3G6EP

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g6eP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g6eP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g6eP02
3CC7P 1QVFO 1S72P 1VQOP 1YIJP 3CCMP 3CCQP 1KC8Q 3CPWO 3OW2O 1N8RQ 1Q7YQ 1VQPP 3CCEP 1K9MQ 3CCSP 3CCUP 1YITP 3CC2P 3I56P 1Q86Q 1M90Q 1VQLP 3CMEP 1Q82Q 2QEXP 1VQMP 1W2BO 1VQ8P 3CCLP 1YJNP 2OTLP 3CCRP 2QA4P 1YI2P 1NJIQ 1JJ2O 1Q81Q 1VQNP 1K8AQ 3CC4P 3G6EP 1YHQP 1VQ7P 3CD6P 1VQKP 3CMAP 3G71P 1KD1Q 3G4SP 1YJ9P 1YJWP 3CCVP 1VQ4P 1QVGO 2OTJP 1M1KQ 3CXCO 1KQSO 1VQ6P 1K73Q 1VQ9P 3I55P 3CCJP 1VQ5P
chains in the Genus database with same CATH superfamily
2LKMA 3CC7P 4I2LC 3MTUE 3GF3A 4OGQD 2XDJA 3V4WA 3U1AA 4JBZA 1S2EA 3L70J 1KYOH 1VQ7P 1W2EA 3G4SP 2JKVA 1KYOE 1JEKA 2Y0CA 1FZGA 2A45I 3RGUA 1GW4A 2FXPA 3DS0A 1KYOD 2KS1A 2CPSA 5CCGD 1NTKG 2VLQA 3FWLA 4N3YB 5AVTB 1ZNVA 5TISH 1U57A 1NQ4A 4EIJA 1ZXGA 3WUTA 4IPYA 3L74G 1DIPA 5TISE 3L70G 2OYIC 2KOQA 1FZBA 1NTMG 2FFDA 4PV1D 3A2AA 4B86A 1LTJB 3PJSK 1H0TB 3ZDMA 1HJBA 1OXZA 1T3UA 3KZIH 1SQVK 3B5NA 1ZRTE 2KB7P 3B4QA 4GT1A 4GOEA 1QX8A 1KQFB 1AQ5A 2NZ2A 1NU1K 3VYIA 1S9KE 2KZJA 2K88A 1Q86Q 2C9LY 2XZ0D 1KYOI 3GZMA 1S9KD 1LNQA 1JCCA 2HPCA 2L22A 2IZ1A 1FOSE 3E2DA 1X79B 2GYKA 3SWKA 4NPDA 1L0ND 4U3FE 2AFDA 1IFJA 1NAYA 3FWNA 1VPCA 3MIWA 2L6EA 3Q3DA 3AEGC 3L4FA 1PP9E 4UB8H 2JWDA 2NPSC 1DD3A 4UB8E 1MFTA 4O9BA 3W68A 1FJPA 1FDIA 1N86A 1AUMA 1FDMA 1QVFO 3A0BE 2H8PD 1U7JA 2WZ7A 3WU2H 2FXOA 2ITAA 3C1LA 1T2KD 2FACA 1KLPA 2R3CA 3H0DA 3RK2D 3WU2E 2FKWB 3AE5C 3RBXA 3V2RA 1PEOA 1OVUA 3OJAB 2DGYA 2BCCJ 1HY8A 1QL2A 2PY8A 4H13C 2X2BA 5CCHC 1GK6A 4D6TJ 5C39A 3TGUJ 2GUSA 1M57D 2H88C 2WPQA 1T6AA 2YKPA 3G26A 2E74D 1P84H 1LWUB 1NTKK 3CXHH 5CMZA 5APSA 2LR2A 3CXHE 1PGPA 1N7LA 4W7ZA 1RE4A 3CPWO 4XROA 3BCCG 1LT9B 1P84D 1K30A 2IDBA 2WT7B 3MZWB 2ZT9D 3CXHD 1NTMK 3A3YB 1YI2P 2Z46A 1G2CB 2W83C 1GDTA 2PFXA 1LTJA 1H0TA 4IZ6A 5KKZC 1IK9A 3TGUG 3CWBE 1GU5A 1EDKA 2KGCA 2XKMA 1RQVA 7CEIA 5M1BA 3CWBD 1QGKB 1VQMP 2UWJE 1FZFA 2Q3EA 5BU5A 3GHGC 3G71P 1EDJA 2KLVA 5DCKA 2IBZG 3RK2B 1MZ9A 2FQ1A 4Y28J 2KODA 2IZ0A 2FVEA 3M9BA 1KC8Q 4EI2A 3CC2P 4XE5B 1K05A 3HYBA 1NJIQ 1GL2C 1ZN5A 4GOFA 1PEMA 1KORA 3HD7C 4ASWA 5CCGA 1NVOA 1S1CX 4OGQC 1OIPA 2ZJSE 3VN0A 4W7YA 3DTJA 2GDYA 2JO1A 3BATA 2WSFJ 3BASA 2ZT9B 1M74A 1VF5D 2CPBA 1L0IA 1YTZT 4N78E 2GZEA 3MD0A 1KB9E 3G3ZA 1FZEA 3L71E 2JEEA 3H1KJ 5AW0B 4KT0J 5HVCA 5CHXA 4YTPC 2KNCA 3ITKA 5KLIB 2PEOA 4WY4B 5BS2A 1FDOA 4H0LC 3L71D 1QRJA 1N73C 1SQXE 1LT1A 2P67A 1LWUA 2R5DA 3V2QA 5AW5B 1L4AC 4PV1C 3NTEA 1KFNA 1Y8AA 2XT1A 1S3JA 3H6PA 2Z4EA 1K04A 1SQXD 4GR6A 3HUSB 3JCUH 1E6JP 1HH0A 2OTLP 3NMDA 2XV6A 1UNKA 1SFCD 3L72J 1EZVD 1JJ2O 1GK4A 3H1LJ 1AFOA 2EIAA 3JCUE 1EIAA 1IZNB 2WT7A 4DG9A 1M1KQ 1OZHA 3M1MA 1L0NG 1E0HA 1G2CA 3C8VA 1OFCX 1SS1A 3A7OA 4AYCA 1GXHA 1PEUA 4GIFA 3SSUA 1PL5A 2GZFA 2W6BA 1RHZB 2JGPA 5B66H 1KB9I 1PPJG 3U59A 3H1HE 5APTA 1LT9C 1M8OB 1SQPE 3L72G 1Z56A 4U7JA 3G21A 4M3LA 2Y0DA 3TSIA 2K5XA 2E5YA 2JBGA 3A5TA 1SQPD 3LW5J 1KILE 2BEZF 3MP7B 2OGUA 2IPPA 2MJZA 1A02F 5AVRB 3AE4C 4H44C 2P2UA 1KILD 2QNWA 2K94A 2WQYC 1X9VA 1CW5A 2IFNA 2N98A 1IFMA 1VQNP 3HE4B 1SFCB 1ZMEC 3SWFA 5KAIH 3V4QA 5AW6B 4OH8B 1GMJA 1QL1A 3MHVA 2V7QH 1BGYE 1DEEG 3UIAA 2M8RA 2E74C 1W5CE 4H2XC 2KR5A 4I7ZC 3M0DA 2OYIB 3M91A 2LL8A 1BGYD 2GM4A 1MKMA 1SQVJ 5AVWB 4WY4A 1E5WA 2JYLA 2KG9A 1SQBJ 5KP7B 2KIKA 4U0AA 4DZOA 2Q1KA 2M5RA 3R4YA 4C46A 2AEJA 1NU1J 1FZAA 1S4XA 2ZYAA 2QA4P 4LGDE 1NTZD 4DJGA 1GTWA 1VKUA 3HUSA 1JY3P 2FQ0A 3GG2A 2AEMA 1CEIA 2RN0A 5KLIC 4RKUJ 1KILB 2Q5UA 1MZ8A 4PJ0E 2Q3IA 1FC2C 3VTPC 3NTNA 2N1TC 3DS3A 2OYOA 1PIXA 3G6EP 5AVVB 1NHLA 2VLPA 1EQ7A 2WMMA 2BASA 1FS0E 5DJUB 1KZUB 4BPHA 2HYNA 4C7NB 4U0DA 2LKIA 5KP6B 4RO0A 1FJKA 3G1IA 2KOPA 3QH9A 1LTGC 5AW2B 2FXMA 1JMBA 4WBAA 3OW2O 2BCCE 3AE1C 1YITP 3E1RA 3DPHA 5KLVG 1OX3A 2A06G 2KZIA 1VQ8P 4D6TE 1XTGB 1VF5C 3P32A 2LPKA 2VLNA 2WITA 2D2CC 3H47A 1GL2D 4LLHA 1ZOYC 2P1JA 2WSCJ 4EDFA 2HODB 1NTKJ 3HD7D 3HE4A 3RK3C 2FYUE 2K93A 3EFFK 2Z45A 1NH4A 1EZVG 2JR8A 3L74J 4U0CA 2E76D 4DT0A 2FYUD 1NTMJ 1YJ9P 3ABVC 2OYIA 1BCCJ 4OVNF 3D71A 1RF1C 5KKZB 3S4RA 2E5TA 2VLOA 5KJ7C 4Y99C 1SFCC 2C0WA 3HRNA 3WUUA 2WPSA 3SFDC 3LIEA 1PEQA 2YMKA 2XXMA 1RF0C 4H0LD 1YJWP 5CBOA 2WVRA 2O01J 3VMZA 3DS4A 3CE7A 2K37A 3GHGB 2JP3A 4XRQA 4NPEA 1Q7YQ 2FHSC 3VRLC 3CCEP 3CCSP 2JU2A 1L4AD 1SP4A 3H1IG 3L73E 1RO2A 1BCCG 1GW3A 2FAEA 2LIUA 1WMKA 1DV5A 3O6QB 5TJHA 1BE3J 2K0YA 5F2NA 1SQBK 5GTHH 3L73D 5AW8B 1Z6MA 2B87B 1GL2B 4KHXA 1VQ5P 1IUQA 2FY8A 5GTHE 3HD7B 1ZRTD 5APWA 2ZYGA 2CNRA 1Y47A 2J58A 2NPSA 4OGQB 3OAKA 4PH1A 1K8AQ 2EHSA 1KILC 2ZXEB 1HGVA 4QMAA 1X0TA 5JPAA 3VP9A 4MN4C 1HTLC 1SQQE 2QE7H 3P8MC 1IMPA 3I56P 3RL0C 1BE3G 3LMOA 3H1KE 4COPA 3V6IA 5KLVK 4U3FD 2ROQA 1Q81Q 1SQQD 3S9OA 1F80D 3A0BH 4H0LB 5CCHA 1JY2P 1PP9D 2OYHC 3Q5PA 4H44D 5AW1B 1JMMA 1YYCA 1PPJE 1JO5A 1N73B 3L35A 2HODA 1FZCC 1X8YA 1L4AB 4PV1B 2N5IA 1U7MA 1DD4A 2JB0A 2FYNC 4KJMA 1D1DA 3BCCJ 3H1LE 1KQSO 3LRYA 1ZR4A 3AEEC 3FGAD 4PWVB 1R8EA 5KTBA 2I1KA 4M0IA 2CK3H 2M8NA 4GR2A 2PRRA 4TLFA 1VDFA 3H1LD 3L75J 3CX5H 2M8LA 2P7JA 1R5LA 3CX5E 2KXPB 4A7PA 1BDDA 1DEBA 2YXRB 2Z5HA 3B8EB 2WSEJ 3CX5D 2PEJA 2C9NY 4XFYA 3GHGA 3CCLP 3AEFC 4IFFA 3USSA 1L0LG 1EOQA 3IFMA 2A45G 2Y9ZA 1LTSC 1NO4A 3GJNA 3L75G 4R4MA 4JYCA 4TT3H 2AFEA 2WSSH 3KYQA 3O6QA 2PGDA 1JM0A 4H44B 3CLQA 2IYOA 1LTTC 1EDLA 2ERHA 1A02J 1EXIA 3HD7A 2P10A 4ZKUA 3E7KA 3WUVA 2N1TD 2KLUA 1JCDA 4GKGA 1JOCA 3EJDA 3F89A 1IO4A 3CX5I 3NXSA 1NOHA 3PHLA 1VQLP 2L5GB 3R2PA 3VMXA 2HLOA 2LXCB 2YMYA 2W6JH 2KW2A 2AEFA 5EJDA 1VL2A 2E74B 2ZXXA 2I1JA 4I7ZB 3EQ2A 1SQVE 3V2NA 2Q6QA 2XZRA 3DS5A 2KOOA 3P05A 4CA3A 3AE8C 1SQBE 1URQD 3AE2C 5GTIH 2E76C 4WVZA 3KXDA 1NU1E 5GTIE 1N73A 2M3BA 2NRGA 3E1IA 1KB9H 1L4AA 1VQ6P 4XFXA 2BEQD 3H1JE 3RK3E 1KTMA 3DS1A 2D2CD 1NU1D 5EFWB 1MUUA 1M7LA 1NKZB 3H1JD 3RK3D 4N78D 1L0NJ 1IFPA 3NFQA 1RY3A 3KDPB 3RG6C 1KB9D 2JYGA 3V2PA 1S5LE 2N9BA 2K9JB 5AVUB 4NEOA 5KAFH 2N1TB 2J59M 1NGMB 2WTYA 5KAFE 3TYYA 3N7NA 1M1JC 2GZJA 5APXA 3PLNA 5KJ7D 5AVSB 4NPFX 2KGEA 1LT9A 1HVVA 3AEBC 3G1GA 2M5AB 1L0LK 1ZP0C 3M06A 3P8CE 2PAJA 2N6ZA 3V5BA 5AW4B 4HJGH 1LGHB 2KG6A 3M9QA 3G9RA 2XZ1C 2AF8A 5CJ0A 3P8CD 4AQRD 2XU6A 1N7SC 2O01N 2J5UA 4I6MC 3CMAP 1PP9G 1VQ4P 1CI6B 1LTBC 2WSCH 1VF5B 2OTKE 3CCJP 4HKZH 3H1HD 5HGMA 5BS1A 1NTKE 2D2CB 2PEMA 4L76A 5E79H 4WWIA 3RK3B 1J1EC 2C0XA 2SPZA 3FX0A 1NTKD 2KOSA 5E79E 3L74E 3L70E 1NTME 2VRSA 3LIDA 1VQOP 1JY3N 5APYA 3L70D 1SLQA 5DJTB 1NTMD 2CQ8A 1RF1B 1ACPA 3RL0D 1QLED 3CWBJ 3KQGA 5HV8A 1IFDA 4Y99B 4WYMA 1NKNA 1H88A 2O01H 1JY3O 1X22A 1YIJP 3B5ND 3GLMA 1GD2E 3PP5A 3EJBA 2EG5A 2W90A 1VQPP 4RESB 2K1AA 3NY7B 2OQQA 2H89C 2PENA 1KD1Q 3L37A 5L8RJ 1CZQA 3H25A 2YO3A 1AVYA 2KOGA 4EYYQ 3W67A 2KWLA 2K9JA 3CWBG 3CCQP 2LOLA 2N1TA 2WWWA 3HE5B 4XA4A 1USDA 1BSHA 5APUA 1PFIA 1Q90D 1FAVA 1FOSF 4U0FA 1YTZI 2EHTA 4PJ0H 2NO8A 1L0NK 2I8DA 2M5AA 3AE9C 1AVOA 5B5EE 3B5IA 2BUOA 4AUWA 2XNDH 3AE7C 3RL0B 4L73A 3CL3D 4PD4E 2FFDB 1RE3C 5KLVJ 3L71J 2M3EA 5HGLA 1M56D 3B5NB 2MR8A 2KSJA 2DNWA 1Q82Q 2OYHB 2QJPC 1GZLA 3HTKB 2W27A 1LTIC 1UJZA 3C9IA 1FZCB 3CCVP 2KG8A 3QWOC 3GZLA 3Q2YA 2MKVA 3BCCE 2FYNB 1KV4A 1BDCA 1URQC 2JWAA 2WPRA 2ZYDA 1JTHB 2YKOA 2HPCB 3Q1MA 4F37A 1ZW0A 3L71G 1WRGA 2QVAA 3TGUE 3CD6P 2BCCD 2HR3A 2QSIA 5CJ4A 1RF1A 1VQ9P 1YBKA 4D6TD 3TGUD 2KSEA 5KJ7A 1OVRA 1SFCA 3CCMP 1SQXG 3IAOA 4JPZB 4PD4I 1RF0A 2Q9IA 1BXIA 2KUBA 2IBZE 1GPJA 4R0MA 2IX7C 5F2KA 1J1DB 5KP8B 1SQPJ 3MUDC 4C7RA 3H1IJ 1TU3F 2IBZD 1KN7A 2AXCA 2XNXA 5APVA 4CPGA 1H8AA 3D6YA 5AW9B 2FBWC 2ZVOB 1GXGA 2K0DX 1W2BO 3RBZA 1SVFA 2PEKA 3M9HA 3HE5A 3H1HG 2O1KA 2E43A 1FR2A 5APQA 4BRYB 1JY2N 1HGZA 1SQPG 1N2DC 3EWKA 2G3AA 5CBNA 3GKLC 1PV3A 1VHNA 1KILA 2L91A 4HH2A 1VQKP 1JUNA 2JJLA 3WBHA 5AVXB 4QNBA 2KK7A 3MGNA 1BGYJ 2M8PA 2IBZI 2FYZA 2GUVA 2JAZA 2LTEA 2V7QJ 1JY2O 4H2YC 2V4HA 3VOPA 2W6AA 3B71A 1RQUA 2O1JA 2WSFH 5AVYB 1PGJA 1HJ0A 1OR5A 3KZIE 3GF7A 2K92A 3AEDC 2E76B 1N7SD 2OYHA 1NTZJ 3B4SA 3HTKA 1RNIA 2JDIH 4C7NA 3D70A 1FZCA 2K9YA 3II6A 4XFZA 3IF4A 1BGYG 4COCA 2FFDC 1L0NE 1JTHA 1MFZA 1A8OA 2B88A 3B5NC 2KGAA 2QJKC 1HUCA 2Z44A 3H1KD 2R32A 4BPFA 2VSQA 2JQ4A 3CCUP 1T8KA 1NTZG 3PTZA 1SQXK 2AVAA 1AJYA 4JYBA 1PPJD 1IC2A 1M1JB 2MD9A 3F5HA 1WT6A 3L72E 3I5CA 2L9FA 2MVVA 2QG4A 1L0LJ 4ZMDA 1EC5A 2P58A 2L4BA 4PXHB 2O3JA 3L72D 2RMZA 3Q20A 5HGNA 4R4LA 2N6YA 2KYVA 2JU1A 2FVFA 2GA1A 1Q2NA 2KNCB 3I55P 4MRTC 1N7SB 2RKLA 1BAJA 1CSBA 3TDKA 2IFMA 2YIUB 2Y0EA 1ZR2A 1USEA 3D6ZA 1A43A 3Q5SA 1J1DC 3N4XA 4DOJA 4UB6H 1M6EX 3LW5H 1SQPK 1AV1A 1QEXA 4BXLA 4BRYA 1DH3A 4UB6E 1P84E 1OW7A 2POHA 2FYUJ 2FVAA 1J1EB 1XTCC 4JQ0D 4H2WC 1G1IA 2N9YB 3GMAA 2B87A 1GL2A 1AA0A 1RO0A 2BCCG 1D7MA 3H4EA 4QKOA 2M0BA 2GDWA 3KPEA 4W80A 4D6TG 5EW5E 2GZIA 1MV8A 3EJEA 4HKGA 1NAFA 2E75D 4YPCA 3T97B 2R3SA 2MVUA 4WY4D 5AW7B 1K9MQ 1BSNA 1X3OA 3WMM0 2KGDA 1RE4C 2FYUG 4I1LA 1ZV8A 5I4TG 3OA7A 2L0QA 2YXQB 2H43A 1YHQP 3L36A 2KI7B 1OVVA 4WB4A 2QJYB 1NWQA 1LP1B 3G0VA 1LTJC 4GDOA 1S72P 3K5BA 4IOIH 3L73J 3FXEA 4L75A 4GODA 1P84I 1M6NA 4Z1MH 2HFED 3CXHI 1SQVD 2B9BA 3G28A 1UIXA 3CC4P 1NTZK 1JNMA 3VP8A 1SQBD 3U1CA 1S5LX 1LJ2A 1M1JA 1T3JA 2CG5B 2KP8A 3EFGA 1EDIA 1S5LH 3TK1A 3KHUA 3DS2A 3BRVB 3L73G 2QRXA 4U0BA 4U3FJ 2FQ2A 2WPTA 1SQQJ 1T8ZA 1G1JA 5KLVE 1H89A 2A06E 1IFIA 5CCGC 2E75B 1AYIA 1PP9J 1UIIA 1N7SA 1KQGB 2QIWA 4L74A 1YJNP 5KLVD 2A06D 3PRJA 2LIWA 2OTJP 3AEAC 2QJPB 2QM8A 4IL6X 4LC1A 2N50A 1EZVE 2GDXA 4K3AA 3S1KA 4IL6H 1E79H 2FADA 4U3FG 1KMIZ 1SQQG 1URQB 4IL6E 2AXTH 3IR9A 3RG2A 3H1KG 2AXTE 1FBMA 4HB1A 3G29A 2YIUC 3FXDA 1ZMBA 2CGQA 2Y9YA 1LWUC 3IN6A 3JC22 4EOTA 4U0EA 1OW8A 3CMEP 2GZGA 3CCRP 2OARA 3T97A 4ZNCA 2YO2A 3RL0g 5B66E 2FYUK 1PGQA 2E1MA 2BQ1E 3Q5RA 2ZAEB 1HWTC 2KORA 3H1IE 4XFJA 3H1LG 2K3RA 2N5HA 3L74D 1LP1A 1L2PA 1KQLA 1BCCE 1HBWA 1M90Q 2PEQA 3A0HH 2CWOA 1DNYA 1L0HA 3H1ID 1EZVI 3H32B 3TF5A 3A0HE 4YXDC 1BCCD 4OWFA 1PZQA 5F2OA 5AW3B 4K35A 4IFDK 3TNUB 2BHVA 1AQTA 1T2KC 2IYPA 3P7KA 3RK2C 3AE6C 1DX7A 2QJYC 2ZFCA 2R44A 4HYTB 2LMLA 2EFJA 2H7HA 2NPSD 3BVHA 3JSVC 1K73Q 2PNGA 4PH0A 5KAIE 3SFEC 1BE3E 2B89A 1NYHA 3MGEA 4N6JA 2MF4A 5H2FH 1FU1A 1BE3D 2Q7CA 2ZVNB 4IFMA 3VMAA 2W8ZA 1GU4A 2ONTA 1RE3A 5H2FE 3SWYA 4ZKPA 2JO0A 2KS1B 1EXJA 1QVGO 2E42A 1NTZE 1HQBA 1IMQA 5B5EH 1N8RQ 1YQ4C 2ZT9C 1KFMA 1OWAA 2PP6A 4H13D 5CCHD 4PD4H 3H1JJ 2DW3A 2MY5A 3M0DC 2PEIA 1SQQK 2MR7A 5CZDB 1URQA 2E75C 4BPGA 4BWNA 1ZLLA 4WY4C 5AVZB 1FE6A 1CI6A 2QJKB 1SQVG 4PD4D 3U43A 1PGOA 2K0XA 1IFNA 1HF9A 1LTAC 2G8YA 1SQBG 3PH0A 4JF7A 4UHPB 3VMYA 1SQXJ 1OW6A 1R5SA 2LXBA 1JB0J 1RH5B 2LF4A 4DCKA 3CXCO 2NPSB 1NU1G 3HUSC 2WPVB 1Y9BA 2Z5IA 3H1JG 2A45H 3CI9A 1L0LE 3GW6A 3AE3C 2QEXP 3HZQA 3BCCD 2YNYA 3L75E 3MUDA 1IK7A 2HG5D 4ASVA 1L0LD 4YXWH 1YQ3C 3O8ZA 5AVQB 1J2JB 2K2QA 1EMVA 5HGOA 2XV5A 4RJTA 3H32A 3L75D 2WSEH 2QM7A 2P9XA 2YKQA 3BRTB 3H1HJ 4H13B 3TNUA 1AF8A 2R5BA 3AECC 5BU8B 5BVZA 1OMIA 5K5GB 3M0AA 2RH0A 1IJDB
chains in the Genus database with same CATH topology
3CC7P 1S72P 1VQOP 5HGLA 1IUQA 2PEJA 3NTEA 3OW2O 1N8RQ 2XT1A 3Q20A 5HGNA 1YITP 3DPHA 4GR6A 4U0EA 1M6NA 2L6EA 4XFYA 3CMEP 1Q82Q 1E6JP 1VQMP 1VQ8P 3CCLP 2OTLP 2XV6A 3RG6C 3CCRP 2OARA 2JYGA 3G28A 1EOQA 1JJ2O 2EIAA 4PH1A 1K8AQ 3CC4P 1VQ7P 1VQKP 1EIAA 3G71P 2PEIA 4WYMA 3G4SP 2E1MA 2BQ1E 5DCKA 3WBHA 3CCVP 3H47A 4QNBA 1M1KQ 3M1MA 2JYLA 3I55P 2M8PA 1AUMA 2KODA 1YIJP 1BAJA 5JPAA 1QVFO 4U0AA 1KC8Q 3DS0A 2EG5A 1PEUA 1VQPP 3CC2P 2Z45A 3I56P 2PEQA 1M90Q 1A43A 2CWOA 3HYBA 4COPA 2QA4P 1NJIQ 1M6EX 3DS2A 4U0CA 2PENA 3H0DA 1Q81Q 3CD6P 1PEMA 1KD1Q 1YJ9P 3G1GA 4U0BA 1QVGO 2LF4A 3CXCO 5F2OA 1VQ9P 1RNIA 1PEOA 4IPYA 2DGYA 2PY8A 3CCMP 3CCQP 2BHVA 3G21A 1VQLP 4XFZA 3DTJA 2QEXP 3HZQA 1YJNP 4COCA 1RO0A 3G26A 1PEQA 3DS3A 2XXMA 5F2KA 1M74A 3H4EA 3G6EP 2EFJA 3CMAP 1A8OA 1YJWP 1D1DA 1VQ4P 2OTJP 1KQSO 1K73Q 3LRYA 2Z44A 5HGOA 3CCJP 3DS4A 4PH0A 4XRQA 3DS5A 2P9XA 4U0FA 5HGMA 5BS1A 3P05A 4M0IA 2M8NA 4GR2A 4XROA 3CPWO 1Q7YQ 3MGEA 3VRLC 3CCEP 1K9MQ 2PEMA 3CCSP 1K30A 3CCUP 1Q86Q 3B5IA 2BUOA 1W2BO 2PEOA 2M8LA 5BS2A 1YI2P 5I4TG 2Z46A 1RO2A 2ONTA 2PEKA 4U0DA 1VQNP 1QRJA 1YHQP 3G1IA 3E2DA 5F2NA 3G0VA 3G29A 1VQ6P 4XFXA 2JO0A 3DS1A 1ZMBA 1VQ5P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 P;  1QVF O;  1S72 P;  1VQO P;  1YIJ P;  3CCM P;  3CCQ P;  1KC8 Q;  3CPW O;  3OW2 O;  1N8R Q;  1Q7Y Q;  1VQP P;  3CCE P;  1K9M Q;  3CCS P;  3CCU P;  1YIT P;  3CC2 P;  3I56 P;  1Q86 Q;  1M90 Q;  1VQL P;  3CME P;  1Q82 Q;  2QEX P;  1VQM P;  1W2B O;  1VQ8 P;  3CCL P;  1YJN P;  2OTL P;  3CCR P;  2QA4 P;  1YI2 P;  1NJI Q;  1JJ2 O;  1Q81 Q;  1VQN P;  1K8A Q;  3CC4 P;  3G6E P;  1YHQ P;  1VQ7 P;  3CD6 P;  1VQK P;  3CMA P;  3G71 P;  1KD1 Q;  3G4S P;  1YJ9 P;  1YJW P;  3CCV P;  1VQ4 P;  1QVG O;  2OTJ P;  1M1K Q;  3CXC O;  1KQS O;  1VQ6 P;  1K73 Q;  1VQ9 P;  3I55 P;  3CCJ P;  1VQ5 P; 
#chains in the Genus database with same CATH topology
 2LKM A;  3CC7 P;  4I2L C;  3MTU E;  3GF3 A;  4OGQ D;  2XDJ A;  3V4W A;  3U1A A;  4JBZ A;  1S2E A;  3L70 J;  1KYO H;  1VQ7 P;  1W2E A;  3G4S P;  2JKV A;  1KYO E;  1JEK A;  2Y0C A;  1FZG A;  2A45 I;  3RGU A;  1GW4 A;  2FXP A;  3DS0 A;  1KYO D;  2KS1 A;  2CPS A;  5CCG D;  1NTK G;  2VLQ A;  3FWL A;  4N3Y B;  5AVT B;  1ZNV A;  5TIS H;  1U57 A;  1NQ4 A;  4EIJ A;  1ZXG A;  3WUT A;  4IPY A;  3L74 G;  1DIP A;  5TIS E;  3L70 G;  2OYI C;  2KOQ A;  1FZB A;  1NTM G;  2FFD A;  4PV1 D;  3A2A A;  4B86 A;  1LTJ B;  3PJS K;  1H0T B;  3ZDM A;  1HJB A;  1OXZ A;  1T3U A;  3KZI H;  1SQV K;  3B5N A;  1ZRT E;  2KB7 P;  3B4Q A;  4GT1 A;  4GOE A;  1QX8 A;  1KQF B;  1AQ5 A;  2NZ2 A;  1NU1 K;  3VYI A;  1S9K E;  2KZJ A;  2K88 A;  1Q86 Q;  2C9L Y;  2XZ0 D;  1KYO I;  3GZM A;  1S9K D;  1LNQ A;  1JCC A;  2HPC A;  2L22 A;  2IZ1 A;  1FOS E;  3E2D A;  1X79 B;  2GYK A;  3SWK A;  4NPD A;  1L0N D;  4U3F E;  2AFD A;  1IFJ A;  1NAY A;  3FWN A;  1VPC A;  3MIW A;  2L6E A;  3Q3D A;  3AEG C;  3L4F A;  1PP9 E;  4UB8 H;  2JWD A;  2NPS C;  1DD3 A;  4UB8 E;  1MFT A;  4O9B A;  3W68 A;  1FJP A;  1FDI A;  1N86 A;  1AUM A;  1FDM A;  1QVF O;  3A0B E;  2H8P D;  1U7J A;  2WZ7 A;  3WU2 H;  2FXO A;  2ITA A;  3C1L A;  1T2K D;  2FAC A;  1KLP A;  2R3C A;  3H0D A;  3RK2 D;  3WU2 E;  2FKW B;  3AE5 C;  3RBX A;  3V2R A;  1PEO A;  1OVU A;  3OJA B;  2DGY A;  2BCC J;  1HY8 A;  1QL2 A;  2PY8 A;  4H13 C;  2X2B A;  5CCH C;  1GK6 A;  4D6T J;  5C39 A;  3TGU J;  2GUS A;  1M57 D;  2H88 C;  2WPQ A;  1T6A A;  2YKP A;  3G26 A;  2E74 D;  1P84 H;  1LWU B;  1NTK K;  3CXH H;  5CMZ A;  5APS A;  2LR2 A;  3CXH E;  1PGP A;  1N7L A;  4W7Z A;  1RE4 A;  3CPW O;  4XRO A;  3BCC G;  1LT9 B;  1P84 D;  1K30 A;  2IDB A;  2WT7 B;  3MZW B;  2ZT9 D;  3CXH D;  1NTM K;  3A3Y B;  1YI2 P;  2Z46 A;  1G2C B;  2W83 C;  1GDT A;  2PFX A;  1LTJ A;  1H0T A;  4IZ6 A;  5KKZ C;  1IK9 A;  3TGU G;  3CWB E;  1GU5 A;  1EDK A;  2KGC A;  2XKM A;  1RQV A;  7CEI A;  5M1B A;  3CWB D;  1QGK B;  1VQM P;  2UWJ E;  1FZF A;  2Q3E A;  5BU5 A;  3GHG C;  3G71 P;  1EDJ A;  2KLV A;  5DCK A;  2IBZ G;  3RK2 B;  1MZ9 A;  2FQ1 A;  4Y28 J;  2KOD A;  2IZ0 A;  2FVE A;  3M9B A;  1KC8 Q;  4EI2 A;  3CC2 P;  4XE5 B;  1K05 A;  3HYB A;  1NJI Q;  1GL2 C;  1ZN5 A;  4GOF A;  1PEM A;  1KOR A;  3HD7 C;  4ASW A;  5CCG A;  1NVO A;  1S1C X;  4OGQ C;  1OIP A;  2ZJS E;  3VN0 A;  4W7Y A;  3DTJ A;  2GDY A;  2JO1 A;  3BAT A;  2WSF J;  3BAS A;  2ZT9 B;  1M74 A;  1VF5 D;  2CPB A;  1L0I A;  1YTZ T;  4N78 E;  2GZE A;  3MD0 A;  1KB9 E;  3G3Z A;  1FZE A;  3L71 E;  2JEE A;  3H1K J;  5AW0 B;  4KT0 J;  5HVC A;  5CHX A;  4YTP C;  2KNC A;  3ITK A;  5KLI B;  2PEO A;  4WY4 B;  5BS2 A;  1FDO A;  4H0L C;  3L71 D;  1QRJ A;  1N73 C;  1SQX E;  1LT1 A;  2P67 A;  1LWU A;  2R5D A;  3V2Q A;  5AW5 B;  1L4A C;  4PV1 C;  3NTE A;  1KFN A;  1Y8A A;  2XT1 A;  1S3J A;  3H6P A;  2Z4E A;  1K04 A;  1SQX D;  4GR6 A;  3HUS B;  3JCU H;  1E6J P;  1HH0 A;  2OTL P;  3NMD A;  2XV6 A;  1UNK A;  1SFC D;  3L72 J;  1EZV D;  1JJ2 O;  1GK4 A;  3H1L J;  1AFO A;  2EIA A;  3JCU E;  1EIA A;  1IZN B;  2WT7 A;  4DG9 A;  1M1K Q;  1OZH A;  3M1M A;  1L0N G;  1E0H A;  1G2C A;  3C8V A;  1OFC X;  1SS1 A;  3A7O A;  4AYC A;  1GXH A;  1PEU A;  4GIF A;  3SSU A;  1PL5 A;  2GZF A;  2W6B A;  1RHZ B;  2JGP A;  5B66 H;  1KB9 I;  1PPJ G;  3U59 A;  3H1H E;  5APT A;  1LT9 C;  1M8O B;  1SQP E;  3L72 G;  1Z56 A;  4U7J A;  3G21 A;  4M3L A;  2Y0D A;  3TSI A;  2K5X A;  2E5Y A;  2JBG A;  3A5T A;  1SQP D;  3LW5 J;  1KIL E;  2BEZ F;  3MP7 B;  2OGU A;  2IPP A;  2MJZ A;  1A02 F;  5AVR B;  3AE4 C;  4H44 C;  2P2U A;  1KIL D;  2QNW A;  2K94 A;  2WQY C;  1X9V A;  1CW5 A;  2IFN A;  2N98 A;  1IFM A;  1VQN P;  3HE4 B;  1SFC B;  1ZME C;  3SWF A;  5KAI H;  3V4Q A;  5AW6 B;  4OH8 B;  1GMJ A;  1QL1 A;  3MHV A;  2V7Q H;  1BGY E;  1DEE G;  3UIA A;  2M8R A;  2E74 C;  1W5C E;  4H2X C;  2KR5 A;  4I7Z C;  3M0D A;  2OYI B;  3M91 A;  2LL8 A;  1BGY D;  2GM4 A;  1MKM A;  1SQV J;  5AVW B;  4WY4 A;  1E5W A;  2JYL A;  2KG9 A;  1SQB J;  5KP7 B;  2KIK A;  4U0A A;  4DZO A;  2Q1K A;  2M5R A;  3R4Y A;  4C46 A;  2AEJ A;  1NU1 J;  1FZA A;  1S4X A;  2ZYA A;  2QA4 P;  4LGD E;  1NTZ D;  4DJG A;  1GTW A;  1VKU A;  3HUS A;  1JY3 P;  2FQ0 A;  3GG2 A;  2AEM A;  1CEI A;  2RN0 A;  5KLI C;  4RKU J;  1KIL B;  2Q5U A;  1MZ8 A;  4PJ0 E;  2Q3I A;  1FC2 C;  3VTP C;  3NTN A;  2N1T C;  3DS3 A;  2OYO A;  1PIX A;  3G6E P;  5AVV B;  1NHL A;  2VLP A;  1EQ7 A;  2WMM A;  2BAS A;  1FS0 E;  5DJU B;  1KZU B;  4BPH A;  2HYN A;  4C7N B;  4U0D A;  2LKI A;  5KP6 B;  4RO0 A;  1FJK A;  3G1I A;  2KOP A;  3QH9 A;  1LTG C;  5AW2 B;  2FXM A;  1JMB A;  4WBA A;  3OW2 O;  2BCC E;  3AE1 C;  1YIT P;  3E1R A;  3DPH A;  5KLV G;  1OX3 A;  2A06 G;  2KZI A;  1VQ8 P;  4D6T E;  1XTG B;  1VF5 C;  3P32 A;  2LPK A;  2VLN A;  2WIT A;  2D2C C;  3H47 A;  1GL2 D;  4LLH A;  1ZOY C;  2P1J A;  2WSC J;  4EDF A;  2HOD B;  1NTK J;  3HD7 D;  3HE4 A;  3RK3 C;  2FYU E;  2K93 A;  3EFF K;  2Z45 A;  1NH4 A;  1EZV G;  2JR8 A;  3L74 J;  4U0C A;  2E76 D;  4DT0 A;  2FYU D;  1NTM J;  1YJ9 P;  3ABV C;  2OYI A;  1BCC J;  4OVN F;  3D71 A;  1RF1 C;  5KKZ B;  3S4R A;  2E5T A;  2VLO A;  5KJ7 C;  4Y99 C;  1SFC C;  2C0W A;  3HRN A;  3WUU A;  2WPS A;  3SFD C;  3LIE A;  1PEQ A;  2YMK A;  2XXM A;  1RF0 C;  4H0L D;  1YJW P;  5CBO A;  2WVR A;  2O01 J;  3VMZ A;  3DS4 A;  3CE7 A;  2K37 A;  3GHG B;  2JP3 A;  4XRQ A;  4NPE A;  1Q7Y Q;  2FHS C;  3VRL C;  3CCE P;  3CCS P;  2JU2 A;  1L4A D;  1SP4 A;  3H1I G;  3L73 E;  1RO2 A;  1BCC G;  1GW3 A;  2FAE A;  2LIU A;  1WMK A;  1DV5 A;  3O6Q B;  5TJH A;  1BE3 J;  2K0Y A;  5F2N A;  1SQB K;  5GTH H;  3L73 D;  5AW8 B;  1Z6M A;  2B87 B;  1GL2 B;  4KHX A;  1VQ5 P;  1IUQ A;  2FY8 A;  5GTH E;  3HD7 B;  1ZRT D;  5APW A;  2ZYG A;  2CNR A;  1Y47 A;  2J58 A;  2NPS A;  4OGQ B;  3OAK A;  4PH1 A;  1K8A Q;  2EHS A;  1KIL C;  2ZXE B;  1HGV A;  4QMA A;  1X0T A;  5JPA A;  3VP9 A;  4MN4 C;  1HTL C;  1SQQ E;  2QE7 H;  3P8M C;  1IMP A;  3I56 P;  3RL0 C;  1BE3 G;  3LMO A;  3H1K E;  4COP A;  3V6I A;  5KLV K;  4U3F D;  2ROQ A;  1Q81 Q;  1SQQ D;  3S9O A;  1F80 D;  3A0B H;  4H0L B;  5CCH A;  1JY2 P;  1PP9 D;  2OYH C;  3Q5P A;  4H44 D;  5AW1 B;  1JMM A;  1YYC A;  1PPJ E;  1JO5 A;  1N73 B;  3L35 A;  2HOD A;  1FZC C;  1X8Y A;  1L4A B;  4PV1 B;  2N5I A;  1U7M A;  1DD4 A;  2JB0 A;  2FYN C;  4KJM A;  1D1D A;  3BCC J;  3H1L E;  1KQS O;  3LRY A;  1ZR4 A;  3AEE C;  3FGA D;  4PWV B;  1R8E A;  5KTB A;  2I1K A;  4M0I A;  2CK3 H;  2M8N A;  4GR2 A;  2PRR A;  4TLF A;  1VDF A;  3H1L D;  3L75 J;  3CX5 H;  2M8L A;  2P7J A;  1R5L A;  3CX5 E;  2KXP B;  4A7P A;  1BDD A;  1DEB A;  2YXR B;  2Z5H A;  3B8E B;  2WSE J;  3CX5 D;  2PEJ A;  2C9N Y;  4XFY A;  3GHG A;  3CCL P;  3AEF C;  4IFF A;  3USS A;  1L0L G;  1EOQ A;  3IFM A;  2A45 G;  2Y9Z A;  1LTS C;  1NO4 A;  3GJN A;  3L75 G;  4R4M A;  4JYC A;  4TT3 H;  2AFE A;  2WSS H;  3KYQ A;  3O6Q A;  2PGD A;  1JM0 A;  4H44 B;  3CLQ A;  2IYO A;  1LTT C;  1EDL A;  2ERH A;  1A02 J;  1EXI A;  3HD7 A;  2P10 A;  4ZKU A;  3E7K A;  3WUV A;  2N1T D;  2KLU A;  1JCD A;  4GKG A;  1JOC A;  3EJD A;  3F89 A;  1IO4 A;  3CX5 I;  3NXS A;  1NOH A;  3PHL A;  1VQL P;  2L5G B;  3R2P A;  3VMX A;  2HLO A;  2LXC B;  2YMY A;  2W6J H;  2KW2 A;  2AEF A;  5EJD A;  1VL2 A;  2E74 B;  2ZXX A;  2I1J A;  4I7Z B;  3EQ2 A;  1SQV E;  3V2N A;  2Q6Q A;  2XZR A;  3DS5 A;  2KOO A;  3P05 A;  4CA3 A;  3AE8 C;  1SQB E;  1URQ D;  3AE2 C;  5GTI H;  2E76 C;  4WVZ A;  3KXD A;  1NU1 E;  5GTI E;  1N73 A;  2M3B A;  2NRG A;  3E1I A;  1KB9 H;  1L4A A;  1VQ6 P;  4XFX A;  2BEQ D;  3H1J E;  3RK3 E;  1KTM A;  3DS1 A;  2D2C D;  1NU1 D;  5EFW B;  1MUU A;  1M7L A;  1NKZ B;  3H1J D;  3RK3 D;  4N78 D;  1L0N J;  1IFP A;  3NFQ A;  1RY3 A;  3KDP B;  3RG6 C;  1KB9 D;  2JYG A;  3V2P A;  1S5L E;  2N9B A;  2K9J B;  5AVU B;  4NEO A;  5KAF H;  2N1T B;  2J59 M;  1NGM B;  2WTY A;  5KAF E;  3TYY A;  3N7N A;  1M1J C;  2GZJ A;  5APX A;  3PLN A;  5KJ7 D;  5AVS B;  4NPF X;  2KGE A;  1LT9 A;  1HVV A;  3AEB C;  3G1G A;  2M5A B;  1L0L K;  1ZP0 C;  3M06 A;  3P8C E;  2PAJ A;  2N6Z A;  3V5B A;  5AW4 B;  4HJG H;  1LGH B;  2KG6 A;  3M9Q A;  3G9R A;  2XZ1 C;  2AF8 A;  5CJ0 A;  3P8C D;  4AQR D;  2XU6 A;  1N7S C;  2O01 N;  2J5U A;  4I6M C;  3CMA P;  1PP9 G;  1VQ4 P;  1CI6 B;  1LTB C;  2WSC H;  1VF5 B;  2OTK E;  3CCJ P;  4HKZ H;  3H1H D;  5HGM A;  5BS1 A;  1NTK E;  2D2C B;  2PEM A;  4L76 A;  5E79 H;  4WWI A;  3RK3 B;  1J1E C;  2C0X A;  2SPZ A;  3FX0 A;  1NTK D;  2KOS A;  5E79 E;  3L74 E;  3L70 E;  1NTM E;  2VRS A;  3LID A;  1VQO P;  1JY3 N;  5APY A;  3L70 D;  1SLQ A;  5DJT B;  1NTM D;  2CQ8 A;  1RF1 B;  1ACP A;  3RL0 D;  1QLE D;  3CWB J;  3KQG A;  5HV8 A;  1IFD A;  4Y99 B;  4WYM A;  1NKN A;  1H88 A;  2O01 H;  1JY3 O;  1X22 A;  1YIJ P;  3B5N D;  3GLM A;  1GD2 E;  3PP5 A;  3EJB A;  2EG5 A;  2W90 A;  1VQP P;  4RES B;  2K1A A;  3NY7 B;  2OQQ A;  2H89 C;  2PEN A;  1KD1 Q;  3L37 A;  5L8R J;  1CZQ A;  3H25 A;  2YO3 A;  1AVY A;  2KOG A;  4EYY Q;  3W67 A;  2KWL A;  2K9J A;  3CWB G;  3CCQ P;  2LOL A;  2N1T A;  2WWW A;  3HE5 B;  4XA4 A;  1USD A;  1BSH A;  5APU A;  1PFI A;  1Q90 D;  1FAV A;  1FOS F;  4U0F A;  1YTZ I;  2EHT A;  4PJ0 H;  2NO8 A;  1L0N K;  2I8D A;  2M5A A;  3AE9 C;  1AVO A;  5B5E E;  3B5I A;  2BUO A;  4AUW A;  2XND H;  3AE7 C;  3RL0 B;  4L73 A;  3CL3 D;  4PD4 E;  2FFD B;  1RE3 C;  5KLV J;  3L71 J;  2M3E A;  5HGL A;  1M56 D;  3B5N B;  2MR8 A;  2KSJ A;  2DNW A;  1Q82 Q;  2OYH B;  2QJP C;  1GZL A;  3HTK B;  2W27 A;  1LTI C;  1UJZ A;  3C9I A;  1FZC B;  3CCV P;  2KG8 A;  3QWO C;  3GZL A;  3Q2Y A;  2MKV A;  3BCC E;  2FYN B;  1KV4 A;  1BDC A;  1URQ C;  2JWA A;  2WPR A;  2ZYD A;  1JTH B;  2YKO A;  2HPC B;  3Q1M A;  4F37 A;  1ZW0 A;  3L71 G;  1WRG A;  2QVA A;  3TGU E;  3CD6 P;  2BCC D;  2HR3 A;  2QSI A;  5CJ4 A;  1RF1 A;  1VQ9 P;  1YBK A;  4D6T D;  3TGU D;  2KSE A;  5KJ7 A;  1OVR A;  1SFC A;  3CCM P;  1SQX G;  3IAO A;  4JPZ B;  4PD4 I;  1RF0 A;  2Q9I A;  1BXI A;  2KUB A;  2IBZ E;  1GPJ A;  4R0M A;  2IX7 C;  5F2K A;  1J1D B;  5KP8 B;  1SQP J;  3MUD C;  4C7R A;  3H1I J;  1TU3 F;  2IBZ D;  1KN7 A;  2AXC A;  2XNX A;  5APV A;  4CPG A;  1H8A A;  3D6Y A;  5AW9 B;  2FBW C;  2ZVO B;  1GXG A;  2K0D X;  1W2B O;  3RBZ A;  1SVF A;  2PEK A;  3M9H A;  3HE5 A;  3H1H G;  2O1K A;  2E43 A;  1FR2 A;  5APQ A;  4BRY B;  1JY2 N;  1HGZ A;  1SQP G;  1N2D C;  3EWK A;  2G3A A;  5CBN A;  3GKL C;  1PV3 A;  1VHN A;  1KIL A;  2L91 A;  4HH2 A;  1VQK P;  1JUN A;  2JJL A;  3WBH A;  5AVX B;  4QNB A;  2KK7 A;  3MGN A;  1BGY J;  2M8P A;  2IBZ I;  2FYZ A;  2GUV A;  2JAZ A;  2LTE A;  2V7Q J;  1JY2 O;  4H2Y C;  2V4H A;  3VOP A;  2W6A A;  3B71 A;  1RQU A;  2O1J A;  2WSF H;  5AVY B;  1PGJ A;  1HJ0 A;  1OR5 A;  3KZI E;  3GF7 A;  2K92 A;  3AED C;  2E76 B;  1N7S D;  2OYH A;  1NTZ J;  3B4S A;  3HTK A;  1RNI A;  2JDI H;  4C7N A;  3D70 A;  1FZC A;  2K9Y A;  3II6 A;  4XFZ A;  3IF4 A;  1BGY G;  4COC A;  2FFD C;  1L0N E;  1JTH A;  1MFZ A;  1A8O A;  2B88 A;  3B5N C;  2KGA A;  2QJK C;  1HUC A;  2Z44 A;  3H1K D;  2R32 A;  4BPF A;  2VSQ A;  2JQ4 A;  3CCU P;  1T8K A;  1NTZ G;  3PTZ A;  1SQX K;  2AVA A;  1AJY A;  4JYB A;  1PPJ D;  1IC2 A;  1M1J B;  2MD9 A;  3F5H A;  1WT6 A;  3L72 E;  3I5C A;  2L9F A;  2MVV A;  2QG4 A;  1L0L J;  4ZMD A;  1EC5 A;  2P58 A;  2L4B A;  4PXH B;  2O3J A;  3L72 D;  2RMZ A;  3Q20 A;  5HGN A;  4R4L A;  2N6Y A;  2KYV A;  2JU1 A;  2FVF A;  2GA1 A;  1Q2N A;  2KNC B;  3I55 P;  4MRT C;  1N7S B;  2RKL A;  1BAJ A;  1CSB A;  3TDK A;  2IFM A;  2YIU B;  2Y0E A;  1ZR2 A;  1USE A;  3D6Z A;  1A43 A;  3Q5S A;  1J1D C;  3N4X A;  4DOJ A;  4UB6 H;  1M6E X;  3LW5 H;  1SQP K;  1AV1 A;  1QEX A;  4BXL A;  4BRY A;  1DH3 A;  4UB6 E;  1P84 E;  1OW7 A;  2POH A;  2FYU J;  2FVA A;  1J1E B;  1XTC C;  4JQ0 D;  4H2W C;  1G1I A;  2N9Y B;  3GMA A;  2B87 A;  1GL2 A;  1AA0 A;  1RO0 A;  2BCC G;  1D7M A;  3H4E A;  4QKO A;  2M0B A;  2GDW A;  3KPE A;  4W80 A;  4D6T G;  5EW5 E;  2GZI A;  1MV8 A;  3EJE A;  4HKG A;  1NAF A;  2E75 D;  4YPC A;  3T97 B;  2R3S A;  2MVU A;  4WY4 D;  5AW7 B;  1K9M Q;  1BSN A;  1X3O A;  3WMM 0;  2KGD A;  1RE4 C;  2FYU G;  4I1L A;  1ZV8 A;  5I4T G;  3OA7 A;  2L0Q A;  2YXQ B;  2H43 A;  1YHQ P;  3L36 A;  2KI7 B;  1OVV A;  4WB4 A;  2QJY B;  1NWQ A;  1LP1 B;  3G0V A;  1LTJ C;  4GDO A;  1S72 P;  3K5B A;  4IOI H;  3L73 J;  3FXE A;  4L75 A;  4GOD A;  1P84 I;  1M6N A;  4Z1M H;  2HFE D;  3CXH I;  1SQV D;  2B9B A;  3G28 A;  1UIX A;  3CC4 P;  1NTZ K;  1JNM A;  3VP8 A;  1SQB D;  3U1C A;  1S5L X;  1LJ2 A;  1M1J A;  1T3J A;  2CG5 B;  2KP8 A;  3EFG A;  1EDI A;  1S5L H;  3TK1 A;  3KHU A;  3DS2 A;  3BRV B;  3L73 G;  2QRX A;  4U0B A;  4U3F J;  2FQ2 A;  2WPT A;  1SQQ J;  1T8Z A;  1G1J A;  5KLV E;  1H89 A;  2A06 E;  1IFI A;  5CCG C;  2E75 B;  1AYI A;  1PP9 J;  1UII A;  1N7S A;  1KQG B;  2QIW A;  4L74 A;  1YJN P;  5KLV D;  2A06 D;  3PRJ A;  2LIW A;  2OTJ P;  3AEA C;  2QJP B;  2QM8 A;  4IL6 X;  4LC1 A;  2N50 A;  1EZV E;  2GDX A;  4K3A A;  3S1K A;  4IL6 H;  1E79 H;  2FAD A;  4U3F G;  1KMI Z;  1SQQ G;  1URQ B;  4IL6 E;  2AXT H;  3IR9 A;  3RG2 A;  3H1K G;  2AXT E;  1FBM A;  4HB1 A;  3G29 A;  2YIU C;  3FXD A;  1ZMB A;  2CGQ A;  2Y9Y A;  1LWU C;  3IN6 A;  3JC2 2;  4EOT A;  4U0E A;  1OW8 A;  3CME P;  2GZG A;  3CCR P;  2OAR A;  3T97 A;  4ZNC A;  2YO2 A;  3RL0 g;  5B66 E;  2FYU K;  1PGQ A;  2E1M A;  2BQ1 E;  3Q5R A;  2ZAE B;  1HWT C;  2KOR A;  3H1I E;  4XFJ A;  3H1L G;  2K3R A;  2N5H A;  3L74 D;  1LP1 A;  1L2P A;  1KQL A;  1BCC E;  1HBW A;  1M90 Q;  2PEQ A;  3A0H H;  2CWO A;  1DNY A;  1L0H A;  3H1I D;  1EZV I;  3H32 B;  3TF5 A;  3A0H E;  4YXD C;  1BCC D;  4OWF A;  1PZQ A;  5F2O A;  5AW3 B;  4K35 A;  4IFD K;  3TNU B;  2BHV A;  1AQT A;  1T2K C;  2IYP A;  3P7K A;  3RK2 C;  3AE6 C;  1DX7 A;  2QJY C;  2ZFC A;  2R44 A;  4HYT B;  2LML A;  2EFJ A;  2H7H A;  2NPS D;  3BVH A;  3JSV C;  1K73 Q;  2PNG A;  4PH0 A;  5KAI E;  3SFE C;  1BE3 E;  2B89 A;  1NYH A;  3MGE A;  4N6J A;  2MF4 A;  5H2F H;  1FU1 A;  1BE3 D;  2Q7C A;  2ZVN B;  4IFM A;  3VMA A;  2W8Z A;  1GU4 A;  2ONT A;  1RE3 A;  5H2F E;  3SWY A;  4ZKP A;  2JO0 A;  2KS1 B;  1EXJ A;  1QVG O;  2E42 A;  1NTZ E;  1HQB A;  1IMQ A;  5B5E H;  1N8R Q;  1YQ4 C;  2ZT9 C;  1KFM A;  1OWA A;  2PP6 A;  4H13 D;  5CCH D;  4PD4 H;  3H1J J;  2DW3 A;  2MY5 A;  3M0D C;  2PEI A;  1SQQ K;  2MR7 A;  5CZD B;  1URQ A;  2E75 C;  4BPG A;  4BWN A;  1ZLL A;  4WY4 C;  5AVZ B;  1FE6 A;  1CI6 A;  2QJK B;  1SQV G;  4PD4 D;  3U43 A;  1PGO A;  2K0X A;  1IFN A;  1HF9 A;  1LTA C;  2G8Y A;  1SQB G;  3PH0 A;  4JF7 A;  4UHP B;  3VMY A;  1SQX J;  1OW6 A;  1R5S A;  2LXB A;  1JB0 J;  1RH5 B;  2LF4 A;  4DCK A;  3CXC O;  2NPS B;  1NU1 G;  3HUS C;  2WPV B;  1Y9B A;  2Z5I A;  3H1J G;  2A45 H;  3CI9 A;  1L0L E;  3GW6 A;  3AE3 C;  2QEX P;  3HZQ A;  3BCC D;  2YNY A;  3L75 E;  3MUD A;  1IK7 A;  2HG5 D;  4ASV A;  1L0L D;  4YXW H;  1YQ3 C;  3O8Z A;  5AVQ B;  1J2J B;  2K2Q A;  1EMV A;  5HGO A;  2XV5 A;  4RJT A;  3H32 A;  3L75 D;  2WSE H;  2QM7 A;  2P9X A;  2YKQ A;  3BRT B;  3H1H J;  4H13 B;  3TNU A;  1AF8 A;  2R5B A;  3AEC C;  5BU8 B;  5BVZ A;  1OMI A;  5K5G B;  3M0A A;  2RH0 A;  1IJD B; 
#chains in the Genus database with same CATH homology
 3CC7 P;  1S72 P;  1VQO P;  5HGL A;  1IUQ A;  2PEJ A;  3NTE A;  3OW2 O;  1N8R Q;  2XT1 A;  3Q20 A;  5HGN A;  1YIT P;  3DPH A;  4GR6 A;  4U0E A;  1M6N A;  2L6E A;  4XFY A;  3CME P;  1Q82 Q;  1E6J P;  1VQM P;  1VQ8 P;  3CCL P;  2OTL P;  2XV6 A;  3RG6 C;  3CCR P;  2OAR A;  2JYG A;  3G28 A;  1EOQ A;  1JJ2 O;  2EIA A;  4PH1 A;  1K8A Q;  3CC4 P;  1VQ7 P;  1VQK P;  1EIA A;  3G71 P;  2PEI A;  4WYM A;  3G4S P;  2E1M A;  2BQ1 E;  5DCK A;  3WBH A;  3CCV P;  3H47 A;  4QNB A;  1M1K Q;  3M1M A;  2JYL A;  3I55 P;  2M8P A;  1AUM A;  2KOD A;  1YIJ P;  1BAJ A;  5JPA A;  1QVF O;  4U0A A;  1KC8 Q;  3DS0 A;  2EG5 A;  1PEU A;  1VQP P;  3CC2 P;  2Z45 A;  3I56 P;  2PEQ A;  1M90 Q;  1A43 A;  2CWO A;  3HYB A;  4COP A;  2QA4 P;  1NJI Q;  1M6E X;  3DS2 A;  4U0C A;  2PEN A;  3H0D A;  1Q81 Q;  3CD6 P;  1PEM A;  1KD1 Q;  1YJ9 P;  3G1G A;  4U0B A;  1QVG O;  2LF4 A;  3CXC O;  5F2O A;  1VQ9 P;  1RNI A;  1PEO A;  4IPY A;  2DGY A;  2PY8 A;  3CCM P;  3CCQ P;  2BHV A;  3G21 A;  1VQL P;  4XFZ A;  3DTJ A;  2QEX P;  3HZQ A;  1YJN P;  4COC A;  1RO0 A;  3G26 A;  1PEQ A;  3DS3 A;  2XXM A;  5F2K A;  1M74 A;  3H4E A;  3G6E P;  2EFJ A;  3CMA P;  1A8O A;  1YJW P;  1D1D A;  1VQ4 P;  2OTJ P;  1KQS O;  1K73 Q;  3LRY A;  2Z44 A;  5HGO A;  3CCJ P;  3DS4 A;  4PH0 A;  4XRQ A;  3DS5 A;  2P9X A;  4U0F A;  5HGM A;  5BS1 A;  3P05 A;  4M0I A;  2M8N A;  4GR2 A;  4XRO A;  3CPW O;  1Q7Y Q;  3MGE A;  3VRL C;  3CCE P;  1K9M Q;  2PEM A;  3CCS P;  1K30 A;  3CCU P;  1Q86 Q;  3B5I A;  2BUO A;  1W2B O;  2PEO A;  2M8L A;  5BS2 A;  1YI2 P;  5I4T G;  2Z46 A;  1RO2 A;  2ONT A;  2PEK A;  4U0D A;  1VQN P;  1QRJ A;  1YHQ P;  3G1I A;  3E2D A;  5F2N A;  3G0V A;  3G29 A;  1VQ6 P;  4XFX A;  2JO0 A;  3DS1 A;  1ZMB A;  1VQ5 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...