3G6EP

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g6eP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g6eP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g6eP02
1VQPP 3G4SP 1YJWP 1VQ7P 3I55P 3CCRP 1YIJP 2QEXP 1VQNP 2OTJP 3CMAP 3CCUP 1W2BO 3CCEP 1VQ9P 1Q7YQ 2OTLP 3CD6P 1VQOP 1Q86Q 1VQ5P 3OW2O 1KC8Q 1VQ6P 3CCQP 3CCVP 2QA4P 3CCMP 3CC4P 3CCLP 1N8RQ 1M1KQ 1KD1Q 1Q82Q 1VQKP 1QVFO 3CMEP 3G71P 1YHQP 3CXCO 3I56P 1S72P 1YITP 1VQMP 1K9MQ 1VQLP 1Q81Q 1K73Q 3CC7P 1QVGO 1JJ2O 1VQ4P 1KQSO 1YI2P 1NJIQ 1YJ9P 3CCJP 1K8AQ 3G6EP 3CCSP 3CPWO 1VQ8P 1M90Q 1YJNP 3CC2P
chains in the Genus database with same CATH superfamily
3CE7A 3WUTA 3L71E 1PEQA 2P67A 2JO1A 3V2QA 4PXHB 1EDKA 2Y0DA 3M06A 1GZLA 2XZRA 3H1JG 1FS0E 1AV1A 4WY4B 2FYNB 2K1AA 1BAJA 1SQQJ 2E76D 2KG6A 3A0BE 1LTBC 5APVA 2YMKA 4U3FJ 2BHVA 2A06E 1KORA 3AE2C 2Y0CA 2OYHB 2QJYC 2XT1A 1FZCA 4TT3H 2E42A 3HTKB 2MVVA 3L4FA 1NHLA 3KDPB 5APTA 3CCUP 1EXIA 3HUSB 3G1IA 2YKOA 5KTBA 2XZ1C 1FJPA 1M1KQ 1EMVA 1KYOD 1K73Q 1AF8A 1IUQA 3L72D 1S5LE 2WSFH 5KKZB 1PP9E 1VQPP 3SFDC 4XE5B 1YQ3C 2KOOA 4C7RA 3H1HG 1CI6A 1SQBD 1M1JC 2M3EA 3B5NC 4JPZB 2GZFA 4XFZA 3SWFA 1Z6MA 1L0NJ 1HF9A 1SQBK 1BGYE 2NZ2A 2N50A 2JBGA 2JU1A 2W6BA 2M8NA 4XFXA 3BCCD 2GZGA 1RF1B 1SFCC 3Q20A 1K9MQ 2YIUC 3FWNA 4LC1A 4HKGA 1LP1B 3RBZA 4JF7A 1YI2P 1CZQA 1PV3A 1SS1A 1VQ8P 3V4QA 3IF4A 5CMZA 5H2FH 5CBNA 1H88A 2IZ0A 1MFTA 4OVNF 1JTHB 3IFMA 2QE7H 3IAOA 3H1KJ 3CD6P 3DS4A 1FZFA 3CC4P 2FYUE 4WBAA 3RBXA 1NTZJ 3GLMA 1HJ0A 1LTJC 3HD7C 1JY3O 1KB9H 1OMIA 2FQ0A 1UJZA 1GXGA 3L74D 2ITAA 4I2LC 1EZVI 2ZT9B 4PD4H 1QRJA 2L5GB 1VQNP 2OTJP 5CHXA 1ZV8A 2JDIH 3EQ2A 2MJZA 1L4AA 2PENA 1VHNA 3B8EB 2O01N 2YKQA 5BVZA 3ZDMA 2L22A 1LWUA 2OYIA 1SQPD 2LPKA 1IFDA 1VF5C 3PHLA 4U3FD 4GOEA 2K92A 3A3YB 4U0DA 1SQPK 1KMIZ 3BASA 2KR5A 3P32A 4RO0A 1RNIA 3CMAP 3M1MA 1WRGA 1M57D 3MD0A 1T3JA 3B5ND 3S1KA 2O01H 2FBWC 3L73G 3VMZA 1NU1J 3RL0g 3NTNA 4AYCA 1SQVJ 1NO4A 1GU5A 4H13B 2LL8A 1ZMEC 3KQGA 2IFNA 2PEJA 4DCKA 2KGDA 1SFCD 1J1DC 2N5HA 1OVUA 4IOIH 1USEA 2GUSA 1IC2A 4JQ0D 3G9RA 3H6PA 5KAIE 2E5YA 2RN0A 4XRQA 1IFJA 1ZRTD 3Q3DA 4TLFA 4GOFA 5AVZB 2GZJA 2LXBA 2K9JA 2YMYA 1T8ZA 1M6NA 3CWBE 5APQA 5TJHA 5KAIH 3HD7D 1HGVA 3L70D 4C7NB 1SQQG 5CJ4A 1GMJA 3JSVC 1RE4C 3L75D 3A2AA 5CCGC 2Y0EA 4U3FG 5KLVD 3TGUE 1SQXJ 1EZVG 1RQUA 2RH0A 1GU4A 2OQQA 2DW3A 2WPQA 1VF5D 5KLVK 3V2NA 2PEQA 1X9VA 2Q9IA 1Q90D 2LIWA 2L0QA 3L36A 4ZKPA 2BCCD 1HH0A 4BWNA 3AE4C 5AW6B 2A45I 1PEUA 3PJSK 5CZDB 2IBZI 2BASA 1FZGA 2M8RA 1OR5A 2AXTH 1X0TA 1KB9D 2J59M 1KC8Q 2KORA 4PD4D 1AQ5A 1KN7A 3HE4B 1Q81Q 3M91A 4OGQC 2WQYC 1AQTA 5BS2A 2JGPA 2EIAA 1BE3E 1L0NG 2XZ0D 1OFCX 2HPCB 3F89A 4XFJA 2B87A 1PGQA 3Q5RA 4W7ZA 3CXHE 2KGCA 3GHGB 3KZIH 3N7NA 3QWOC 2JJLA 3AE8C 2E74C 1ZNVA 3RL0C 3LW5H 5BS1A 1CW5A 3CXCO 2KG8A 2KS1B 2Q3EA 2W90A 1EDIA 2FAEA 1NU1K 2EHSA 1FR2A 2Z44A 3TF5A 5AW8B 1N73C 5L8RJ 1SQVK 1AVOA 2QEXP 3O6QA 1FOSE 3QH9A 2AEJA 5B5EH 2P2UA 4WY4C 2IYOA 3I56P 3VTPC 3AE6C 2C9LY 3H1KG 5CCGD 1LNQA 1H89A 5M1BA 2EG5A 1DD4A 1R5LA 3MUDC 1OVVA 1NTZG 3AEFC 4Y99C 1M7LA 3CCRP 1E0HA 4IPYA 2ERHA 2QA4P 2HLOA 1JY3P 1EIAA 1S4XA 4K35A 2CGQA 2N6ZA 4ZNCA 1BCCD 1NTKD 2JWDA 4D6TD 2L4BA 3FGAD 1NTKK 3DPHA 1P84I 1AFOA 2IX7C 3H1ID 1KYOE 3V4WA 1PEMA 3L72E 3G71P 1N7LA 5BU8B 2PAJA 2LKIA 5GTIH 1VPCA 2Z5HA 5KKZC 3GMAA 3SFEC 3CCJP 4OGQD 1MUUA 2IBZG 2FVFA 1FZCB 1SQBE 4NPFX 2AVAA 1RHZB 2ZVNB 1NU1G 5AW9B 2D2CB 1PGPA 1SQVG 4N3YB 3CI9A 1G1IA 3B5NA 1Q82Q 2E74D 4OWFA 3RL0D 1N7SA 4COPA 1NTMJ 2B9BA 1GW3A 3BCCE 1JO5A 1HQBA 2KZIA 2V4HA 2J58A 2N6YA 3H1JD 5AW5B 1JB0J 2PEIA 3RK3C 2GUVA 1SFCA 5AW2B 1RE3C 4YTPC 1E6JP 3OAKA 3WUUA 3ABVC 3G26A 1CI6B 5B66E 3LMOA 3PP5A 3CX5I 2Y9ZA 4WY4D 1LGHB 4AQRD 1AJYA 2K2QA 5KP6B 2IZ1A 2MVUA 3B5IA 1NJIQ 4EI2A 4NPEA 4H0LB 2GZEA 4M3LA 5AVUB 1LT9C 2HFED 3HZQA 3UIAA 1GTWA 1BDCA 3RGUA 4H2XC 4UB6H 2N98A 4N6JA 3CCQP 3CCMP 3GF7A 2XNXA 3OA7A 3L74E 2KOQA 3HD7A 1KQSO 2CPSA 1JMMA 4H2WC 3G21A 3BRTB 1KZUB 3PH0A 1DV5A 4JBZA 3H1LJ 3P8CD 1VL2A 5E79H 1SQXG 4BRYA 1W5CE 3KHUA 1GW4A 4R0MA 1HJBA 2FHSC 3H32A 2IYPA 4M0IA 1SQPE 3H1HD 2B89A 4I1LA 1MFZA 5DJTB 1YJNP 3PTZA 2EFJA 2FXOA 4L75A 2K0YA 3CCLP 1L4AB 3C1LA 2M5AA 5HGOA 1YITP 1QVGO 2O3JA 5AVTB 2R32A 1LWUB 3JC22 2WZ7A 2KB7P 2OYIB 1KFNA 4IZ6A 4IL6H 3JCUH 2Q6QA 3Q5PA 2K9YA 3AEAC 3RK3D 3HE5A 3G3ZA 3SSUA 1PFIA 1NH4A 5DCKA 1L0LJ 3VP8A 1ZRTE 5CCHC 3AEGC 2POHA 2Q3IA 2KNCA 2C9NY 1KYOI 3RK2B 2BUOA 2O1KA 1HY8A 3V2PA 1Z56A 3A7OA 2KI7B 2VRSA 2R5DA 3L71J 2I8DA 3L70E 1PPJG 3W67A 4WWIA 1GL2C 3H4EA 2XV6A 3L75E 2FFDC 4XFYA 2JYLA 5KLVE 5CCGA 2K9JB 4ASVA 2M0BA 2WWWA 3U43A 4U0EA 1NKZB 2KOPA 2LKMA 3L35A 2XNDH 2MY5A 3L73D 5H2FE 2BCCE 1VQOP 4BPGA 3R2PA 3V2RA 4CA3A 1PZQA 3VMYA 4WB4A 1SVFA 2GYKA 1QGKB 5I4TG 1BXIA 1HGZA 1ZOYC 1KB9E 3AE7C 1WT6A 5EW5E 2WSEJ 3PLNA 3MIWA 2ROQA 1W2BO 1FBMA 4PD4E 2K5XA 2SPZA 1NQ4A 1HBWA 4H44C 1PP9J 2PFXA 1LTIC 4K3AA 4YXDC 4L74A 2QJPB 2H89C 2LF4A 1GDTA 2P58A 1NTMG 5CCHD 4EDFA 4ZMDA 1U7JA 2AXCA 2ZXEB 1BGYJ 2PRRA 3CLQA 2E5TA 1SQQD 1URQA 4JYCA 2IDBA 2N1TC 2MR7A 3CCSP 1N73A 2WMMA 3CPWO 4ASWA 3GW6A 1SQQK 3AEDC 2XKMA 1IFMA 3LIDA 2WSSH 1GL2D 5AW1B 1OW7A 1G1JA 1Q7YQ 1FZEA 1EZVD 2P7JA 1IFPA 2B87B 4QNBA 4XROA 3VYIA 3LRYA 1JM0A 2WVRA 2WSCJ 4WVZA 1G2CA 3MUDA 2LIUA 5APUA 2WT7A 3AE3C 5AW0B 3MZWB 1ZMBA 3G4SP 2FYUJ 2JWAA 4U7JA 1OVRA 2Q1KA 3RG2A 3H1LG 3C8VA 3O6QB 2YO2A 1BCCE 3MGEA 1NTKE 2GDXA 3DS1A 3V6IA 2YNYA 4D6TE 2QJKC 2W83C 2W8ZA 3BATA 4NPDA 3M9HA 1S1CX 2E43A 2WPSA 4O9BA 2K93A 3H1IE 4GKGA 2W6AA 1L0ND 2AF8A 4L76A 2O01J 3D71A 5AVRB 1KILC 1L0NK 4HKZH 1ZR2A 4IFFA 1JEKA 3PRJA 1FZCC 2PP6A 3M0DC 4H44D 1YYCA 2HODA 2QJYB 1OX3A 4HH2A 4NEOA 2G3AA 3DS0A 1VKUA 3A5TA 1JUNA 1L2PA 5AVYB 3H1JE 2N1TD 3H1KD 3AE5C 2GZIA 4RKUJ 1RY3A 3NFQA 4DZOA 2WITA 1P84H 4GODA 1L0LG 1NTZD 1MKMA 2L9FA 1JY2N 2AXTE 2CG5B 1DIPA 2PEKA 4RJTA 1RE3A 4RESB 3TDKA 3NY7B 3CCVP 1S5LX 2CK3H 1NTZK 2W6JH 3B5NB 2Q7CA 4PV1B 5JPAA 1KB9I 1N7SB 3L71G 2PY8A 5APXA 1YJWP 1LT9A 1RF0C 4GIFA 3CWBJ 3HRNA 2Z45A 3D6ZA 5KLIC 1Q86Q 1PIXA 1SFCB 3KZIE 1H0TA 2NPSC 2QVAA 2ZYDA 3P8CE 1X22A 1HVVA 1ZN5A 4IFMA 1NWQA 2H7HA 1WMKA 1FOSF 3GF3A 1FZAA 2FXPA 5APWA 2IBZD 3H1HE 1EDJA 2A06G 1NU1D 3TGUJ 2XV5A 2VLQA 3CX5H 2M8PA 1IFNA 1QVFO 1KQGB 5B5EE 1SQVD 1YTZT 1EQ7A 4PJ0H 1UIXA 2N9YB 2XXMA 1KILD 3HD7B 2K94A 2FYUK 4Z1MH 2Z5IA 5HV8A 1OZHA 3FXDA 1MZ9A 2BEQD 2CNRA 3MP7B 4BRYB 1LWUC 1A02F 2FYNC 2OYIC 3H32B 1GD2E 4U0BA 3U1CA 2OTKE 1JMBA 1LJ2A 1PP9G 3RK3E 3WMM0 1VF5B 2OTLP 3DS5A 3DS2A 2OYHC 2OGUA 3P8MC 3OJAB 1KD1Q 1BE3J 1LTGC 2HYNA 1BGYG 1S2EA 4R4LA 2FYZA 2M5AB 3E1IA 4ZKUA 2J5UA 2KLVA 2JQ4A 5GTIE 1UNKA 5CCHA 2KWLA 3AECC 3HUSC 1N2DC 4I7ZB 3IN6A 2K37A 2KXPB 3EFFK 1HTLC 2M3BA 1A8OA 2MF4A 1SQXD 4BPHA 3E1RA 1J1DB 2WTYA 3GKLC 3M9QA 2A45G 3HE5B 2C0WA 2IFMA 2NPSD 4GR2A 1SQXK 2KUBA 1NGMB 1GL2A 3CC2P 2VLNA 4KHXA 5AVQB 2LMLA 1TU3F 2GDYA 2FFDA 1GK6A 3TSIA 2KNCB 3M0AA 2JKVA 3V5BA 2FYUG 1M1JA 1VQLP 1P84D 5KAFH 1FDOA 2AFEA 3WU2E 3L73E 1T8KA 1RF1C 1SP4A 2QSIA 3NXSA 1FDMA 3AE1C 1A02J 1J1EB 2FKWB 3S9OA 2KGEA 4UB6E 3WU2H 3II6A 5AVSB 1T2KC 3K5BA 4U0FA 2IPPA 2Q5UA 3T97A 3L72J 3USSA 2HG5D 5E79E 3P7KA 1FC2C 4N78D 1VQKP 1S9KD 3G28A 2K88A 1SQBJ 1J2JB 1IK9A 2ZT9C 4LGDE 1LTJA 1PGOA 3NTEA 3CX5D 1QX8A 3Q5SA 4QMAA 3CXHI 4HB1A 1XTGB 1PPJD 1OW6A 1SQQE 1Y8AA 5TISH 3BCCJ 1SLQA 3VP9A 2V7QJ 3U59A 2ZAEB 2XDJA 3A0HH 4U3FE 1R5SA 2N1TA 4CPGA 2K0DX 1X79B 4OGQB 2YO3A 5KJ7C 3EFGA 1EZVE 2FADA 3U1AA 4H2YC 4IL6E 3JCUE 3VOPA 3VMXA 1U57A 3CWBG 5CJ0A 3GG2A 2GM4A 2E74B 3R4YA 3RL0B 1URQB 4H13C 3B71A 1M90Q 2RMZA 3FX0A 2E1MA 2R3SA 1N73B 1VQ7P 3L74J 2LTEA 1N86A 2R5BA 2KSJA 1VQMP 2FQ1A 4DG9A 3TGUG 5GTHE 2O1JA 1T2KD 1EDLA 1G2CB 1L0NE 3KPEA 1FAVA 5HGLA 1SQPJ 1IK7A 5CBOA 1JOCA 2WT7B 5F2NA 2FACA 4JYBA 4Y99B 1NTMD 4W7YA 1W2EA 2ONTA 1KILA 5GTHH 1NTMK 3M0DA 3A0BH 2ZT9D 1M6EX 3TYYA 5AW3B 4C46A 1M74A 1E5WA 2PNGA 1D7MA 1AYIA 1M8OB 3FXEA 1DEBA 2JO0A 1RE4A 2YXQB 1KV4A 1IO4A 2AEMA 3EJDA 2KW2A 2KODA 1IMPA 1NAYA 3H1KE 4UB8E 1RO2A 1BE3G 3TNUA 1K8AQ 1Y9BA 4I6MC 1NTZE 4EOTA 3IR9A 2QRXA 3G29A 5AVWB 1DH3A 2HODB 1NKNA 2E75B 5KJ7D 3EJEA 4L73A 2KOGA 2WSEH 4PV1C 2ZYGA 4A7PA 4UB8H 2YXRB 1N7SC 1X3OA 3G0VA 1S5LH 2WSFJ 3H1LD 5AVXB 3G6EP 3VRLC 4H13D 2H43A 1CSBA 1EOQA 1BSNA 2E76B 4R4MA 1QEXA 1M56D 1RF0A 5AW7B 1FZBA 3RK3B 3L70J 1RQVA 1VDFA 2QNWA 4AUWA 4W80A 2NPSA 3L75J 5C39A 3GHGC 2IBZE 5KLVJ 2GA1A 1NU1E 1NVOA 1LT9B 1SQVE 2JR8A 2JAZA 2WPRA 3GZMA 1KILE 2VLOA 7CEIA 2FQ2A 1JY2O 2NO8A 2A45H 1UIIA 4BXLA 1AUMA 2WSCH 1YJ9P 1H0TB 5F2OA 2BCCJ 2P10A 1KFMA 3Q1MA 4PH1A 1Q2NA 2ZFCA 4KJMA 1IFIA 3L72G 1L0LD 2CQ8A 4WY4A 2P1JA 4XA4A 2X2BA 2FVAA 2QM7A 1L0LK 2OARA 1IMQA 1SQBG 1LTTC 1HWTC 3KXDA 2MR8A 1YTZI 1DD3A 2OYHA 3L71D 1ACPA 4DOJA 2LXCB 4PV1D 2RKLA 3W68A 3HTKA 4IL6X 1N7SD 4I7ZC 3BCCG 4HJGH 3HUSA 3D6YA 2KIKA 1A43A 1MV8A 2VLPA 1SQXE 1OWAA 1ZP0C 3OW2O 2L6EA 3CMEP 2ZJSE 2KZJA 1KLPA 3B4QA 1ZXGA 1VQ4P 5APYA 1ZLLA 2A06D 1CEIA 2N9BA 2D2CC 2DGYA 4EYYQ 2PGDA 1PGJA 1FDIA 1FJKA 2KG9A 4LLHA 1P84E 3M9BA 2WPTA 2P9XA 3NMDA 2N5IA 1Y47A 3L74G 1S72P 2Z4EA 4Y28J 2I1KA 1GXHA 1L0HA 3P05A 2CWOA 1YBKA 1RF1A 5F2KA 1DNYA 4MN4C 1ZR4A 1J1EC 1BCCJ 1NTKJ 1GL2B 1PP9D 4D6TJ 1LT1A 2H88C 2FFDB 1SQPG 2KSEA 2PEMA 1LP1A 1JY3N 3AEBC 2AFDA 3CL3D 4GDOA 4H0LC 2NRGA 1M1JB 3H1IJ 1D1DA 2ZYAA 5EFWB 1BGYD 1JTHA 2QM8A 1BSHA 1PEOA 4PD4I 1RO0A 3H0DA 4N78E 1X8YA 2BEZF 2K3RA 1VQ9P 1S9KE 3MTUE 1VQ6P 3TK1A 4F37A 1QL1A 1QL2A 1NYHA 2OYOA 4PH0A 3H25A 3CX5E 2JB0A 3AE9C 1S3JA 2M5RA 2YIUB 4PJ0E 1PPJE 2XU6A 2WPVB 1EXJA 2AEFA 2C0XA 4PWVB 1QLED 2I1JA 3ITKA 3T97B 2JU2A 2LR2A 1VQ5P 3H1JJ 3VN0A 3WBHA 1N8RQ 2H8PD 1ZW0A 3CC7P 1DX7A 3BRVB 2FYUD 2KGAA 4H44B 5HGNA 5AW4B 1LTJB 5KJ7A 2D2CD 3DS3A 2HR3A 1JCDA 1L4AC 1LTSC 1URQC 1AVYA 1NAFA 3H47A 4IFDK 3FWLA 1XTCC 4MRTC 1E79H 3L70G 2PEOA 3SWKA 3GJNA 4DJGA 2R3CA 2QIWA 1EC5A 3CXHH 3L75G 2N1TB 1PL5A 4KT0J 3MHVA 3LW5J 5KP8B 5KLVG 1L0IA 1T3UA 4YPCA 2M8LA 1JCCA 1JNMA 4H0LD 2KP8A 1F80D 2CPBA 3H1HJ 1OW8A 5AVVB 3RK2C 3SWYA 3HYBA 3B4SA 3D70A 1NTME 2R44A 3I55P 1YIJP 3BVHA 2BCCG 3I5CA 1LTAC 1JY2P 3EWKA 3WUVA 2YKPA 3L37A 1KTMA 1HUCA 4OH8B 2KK7A 2BQ1E 4C7NA 5KAFE 1K04A 3N4XA 2QJKB 3VMAA 5HVCA 5KP7B 3F5HA 4GR6A 2KYVA 3CCEP 2Z46A 4YXWH 2UWJE 2DNWA 3S4RA 2EHTA 2KLUA 1YHQP 2FXMA 2ZXXA 2MD9A 2MKVA 5EJDA 1OXZA 3G1GA 4HYTB 2E75C 1OIPA 1FE6A 5HGMA 1KILB 3CWBD 1R8EA 2B88A 1KQLA 1KYOH 2FY8A 4U0AA 1U7MA 1AA0A 3O8ZA 5DJUB 3RG6C 1L4AD 3H1LE 4GT1A 1URQD 1IJDB 2E76C 1FU1A 1BDDA 3C9IA 1KQFB 3TNUB 4COCA 3TGUD 2JEEA 4BPFA 2Y9YA 2JP3A 3HE4A 1GK4A 3EJBA 1K30A 1USDA 2QJPC 1YQ4C 5TISE 5APSA 1JJ2O 1H8AA 2V7QH 2K0XA 4UHPB 2HPCA 1DEEG 4EIJA 3A0HE 2FVEA 3E7KA 3Q2YA 3GHGA 3GZLA 2ZVOB 3RK2D 4B86A 1RH5B 2G8YA 5B66H 2KS1A 1MZ8A 3L73J 1T6AA 1BCCG 1NTKG 5KLIB 3MGNA 1IZNB 4D6TG 3E2DA 2NPSB 4WYMA 3H1IG 1GPJA 2KOSA 1BE3D 2JYGA 3KYQA 3LIEA 1L0LE 3AEEC 1K05A 3CXHD 2LOLA 2L91A 4QKOA 5K5GB 2QG4A 2GDWA 4U0CA 2W27A 3DTJA 2VSQA 5BU5A 1NOHA 2E75D 4DT0A
chains in the Genus database with same CATH topology
2XV6A 4XFXA 1PEQA 5F2NA 4U0AA 4XFYA 3DPHA 3DS3A 2PEJA 1Q7YQ 2OTLP 3DS5A 3DS2A 2PEKA 1KC8Q 4QNBA 3RG6C 2JYLA 4XROA 2P9XA 3CCVP 3LRYA 4M0IA 1PEMA 1KD1Q 1VQKP 3G71P 1S72P 3G28A 3Q20A 3H47A 1K9MQ 2ONTA 1Q81Q 1AUMA 3P05A 1YI2P 2PEOA 5JPAA 1YJ9P 5BS2A 3CCJP 2CWOA 3NTEA 1BAJA 2EIAA 5F2OA 1VQ8P 4U0EA 1M6EX 1YJNP 4PH1A 1ZMBA 1M74A 5F2KA 2PY8A 4XRQA 4COCA 3G4SP 1YJWP 2EFJA 2Z45A 3CD6P 1VQOP 1Q86Q 2JO0A 3DS4A 2BHVA 1A8OA 2PEMA 3CC4P 3CCLP 1Q82Q 1K30A 5BS1A 1M6NA 3CXCO 5HGOA 3MGEA 1YITP 2KODA 2M8LA 1QVGO 1JJ2O 2XT1A 4COPA 1RO2A 2Z44A 1D1DA 5I4TG 1K8AQ 4GR2A 2OARA 3HYBA 3CC2P 3G29A 1PEOA 1QRJA 2PEIA 3I55P 1YIJP 1VQNP 2QEXP 1RO0A 2OTJP 3H0DA 3CCUP 1W2BO 1VQ9P 3G1IA 2PENA 1E6JP 1VQ6P 3G26A 2M8PA 1M1KQ 1QVFO 3I56P 1VQLP 3G0VA 1K73Q 4PH0A 2EG5A 3B5IA 5DCKA 1IUQA 1NJIQ 2XXMA 2BQ1E 3G6EP 2LF4A 3E2DA 3VRLC 1M90Q 4WYMA 1EOQA 1VQPP 2E1MA 1A43A 1VQ7P 4U0DA 3CCRP 4GR6A 1RNIA 2JYGA 3M1MA 3CMAP 3CCEP 4IPYA 3HZQA 2PEQA 3DS0A 2BUOA 2Z46A 1VQ5P 3OW2O 2L6EA 3CCQP 2QA4P 3CCMP 3WBHA 4XFZA 1N8RQ 3CMEP 1YHQP 1EIAA 1VQMP 3CC7P 3G1GA 1VQ4P 1KQSO 1PEUA 4U0CA 4U0BA 4U0FA 5HGMA 3CCSP 5HGNA 3CPWO 3G21A 3DTJA 2DGYA 3DS1A 3H4EA 5HGLA 2M8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP P;  3G4S P;  1YJW P;  1VQ7 P;  3I55 P;  3CCR P;  1YIJ P;  2QEX P;  1VQN P;  2OTJ P;  3CMA P;  3CCU P;  1W2B O;  3CCE P;  1VQ9 P;  1Q7Y Q;  2OTL P;  3CD6 P;  1VQO P;  1Q86 Q;  1VQ5 P;  3OW2 O;  1KC8 Q;  1VQ6 P;  3CCQ P;  3CCV P;  2QA4 P;  3CCM P;  3CC4 P;  3CCL P;  1N8R Q;  1M1K Q;  1KD1 Q;  1Q82 Q;  1VQK P;  1QVF O;  3CME P;  3G71 P;  1YHQ P;  3CXC O;  3I56 P;  1S72 P;  1YIT P;  1VQM P;  1K9M Q;  1VQL P;  1Q81 Q;  1K73 Q;  3CC7 P;  1QVG O;  1JJ2 O;  1VQ4 P;  1KQS O;  1YI2 P;  1NJI Q;  1YJ9 P;  3CCJ P;  1K8A Q;  3G6E P;  3CCS P;  3CPW O;  1VQ8 P;  1M90 Q;  1YJN P;  3CC2 P; 
#chains in the Genus database with same CATH topology
 3CE7 A;  3WUT A;  3L71 E;  1PEQ A;  2P67 A;  2JO1 A;  3V2Q A;  4PXH B;  1EDK A;  2Y0D A;  3M06 A;  1GZL A;  2XZR A;  3H1J G;  1FS0 E;  1AV1 A;  4WY4 B;  2FYN B;  2K1A A;  1BAJ A;  1SQQ J;  2E76 D;  2KG6 A;  3A0B E;  1LTB C;  5APV A;  2YMK A;  4U3F J;  2BHV A;  2A06 E;  1KOR A;  3AE2 C;  2Y0C A;  2OYH B;  2QJY C;  2XT1 A;  1FZC A;  4TT3 H;  2E42 A;  3HTK B;  2MVV A;  3L4F A;  1NHL A;  3KDP B;  5APT A;  3CCU P;  1EXI A;  3HUS B;  3G1I A;  2YKO A;  5KTB A;  2XZ1 C;  1FJP A;  1M1K Q;  1EMV A;  1KYO D;  1K73 Q;  1AF8 A;  1IUQ A;  3L72 D;  1S5L E;  2WSF H;  5KKZ B;  1PP9 E;  1VQP P;  3SFD C;  4XE5 B;  1YQ3 C;  2KOO A;  4C7R A;  3H1H G;  1CI6 A;  1SQB D;  1M1J C;  2M3E A;  3B5N C;  4JPZ B;  2GZF A;  4XFZ A;  3SWF A;  1Z6M A;  1L0N J;  1HF9 A;  1SQB K;  1BGY E;  2NZ2 A;  2N50 A;  2JBG A;  2JU1 A;  2W6B A;  2M8N A;  4XFX A;  3BCC D;  2GZG A;  1RF1 B;  1SFC C;  3Q20 A;  1K9M Q;  2YIU C;  3FWN A;  4LC1 A;  4HKG A;  1LP1 B;  3RBZ A;  4JF7 A;  1YI2 P;  1CZQ A;  1PV3 A;  1SS1 A;  1VQ8 P;  3V4Q A;  3IF4 A;  5CMZ A;  5H2F H;  5CBN A;  1H88 A;  2IZ0 A;  1MFT A;  4OVN F;  1JTH B;  3IFM A;  2QE7 H;  3IAO A;  3H1K J;  3CD6 P;  3DS4 A;  1FZF A;  3CC4 P;  2FYU E;  4WBA A;  3RBX A;  1NTZ J;  3GLM A;  1HJ0 A;  1LTJ C;  3HD7 C;  1JY3 O;  1KB9 H;  1OMI A;  2FQ0 A;  1UJZ A;  1GXG A;  3L74 D;  2ITA A;  4I2L C;  1EZV I;  2ZT9 B;  4PD4 H;  1QRJ A;  2L5G B;  1VQN P;  2OTJ P;  5CHX A;  1ZV8 A;  2JDI H;  3EQ2 A;  2MJZ A;  1L4A A;  2PEN A;  1VHN A;  3B8E B;  2O01 N;  2YKQ A;  5BVZ A;  3ZDM A;  2L22 A;  1LWU A;  2OYI A;  1SQP D;  2LPK A;  1IFD A;  1VF5 C;  3PHL A;  4U3F D;  4GOE A;  2K92 A;  3A3Y B;  4U0D A;  1SQP K;  1KMI Z;  3BAS A;  2KR5 A;  3P32 A;  4RO0 A;  1RNI A;  3CMA P;  3M1M A;  1WRG A;  1M57 D;  3MD0 A;  1T3J A;  3B5N D;  3S1K A;  2O01 H;  2FBW C;  3L73 G;  3VMZ A;  1NU1 J;  3RL0 g;  3NTN A;  4AYC A;  1SQV J;  1NO4 A;  1GU5 A;  4H13 B;  2LL8 A;  1ZME C;  3KQG A;  2IFN A;  2PEJ A;  4DCK A;  2KGD A;  1SFC D;  1J1D C;  2N5H A;  1OVU A;  4IOI H;  1USE A;  2GUS A;  1IC2 A;  4JQ0 D;  3G9R A;  3H6P A;  5KAI E;  2E5Y A;  2RN0 A;  4XRQ A;  1IFJ A;  1ZRT D;  3Q3D A;  4TLF A;  4GOF A;  5AVZ B;  2GZJ A;  2LXB A;  2K9J A;  2YMY A;  1T8Z A;  1M6N A;  3CWB E;  5APQ A;  5TJH A;  5KAI H;  3HD7 D;  1HGV A;  3L70 D;  4C7N B;  1SQQ G;  5CJ4 A;  1GMJ A;  3JSV C;  1RE4 C;  3L75 D;  3A2A A;  5CCG C;  2Y0E A;  4U3F G;  5KLV D;  3TGU E;  1SQX J;  1EZV G;  1RQU A;  2RH0 A;  1GU4 A;  2OQQ A;  2DW3 A;  2WPQ A;  1VF5 D;  5KLV K;  3V2N A;  2PEQ A;  1X9V A;  2Q9I A;  1Q90 D;  2LIW A;  2L0Q A;  3L36 A;  4ZKP A;  2BCC D;  1HH0 A;  4BWN A;  3AE4 C;  5AW6 B;  2A45 I;  1PEU A;  3PJS K;  5CZD B;  2IBZ I;  2BAS A;  1FZG A;  2M8R A;  1OR5 A;  2AXT H;  1X0T A;  1KB9 D;  2J59 M;  1KC8 Q;  2KOR A;  4PD4 D;  1AQ5 A;  1KN7 A;  3HE4 B;  1Q81 Q;  3M91 A;  4OGQ C;  2WQY C;  1AQT A;  5BS2 A;  2JGP A;  2EIA A;  1BE3 E;  1L0N G;  2XZ0 D;  1OFC X;  2HPC B;  3F89 A;  4XFJ A;  2B87 A;  1PGQ A;  3Q5R A;  4W7Z A;  3CXH E;  2KGC A;  3GHG B;  3KZI H;  3N7N A;  3QWO C;  2JJL A;  3AE8 C;  2E74 C;  1ZNV A;  3RL0 C;  3LW5 H;  5BS1 A;  1CW5 A;  3CXC O;  2KG8 A;  2KS1 B;  2Q3E A;  2W90 A;  1EDI A;  2FAE A;  1NU1 K;  2EHS A;  1FR2 A;  2Z44 A;  3TF5 A;  5AW8 B;  1N73 C;  5L8R J;  1SQV K;  1AVO A;  2QEX P;  3O6Q A;  1FOS E;  3QH9 A;  2AEJ A;  5B5E H;  2P2U A;  4WY4 C;  2IYO A;  3I56 P;  3VTP C;  3AE6 C;  2C9L Y;  3H1K G;  5CCG D;  1LNQ A;  1H89 A;  5M1B A;  2EG5 A;  1DD4 A;  1R5L A;  3MUD C;  1OVV A;  1NTZ G;  3AEF C;  4Y99 C;  1M7L A;  3CCR P;  1E0H A;  4IPY A;  2ERH A;  2QA4 P;  2HLO A;  1JY3 P;  1EIA A;  1S4X A;  4K35 A;  2CGQ A;  2N6Z A;  4ZNC A;  1BCC D;  1NTK D;  2JWD A;  4D6T D;  2L4B A;  3FGA D;  1NTK K;  3DPH A;  1P84 I;  1AFO A;  2IX7 C;  3H1I D;  1KYO E;  3V4W A;  1PEM A;  3L72 E;  3G71 P;  1N7L A;  5BU8 B;  2PAJ A;  2LKI A;  5GTI H;  1VPC A;  2Z5H A;  5KKZ C;  3GMA A;  3SFE C;  3CCJ P;  4OGQ D;  1MUU A;  2IBZ G;  2FVF A;  1FZC B;  1SQB E;  4NPF X;  2AVA A;  1RHZ B;  2ZVN B;  1NU1 G;  5AW9 B;  2D2C B;  1PGP A;  1SQV G;  4N3Y B;  3CI9 A;  1G1I A;  3B5N A;  1Q82 Q;  2E74 D;  4OWF A;  3RL0 D;  1N7S A;  4COP A;  1NTM J;  2B9B A;  1GW3 A;  3BCC E;  1JO5 A;  1HQB A;  2KZI A;  2V4H A;  2J58 A;  2N6Y A;  3H1J D;  5AW5 B;  1JB0 J;  2PEI A;  3RK3 C;  2GUV A;  1SFC A;  5AW2 B;  1RE3 C;  4YTP C;  1E6J P;  3OAK A;  3WUU A;  3ABV C;  3G26 A;  1CI6 B;  5B66 E;  3LMO A;  3PP5 A;  3CX5 I;  2Y9Z A;  4WY4 D;  1LGH B;  4AQR D;  1AJY A;  2K2Q A;  5KP6 B;  2IZ1 A;  2MVU A;  3B5I A;  1NJI Q;  4EI2 A;  4NPE A;  4H0L B;  2GZE A;  4M3L A;  5AVU B;  1LT9 C;  2HFE D;  3HZQ A;  3UIA A;  1GTW A;  1BDC A;  3RGU A;  4H2X C;  4UB6 H;  2N98 A;  4N6J A;  3CCQ P;  3CCM P;  3GF7 A;  2XNX A;  3OA7 A;  3L74 E;  2KOQ A;  3HD7 A;  1KQS O;  2CPS A;  1JMM A;  4H2W C;  3G21 A;  3BRT B;  1KZU B;  3PH0 A;  1DV5 A;  4JBZ A;  3H1L J;  3P8C D;  1VL2 A;  5E79 H;  1SQX G;  4BRY A;  1W5C E;  3KHU A;  1GW4 A;  4R0M A;  1HJB A;  2FHS C;  3H32 A;  2IYP A;  4M0I A;  1SQP E;  3H1H D;  2B89 A;  4I1L A;  1MFZ A;  5DJT B;  1YJN P;  3PTZ A;  2EFJ A;  2FXO A;  4L75 A;  2K0Y A;  3CCL P;  1L4A B;  3C1L A;  2M5A A;  5HGO A;  1YIT P;  1QVG O;  2O3J A;  5AVT B;  2R32 A;  1LWU B;  3JC2 2;  2WZ7 A;  2KB7 P;  2OYI B;  1KFN A;  4IZ6 A;  4IL6 H;  3JCU H;  2Q6Q A;  3Q5P A;  2K9Y A;  3AEA C;  3RK3 D;  3HE5 A;  3G3Z A;  3SSU A;  1PFI A;  1NH4 A;  5DCK A;  1L0L J;  3VP8 A;  1ZRT E;  5CCH C;  3AEG C;  2POH A;  2Q3I A;  2KNC A;  2C9N Y;  1KYO I;  3RK2 B;  2BUO A;  2O1K A;  1HY8 A;  3V2P A;  1Z56 A;  3A7O A;  2KI7 B;  2VRS A;  2R5D A;  3L71 J;  2I8D A;  3L70 E;  1PPJ G;  3W67 A;  4WWI A;  1GL2 C;  3H4E A;  2XV6 A;  3L75 E;  2FFD C;  4XFY A;  2JYL A;  5KLV E;  5CCG A;  2K9J B;  4ASV A;  2M0B A;  2WWW A;  3U43 A;  4U0E A;  1NKZ B;  2KOP A;  2LKM A;  3L35 A;  2XND H;  2MY5 A;  3L73 D;  5H2F E;  2BCC E;  1VQO P;  4BPG A;  3R2P A;  3V2R A;  4CA3 A;  1PZQ A;  3VMY A;  4WB4 A;  1SVF A;  2GYK A;  1QGK B;  5I4T G;  1BXI A;  1HGZ A;  1ZOY C;  1KB9 E;  3AE7 C;  1WT6 A;  5EW5 E;  2WSE J;  3PLN A;  3MIW A;  2ROQ A;  1W2B O;  1FBM A;  4PD4 E;  2K5X A;  2SPZ A;  1NQ4 A;  1HBW A;  4H44 C;  1PP9 J;  2PFX A;  1LTI C;  4K3A A;  4YXD C;  4L74 A;  2QJP B;  2H89 C;  2LF4 A;  1GDT A;  2P58 A;  1NTM G;  5CCH D;  4EDF A;  4ZMD A;  1U7J A;  2AXC A;  2ZXE B;  1BGY J;  2PRR A;  3CLQ A;  2E5T A;  1SQQ D;  1URQ A;  4JYC A;  2IDB A;  2N1T C;  2MR7 A;  3CCS P;  1N73 A;  2WMM A;  3CPW O;  4ASW A;  3GW6 A;  1SQQ K;  3AED C;  2XKM A;  1IFM A;  3LID A;  2WSS H;  1GL2 D;  5AW1 B;  1OW7 A;  1G1J A;  1Q7Y Q;  1FZE A;  1EZV D;  2P7J A;  1IFP A;  2B87 B;  4QNB A;  4XRO A;  3VYI A;  3LRY A;  1JM0 A;  2WVR A;  2WSC J;  4WVZ A;  1G2C A;  3MUD A;  2LIU A;  5APU A;  2WT7 A;  3AE3 C;  5AW0 B;  3MZW B;  1ZMB A;  3G4S P;  2FYU J;  2JWA A;  4U7J A;  1OVR A;  2Q1K A;  3RG2 A;  3H1L G;  3C8V A;  3O6Q B;  2YO2 A;  1BCC E;  3MGE A;  1NTK E;  2GDX A;  3DS1 A;  3V6I A;  2YNY A;  4D6T E;  2QJK C;  2W83 C;  2W8Z A;  3BAT A;  4NPD A;  3M9H A;  1S1C X;  2E43 A;  2WPS A;  4O9B A;  2K93 A;  3H1I E;  4GKG A;  2W6A A;  1L0N D;  2AF8 A;  4L76 A;  2O01 J;  3D71 A;  5AVR B;  1KIL C;  1L0N K;  4HKZ H;  1ZR2 A;  4IFF A;  1JEK A;  3PRJ A;  1FZC C;  2PP6 A;  3M0D C;  4H44 D;  1YYC A;  2HOD A;  2QJY B;  1OX3 A;  4HH2 A;  4NEO A;  2G3A A;  3DS0 A;  1VKU A;  3A5T A;  1JUN A;  1L2P A;  5AVY B;  3H1J E;  2N1T D;  3H1K D;  3AE5 C;  2GZI A;  4RKU J;  1RY3 A;  3NFQ A;  4DZO A;  2WIT A;  1P84 H;  4GOD A;  1L0L G;  1NTZ D;  1MKM A;  2L9F A;  1JY2 N;  2AXT E;  2CG5 B;  1DIP A;  2PEK A;  4RJT A;  1RE3 A;  4RES B;  3TDK A;  3NY7 B;  3CCV P;  1S5L X;  2CK3 H;  1NTZ K;  2W6J H;  3B5N B;  2Q7C A;  4PV1 B;  5JPA A;  1KB9 I;  1N7S B;  3L71 G;  2PY8 A;  5APX A;  1YJW P;  1LT9 A;  1RF0 C;  4GIF A;  3CWB J;  3HRN A;  2Z45 A;  3D6Z A;  5KLI C;  1Q86 Q;  1PIX A;  1SFC B;  3KZI E;  1H0T A;  2NPS C;  2QVA A;  2ZYD A;  3P8C E;  1X22 A;  1HVV A;  1ZN5 A;  4IFM A;  1NWQ A;  2H7H A;  1WMK A;  1FOS F;  3GF3 A;  1FZA A;  2FXP A;  5APW A;  2IBZ D;  3H1H E;  1EDJ A;  2A06 G;  1NU1 D;  3TGU J;  2XV5 A;  2VLQ A;  3CX5 H;  2M8P A;  1IFN A;  1QVF O;  1KQG B;  5B5E E;  1SQV D;  1YTZ T;  1EQ7 A;  4PJ0 H;  1UIX A;  2N9Y B;  2XXM A;  1KIL D;  3HD7 B;  2K94 A;  2FYU K;  4Z1M H;  2Z5I A;  5HV8 A;  1OZH A;  3FXD A;  1MZ9 A;  2BEQ D;  2CNR A;  3MP7 B;  4BRY B;  1LWU C;  1A02 F;  2FYN C;  2OYI C;  3H32 B;  1GD2 E;  4U0B A;  3U1C A;  2OTK E;  1JMB A;  1LJ2 A;  1PP9 G;  3RK3 E;  3WMM 0;  1VF5 B;  2OTL P;  3DS5 A;  3DS2 A;  2OYH C;  2OGU A;  3P8M C;  3OJA B;  1KD1 Q;  1BE3 J;  1LTG C;  2HYN A;  1BGY G;  1S2E A;  4R4L A;  2FYZ A;  2M5A B;  3E1I A;  4ZKU A;  2J5U A;  2KLV A;  2JQ4 A;  5GTI E;  1UNK A;  5CCH A;  2KWL A;  3AEC C;  3HUS C;  1N2D C;  4I7Z B;  3IN6 A;  2K37 A;  2KXP B;  3EFF K;  1HTL C;  2M3B A;  1A8O A;  2MF4 A;  1SQX D;  4BPH A;  3E1R A;  1J1D B;  2WTY A;  3GKL C;  3M9Q A;  2A45 G;  3HE5 B;  2C0W A;  2IFM A;  2NPS D;  4GR2 A;  1SQX K;  2KUB A;  1NGM B;  1GL2 A;  3CC2 P;  2VLN A;  4KHX A;  5AVQ B;  2LML A;  1TU3 F;  2GDY A;  2FFD A;  1GK6 A;  3TSI A;  2KNC B;  3M0A A;  2JKV A;  3V5B A;  2FYU G;  1M1J A;  1VQL P;  1P84 D;  5KAF H;  1FDO A;  2AFE A;  3WU2 E;  3L73 E;  1T8K A;  1RF1 C;  1SP4 A;  2QSI A;  3NXS A;  1FDM A;  3AE1 C;  1A02 J;  1J1E B;  2FKW B;  3S9O A;  2KGE A;  4UB6 E;  3WU2 H;  3II6 A;  5AVS B;  1T2K C;  3K5B A;  4U0F A;  2IPP A;  2Q5U A;  3T97 A;  3L72 J;  3USS A;  2HG5 D;  5E79 E;  3P7K A;  1FC2 C;  4N78 D;  1VQK P;  1S9K D;  3G28 A;  2K88 A;  1SQB J;  1J2J B;  1IK9 A;  2ZT9 C;  4LGD E;  1LTJ A;  1PGO A;  3NTE A;  3CX5 D;  1QX8 A;  3Q5S A;  4QMA A;  3CXH I;  4HB1 A;  1XTG B;  1PPJ D;  1OW6 A;  1SQQ E;  1Y8A A;  5TIS H;  3BCC J;  1SLQ A;  3VP9 A;  2V7Q J;  3U59 A;  2ZAE B;  2XDJ A;  3A0H H;  4U3F E;  1R5S A;  2N1T A;  4CPG A;  2K0D X;  1X79 B;  4OGQ B;  2YO3 A;  5KJ7 C;  3EFG A;  1EZV E;  2FAD A;  3U1A A;  4H2Y C;  4IL6 E;  3JCU E;  3VOP A;  3VMX A;  1U57 A;  3CWB G;  5CJ0 A;  3GG2 A;  2GM4 A;  2E74 B;  3R4Y A;  3RL0 B;  1URQ B;  4H13 C;  3B71 A;  1M90 Q;  2RMZ A;  3FX0 A;  2E1M A;  2R3S A;  1N73 B;  1VQ7 P;  3L74 J;  2LTE A;  1N86 A;  2R5B A;  2KSJ A;  1VQM P;  2FQ1 A;  4DG9 A;  3TGU G;  5GTH E;  2O1J A;  1T2K D;  1EDL A;  1G2C B;  1L0N E;  3KPE A;  1FAV A;  5HGL A;  1SQP J;  1IK7 A;  5CBO A;  1JOC A;  2WT7 B;  5F2N A;  2FAC A;  4JYB A;  4Y99 B;  1NTM D;  4W7Y A;  1W2E A;  2ONT A;  1KIL A;  5GTH H;  1NTM K;  3M0D A;  3A0B H;  2ZT9 D;  1M6E X;  3TYY A;  5AW3 B;  4C46 A;  1M74 A;  1E5W A;  2PNG A;  1D7M A;  1AYI A;  1M8O B;  3FXE A;  1DEB A;  2JO0 A;  1RE4 A;  2YXQ B;  1KV4 A;  1IO4 A;  2AEM A;  3EJD A;  2KW2 A;  2KOD A;  1IMP A;  1NAY A;  3H1K E;  4UB8 E;  1RO2 A;  1BE3 G;  3TNU A;  1K8A Q;  1Y9B A;  4I6M C;  1NTZ E;  4EOT A;  3IR9 A;  2QRX A;  3G29 A;  5AVW B;  1DH3 A;  2HOD B;  1NKN A;  2E75 B;  5KJ7 D;  3EJE A;  4L73 A;  2KOG A;  2WSE H;  4PV1 C;  2ZYG A;  4A7P A;  4UB8 H;  2YXR B;  1N7S C;  1X3O A;  3G0V A;  1S5L H;  2WSF J;  3H1L D;  5AVX B;  3G6E P;  3VRL C;  4H13 D;  2H43 A;  1CSB A;  1EOQ A;  1BSN A;  2E76 B;  4R4M A;  1QEX A;  1M56 D;  1RF0 A;  5AW7 B;  1FZB A;  3RK3 B;  3L70 J;  1RQV A;  1VDF A;  2QNW A;  4AUW A;  4W80 A;  2NPS A;  3L75 J;  5C39 A;  3GHG C;  2IBZ E;  5KLV J;  2GA1 A;  1NU1 E;  1NVO A;  1LT9 B;  1SQV E;  2JR8 A;  2JAZ A;  2WPR A;  3GZM A;  1KIL E;  2VLO A;  7CEI A;  2FQ2 A;  1JY2 O;  2NO8 A;  2A45 H;  1UII A;  4BXL A;  1AUM A;  2WSC H;  1YJ9 P;  1H0T B;  5F2O A;  2BCC J;  2P10 A;  1KFM A;  3Q1M A;  4PH1 A;  1Q2N A;  2ZFC A;  4KJM A;  1IFI A;  3L72 G;  1L0L D;  2CQ8 A;  4WY4 A;  2P1J A;  4XA4 A;  2X2B A;  2FVA A;  2QM7 A;  1L0L K;  2OAR A;  1IMQ A;  1SQB G;  1LTT C;  1HWT C;  3KXD A;  2MR8 A;  1YTZ I;  1DD3 A;  2OYH A;  3L71 D;  1ACP A;  4DOJ A;  2LXC B;  4PV1 D;  2RKL A;  3W68 A;  3HTK A;  4IL6 X;  1N7S D;  4I7Z C;  3BCC G;  4HJG H;  3HUS A;  3D6Y A;  2KIK A;  1A43 A;  1MV8 A;  2VLP A;  1SQX E;  1OWA A;  1ZP0 C;  3OW2 O;  2L6E A;  3CME P;  2ZJS E;  2KZJ A;  1KLP A;  3B4Q A;  1ZXG A;  1VQ4 P;  5APY A;  1ZLL A;  2A06 D;  1CEI A;  2N9B A;  2D2C C;  2DGY A;  4EYY Q;  2PGD A;  1PGJ A;  1FDI A;  1FJK A;  2KG9 A;  4LLH A;  1P84 E;  3M9B A;  2WPT A;  2P9X A;  3NMD A;  2N5I A;  1Y47 A;  3L74 G;  1S72 P;  2Z4E A;  4Y28 J;  2I1K A;  1GXH A;  1L0H A;  3P05 A;  2CWO A;  1YBK A;  1RF1 A;  5F2K A;  1DNY A;  4MN4 C;  1ZR4 A;  1J1E C;  1BCC J;  1NTK J;  1GL2 B;  1PP9 D;  4D6T J;  1LT1 A;  2H88 C;  2FFD B;  1SQP G;  2KSE A;  2PEM A;  1LP1 A;  1JY3 N;  3AEB C;  2AFD A;  3CL3 D;  4GDO A;  4H0L C;  2NRG A;  1M1J B;  3H1I J;  1D1D A;  2ZYA A;  5EFW B;  1BGY D;  1JTH A;  2QM8 A;  1BSH A;  1PEO A;  4PD4 I;  1RO0 A;  3H0D A;  4N78 E;  1X8Y A;  2BEZ F;  2K3R A;  1VQ9 P;  1S9K E;  3MTU E;  1VQ6 P;  3TK1 A;  4F37 A;  1QL1 A;  1QL2 A;  1NYH A;  2OYO A;  4PH0 A;  3H25 A;  3CX5 E;  2JB0 A;  3AE9 C;  1S3J A;  2M5R A;  2YIU B;  4PJ0 E;  1PPJ E;  2XU6 A;  2WPV B;  1EXJ A;  2AEF A;  2C0X A;  4PWV B;  1QLE D;  2I1J A;  3ITK A;  3T97 B;  2JU2 A;  2LR2 A;  1VQ5 P;  3H1J J;  3VN0 A;  3WBH A;  1N8R Q;  2H8P D;  1ZW0 A;  3CC7 P;  1DX7 A;  3BRV B;  2FYU D;  2KGA A;  4H44 B;  5HGN A;  5AW4 B;  1LTJ B;  5KJ7 A;  2D2C D;  3DS3 A;  2HR3 A;  1JCD A;  1L4A C;  1LTS C;  1URQ C;  1AVY A;  1NAF A;  3H47 A;  4IFD K;  3FWL A;  1XTC C;  4MRT C;  1E79 H;  3L70 G;  2PEO A;  3SWK A;  3GJN A;  4DJG A;  2R3C A;  2QIW A;  1EC5 A;  3CXH H;  3L75 G;  2N1T B;  1PL5 A;  4KT0 J;  3MHV A;  3LW5 J;  5KP8 B;  5KLV G;  1L0I A;  1T3U A;  4YPC A;  2M8L A;  1JCC A;  1JNM A;  4H0L D;  2KP8 A;  1F80 D;  2CPB A;  3H1H J;  1OW8 A;  5AVV B;  3RK2 C;  3SWY A;  3HYB A;  3B4S A;  3D70 A;  1NTM E;  2R44 A;  3I55 P;  1YIJ P;  3BVH A;  2BCC G;  3I5C A;  1LTA C;  1JY2 P;  3EWK A;  3WUV A;  2YKP A;  3L37 A;  1KTM A;  1HUC A;  4OH8 B;  2KK7 A;  2BQ1 E;  4C7N A;  5KAF E;  1K04 A;  3N4X A;  2QJK B;  3VMA A;  5HVC A;  5KP7 B;  3F5H A;  4GR6 A;  2KYV A;  3CCE P;  2Z46 A;  4YXW H;  2UWJ E;  2DNW A;  3S4R A;  2EHT A;  2KLU A;  1YHQ P;  2FXM A;  2ZXX A;  2MD9 A;  2MKV A;  5EJD A;  1OXZ A;  3G1G A;  4HYT B;  2E75 C;  1OIP A;  1FE6 A;  5HGM A;  1KIL B;  3CWB D;  1R8E A;  2B88 A;  1KQL A;  1KYO H;  2FY8 A;  4U0A A;  1U7M A;  1AA0 A;  3O8Z A;  5DJU B;  3RG6 C;  1L4A D;  3H1L E;  4GT1 A;  1URQ D;  1IJD B;  2E76 C;  1FU1 A;  1BDD A;  3C9I A;  1KQF B;  3TNU B;  4COC A;  3TGU D;  2JEE A;  4BPF A;  2Y9Y A;  2JP3 A;  3HE4 A;  1GK4 A;  3EJB A;  1K30 A;  1USD A;  2QJP C;  1YQ4 C;  5TIS E;  5APS A;  1JJ2 O;  1H8A A;  2V7Q H;  2K0X A;  4UHP B;  2HPC A;  1DEE G;  4EIJ A;  3A0H E;  2FVE A;  3E7K A;  3Q2Y A;  3GHG A;  3GZL A;  2ZVO B;  3RK2 D;  4B86 A;  1RH5 B;  2G8Y A;  5B66 H;  2KS1 A;  1MZ8 A;  3L73 J;  1T6A A;  1BCC G;  1NTK G;  5KLI B;  3MGN A;  1IZN B;  4D6T G;  3E2D A;  2NPS B;  4WYM A;  3H1I G;  1GPJ A;  2KOS A;  1BE3 D;  2JYG A;  3KYQ A;  3LIE A;  1L0L E;  3AEE C;  1K05 A;  3CXH D;  2LOL A;  2L91 A;  4QKO A;  5K5G B;  2QG4 A;  2GDW A;  4U0C A;  2W27 A;  3DTJ A;  2VSQ A;  5BU5 A;  1NOH A;  2E75 D;  4DT0 A; 
#chains in the Genus database with same CATH homology
 2XV6 A;  4XFX A;  1PEQ A;  5F2N A;  4U0A A;  4XFY A;  3DPH A;  3DS3 A;  2PEJ A;  1Q7Y Q;  2OTL P;  3DS5 A;  3DS2 A;  2PEK A;  1KC8 Q;  4QNB A;  3RG6 C;  2JYL A;  4XRO A;  2P9X A;  3CCV P;  3LRY A;  4M0I A;  1PEM A;  1KD1 Q;  1VQK P;  3G71 P;  1S72 P;  3G28 A;  3Q20 A;  3H47 A;  1K9M Q;  2ONT A;  1Q81 Q;  1AUM A;  3P05 A;  1YI2 P;  2PEO A;  5JPA A;  1YJ9 P;  5BS2 A;  3CCJ P;  2CWO A;  3NTE A;  1BAJ A;  2EIA A;  5F2O A;  1VQ8 P;  4U0E A;  1M6E X;  1YJN P;  4PH1 A;  1ZMB A;  1M74 A;  5F2K A;  2PY8 A;  4XRQ A;  4COC A;  3G4S P;  1YJW P;  2EFJ A;  2Z45 A;  3CD6 P;  1VQO P;  1Q86 Q;  2JO0 A;  3DS4 A;  2BHV A;  1A8O A;  2PEM A;  3CC4 P;  3CCL P;  1Q82 Q;  1K30 A;  5BS1 A;  1M6N A;  3CXC O;  5HGO A;  3MGE A;  1YIT P;  2KOD A;  2M8L A;  1QVG O;  1JJ2 O;  2XT1 A;  4COP A;  1RO2 A;  2Z44 A;  1D1D A;  5I4T G;  1K8A Q;  4GR2 A;  2OAR A;  3HYB A;  3CC2 P;  3G29 A;  1PEO A;  1QRJ A;  2PEI A;  3I55 P;  1YIJ P;  1VQN P;  2QEX P;  1RO0 A;  2OTJ P;  3H0D A;  3CCU P;  1W2B O;  1VQ9 P;  3G1I A;  2PEN A;  1E6J P;  1VQ6 P;  3G26 A;  2M8P A;  1M1K Q;  1QVF O;  3I56 P;  1VQL P;  3G0V A;  1K73 Q;  4PH0 A;  2EG5 A;  3B5I A;  5DCK A;  1IUQ A;  1NJI Q;  2XXM A;  2BQ1 E;  3G6E P;  2LF4 A;  3E2D A;  3VRL C;  1M90 Q;  4WYM A;  1EOQ A;  1VQP P;  2E1M A;  1A43 A;  1VQ7 P;  4U0D A;  3CCR P;  4GR6 A;  1RNI A;  2JYG A;  3M1M A;  3CMA P;  3CCE P;  4IPY A;  3HZQ A;  2PEQ A;  3DS0 A;  2BUO A;  2Z46 A;  1VQ5 P;  3OW2 O;  2L6E A;  3CCQ P;  2QA4 P;  3CCM P;  3WBH A;  4XFZ A;  1N8R Q;  3CME P;  1YHQ P;  1EIA A;  1VQM P;  3CC7 P;  3G1G A;  1VQ4 P;  1KQS O;  1PEU A;  4U0C A;  4U0B A;  4U0F A;  5HGM A;  3CCS P;  5HGN A;  3CPW O;  3G21 A;  3DTJ A;  2DGY A;  3DS1 A;  3H4E A;  5HGL A;  2M8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...