CWO A;  1VQ6 P;  2P9X A;  2M8P A;  2QA4 P;  2BUO A;  1YJ9 P;  1QVG O;  3P05 A;  3DS0 A;  3LRY A;  3E2D A;  1VQM P;  1YJW P;  4U0F A;  1QRJ A;  2M8N A;  5F2K A;  3CCJ P;  3CCV P;  2L6E A;  2E1M A;  3G26 A;  5F2O A;  4COP A;  1Q7Y Q;  2LF4 A;  1PEU A;  5BS2 A;  3G0V A;  5I4T G;  3G21 A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...