3G6EP

Co-crystal structure of homoharringtonine bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g6eP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g6eP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g6eP02
1Q82Q 3CCLP 1YITP 3CPWO 1YJ9P 1YJWP 1YJNP 1QVFO 3G71P 3OW2O 1VQ6P 3CMAP 3CC2P 1S72P 3CC7P 1VQLP 3CC4P 3CCRP 3CCSP 1KC8Q 1W2BO 3CCMP 1YHQP 3G6EP 1VQ7P 1VQ9P 3I56P 3CCQP 1K73Q 1VQ4P 3CMEP 1Q81Q 1VQ8P 1M90Q 3CCUP 3I55P 1QVGO 1KD1Q 1VQKP 1VQPP 3CCVP 3CXCO 3CD6P 3CCJP 1VQMP 2OTJP 1YI2P 2OTLP 3CCEP 1VQ5P 1K8AQ 1YIJP 2QEXP 1Q7YQ 1N8RQ 1NJIQ 1Q86Q 1K9MQ 3G4SP 2QA4P 1M1KQ 1VQNP 1VQOP 1JJ2O 1KQSO
chains in the Genus database with same CATH superfamily
2W8ZA 1YITP 4PD4D 1K05A 2WPTA 5APSA 3P32A 1H0TB 2BEZF 1RQVA 3FX0A 4OVNF 1N7SA 4PH1A 3CL3D 1K73Q 4COPA 2M5AB 2LXCB 3Q20A 3MUDC 1PGJA 1IK7A 1PP9D 3H1HD 1K30A 5DJUB 3RL0g 3MGEA 4XE5B 3B5NA 1SQPK 2HPCB 3LMOA 3PJSK 5KAFE 2PNGA 4U7JA 1FZCA 2PEIA 1F80D 4OGQB 5F2OA 4U0FA 4U3FD 1NTZE 4XFJA 3VTPC 2AXTH 2FKWB 4TLFA 1XTGB 1FJKA 1OW7A 2Q3IA 2KGEA 1DD3A 4LGDE 1OVRA 4C7NB 2K93A 1FJPA 2H8PD 1RE4A 1BE3E 4L74A 4L73A 1FE6A 1QGKB 2IX7C 4ZMDA 1KB9D 2N5IA 2C9NY 3A0HE 2E75B 1SQVE 3MUDA 2K0XA 4IFMA 1PIXA 1JMMA 5BS2A 1EC5A 3U59A 1SFCD 1URQA 3H25A 3L72D 2OGUA 5TJHA 3P8CD 3CX5D 4UB6H 1S9KD 1AA0A 5HVCA 2IBZD 1S1CX 1JMBA 1LWUC 2X2BA 2JWAA 1NU1G 2P67A 1LTSC 1EZVI 3JCUE 2JDIH 1L4AC 2JR8A 4PV1D 2B9BA 3RK3D 2HFED 1S72P 5APVA 1LT9A 1EDLA 1Q81Q 4I2LC 1MV8A 3CXHD 3SWYA 1TU3F 3GHGB 4R4MA 3HRNA 1A43A 3SFDC 3DS3A 1LNQA 2XU6A 4IPYA 3H1IE 2FY8A 3LRYA 3SSUA 2M8PA 2XKMA 1VF5D 1AFOA 2NO8A 1LWUA 1DH3A 4BXLA 1SFCB 2H89C 2W6JH 3CCJP 3MIWA 4JYCA 3AEAC 3B4QA 5AVQB 2OARA 3H1KJ 2SPZA 1GD2E 3MD0A 2NPSA 3MZWB 1QVFO 2R44A 1A02F 2YXQB 1BSNA 2WVRA 3AE6C 1OIPA 1KILD 2JO0A 5APXA 1VQ8P 1U7MA 3CCVP 1BGYG 1SQXE 2ZVOB 4PV1B 5TISE 3L70J 2YO2A 2CPSA 1T6AA 3H1LD 3DS0A 2E5TA 4PH0A 1X22A 1AF8A 3CCSP 2WSFH 5BU5A 2J5UA 1RHZB 2Z4EA 1S2EA 3C1LA 2GM4A 2QVAA 5CZDB 1J1EB 3KHUA 3H1JD 4WY4D 1VF5B 2O3JA 3RK2D 3PH0A 3NXSA 1NYHA 1SQQD 1M90Q 4N78E 4M0IA 2GZIA 2GZEA 5AVTB 2M8LA 2K5XA 1LWUB 5H2FE 5KJ7D 2ZYDA 1EZVD 1S5LX 1XTCC 4XA4A 1PGOA 1N73C 5EJDA 2EFJA 1L4AB 5CCGD 1HGVA 3VOPA 1AVOA 2PEQA 1FBMA 2FVFA 2K94A 2FVEA 5E79E 5HGNA 4D6TJ 4DT0A 1LP1B 1T2KC 2K2QA 1K8AQ 1N2DC 4NPDA 3H0DA 1FR2A 5AW6B 2QJKC 3CI9A 4H2WC 4Y99B 1IJDB 4F37A 2Q3EA 4EDFA 2B87B 3E1IA 3N4XA 1IFNA 2AXCA 3CCQP 4YXDC 1A8OA 1J1DB 1M1KQ 2I1KA 1N73A 5CCHC 1CI6B 3DS2A 1X0TA 5APYA 1JO5A 5AW2B 1YQ3C 3M9QA 1NU1E 2KOGA 3RL0D 4ZKUA 2Q5UA 3EFGA 2KK7A 2O01J 3HD7C 3HE4A 1L0LG 1SP4A 4I7ZC 1JY3P 2N9YB 5KLVD 1FZGA 2V7QJ 5BVZA 1KC8Q 2PEKA 3QH9A 2EG5A 2HR3A 3M9BA 5HV8A 4CA3A 1YI2P 4UB6E 2ZYAA 2IYOA 4DJGA 3TNUB 3V2PA 3NMDA 4C46A 3NTNA 3L37A 1UIXA 2H88C 4H0LC 3E2DA 3HE5A 1VKUA 3CCMP 4Y28J 2GDYA 3HZQA 1G2CB 2KG6A 4BRYA 1GXGA 1PP9G 2Q6QA 1G1JA 2MKVA 3H1HG 2ROQA 3TGUJ 4KT0J 2ZVNB 2QEXP 2OYHA 1Q86Q 3II6A 2KNCA 3R2PA 2MD9A 1ZMEC 1HVVA 2N1TC 1JTHA 1IK9A 1OW8A 2QE7H 3GZLA 3A0HH 1P84D 2Y0EA 1N73B 3TF5A 2WZ7A 4U3FG 2QSIA 2AVAA 4DOJA 3CWBD 1BGYE 1IFIA 1JY2O 2PEJA 2KODA 2XDJA 2GZFA 2WPSA 1GW3A 2IFMA 5CJ4A 1OFCX 3CPWO 3LW5H 2A45I 2R3CA 2QJKB 1HF9A 2KS1B 2FXPA 2WT7A 3G1GA 2KOQA 2C9LY 3IAOA 2MY5A 2FFDC 1Z6MA 2FYUK 1PZQA 1VQKP 3CD6P 7CEIA 1T3UA 1Q7YQ 1L0NK 2AF8A 4GIFA 3O8ZA 2KGCA 2ERHA 3F5HA 2IBZG 3FGAD 1PP9J 2FACA 2GUVA 3H1HJ 2MVVA 3V2QA 5F2KA 3AE8C 2K0YA 2N1TD 2YIUB 1QX8A 3A0BE 5AVSB 3C9IA 2RKLA 2WITA 4JPZB 3H32A 3U1AA 4XFZA 2P9XA 1YTZT 1SQPG 1JUNA 4U3FJ 1FZFA 2KWLA 3HD7B 2A06D 1YJNP 4I7ZB 2K37A 1NO4A 2VLOA 2MF4A 1OR5A 4OGQC 2WSEJ 1E0HA 5KP8B 2WPQA 4H44C 5HGLA 2LL8A 2J58A 4XFYA 3L74G 4JF7A 3B4SA 1W2EA 3AEEC 3WBHA 1JJ2O 2R32A 1H0TA 2L4BA 1DEEG 4EI2A 2M5AA 2FYUD 1KQLA 4H0LB 2AEMA 1KYOH 3L72J 2E75C 1WT6A 3L73D 2MR7A 4HKGA 1W5CE 2JWDA 1GZLA 1L0ND 1ZR2A 1YIJP 3FWNA 3T97B 2HPCA 2N1TB 3USSA 3H47A 5GTHH 2BCCD 4EYYQ 3A3YB 1AQTA 3H1LG 3PLNA 4C7NA 1SQBD 2CPBA 4IL6X 4RESB 4NPEA 3LIEA 1GTWA 1SLQA 3KYQA 2N50A 3CCRP 5H2FH 3GZMA 2FFDB 3AE2C 2BHVA 4PD4E 3H6PA 3GHGC 4N6JA 2FBWC 1LT1A 3KXDA 3L35A 2W83C 1IFMA 5E79H 5B5EH 1PP9E 1RQUA 3H1HE 1SFCC 1HUCA 4IZ6A 1PL5A 2G3AA 3GKLC 2OTKE 2BEQD 3ITKA 2KSJA 1PGPA 2AFDA 3RGUA 4U3FE 2HYNA 5JPAA 3V2NA 1YQ4C 3H1LJ 1NKNA 2YMYA 3AEDC 1W2BO 1M8OB 1NGMB 3K5BA 3GHGA 3IF4A 3IN6A 1RF1B 2YKOA 4H44B 4PV1C 2DNWA 1K9MQ 3RK3C 1KB9E 4L76A 1ZRTD 1PEUA 1EMVA 4NPFX 2EIAA 1HWTC 1GMJA 2O01N 2PEMA 1EDKA 1U57A 2R5BA 4HH2A 3H1JJ 1PEOA 1SFCA 1VQLP 1ZMBA 1Z56A 2YXRB 4GR2A 1LTJB 2KP8A 2N6YA 3S4RA 3B5ND 3OA7A 1VQMP 2FVAA 2OYOA 2OTLP 3P8CE 3CX5E 3HUSC 1J1EC 2WPRA 2VLNA 1SQQJ 4JYBA 2IBZE 2LXBA 2M3EA 3G26A 1VF5C 1R8EA 1KYOI 1ZN5A 2JP3A 4DZOA 2YO3A 1IFDA 4I1LA 3H1KG 3PHLA 4M3LA 1LTIC 2JO1A 1HTLC 4AUWA 1SQPE 5CBNA 1BE3D 4IOIH 2K3RA 1FOSE 2K0DX 2L9FA 1SQVD 1KILC 3A2AA 3CXHE 4DCKA 1FAVA 1G1IA 1URQD 3L70G 2E74D 1YHQP 2GA1A 1AYIA 3L74E 4GR6A 1RY3A 1GDTA 3AE7C 3LIDA 1EXIA 1MZ8A 2K88A 4Y99C 1Q82Q 3RG2A 2KORA 2KLUA 1ZOYC 1LTBC 1QVGO 5AVYB 4WY4C 3CXCO 1LGHB 2HODB 1J1DC 5B66H 1SQQK 3RK2C 1JY2P 1L4AA 2E1MA 1HY8A 1KILE 1KMIZ 2M0BA 1GPJA 3G28A 2W6BA 3AECC 2Q1KA 3FXDA 3DS1A 1EXJA 3BRVB 3WU2H 1LP1A 2Q7CA 5KJ7C 5KLVJ 1KN7A 4OH8B 2LTEA 3H1LE 3V2RA 3H1ID 1RF0C 3CCEP 2FYZA 1KYOE 5CCGC 2CK3H 3RK3B 2B87A 3O6QB 4D6TG 2E74B 3A0BH 2GUSA 2P1JA 1NTKK 2ZT9D 2M8NA 2NPSD 1ZV8A 3WMM0 1N7LA 2O01H 1ZNVA 1CI6A 1E6JP 5AW7B 4EIJA 1JY3N 1IZNB 3HUSB 5GTHE 1AUMA 3KQGA 1SQQE 5DJTB 2V7QH 1SQXD 2KW2A 5HGMA 2HG5D 5F2NA 2P2UA 3GF3A 4RO0A 1VQ9P 3TK1A 4H13D 1OX3A 3CWBJ 2W6AA 1OVUA 2A06G 5KLIC 3VYIA 2GZGA 1VQNP 4BPHA 1BCCD 2D2CD 1HGZA 4ZKPA 1ZW0A 4PJ0E 1IMQA 3RL0C 1KILB 4YTPC 5KLVK 1IMPA 3UIAA 1HQBA 1KFMA 2JB0A 1Q2NA 1J2JB 2YKQA 1JEKA 1VQPP 4JQ0D 3GF7A 2KZIA 5B5EE 3TNUA 4CPGA 2FQ1A 5AVXB 1VQOP 4HKZH 2FYUG 1PFIA 2ZT9B 1NTKD 1AV1A 2JGPA 1PPJG 1HH0A 2FYNC 1G2CA 2JJLA 3G21A 1VDFA 3EJEA 1A02J 1L0NG 3B71A 2C0WA 1NVOA 5M1BA 2P10A 1AJYA 3TSIA 4WY4B 2ONTA 5APTA 3RK2B 1EDJA 1MKMA 2IZ1A 3BCCD 1KLPA 1FU1A 5I4TG 3DS5A 2CGQA 3H1KE 3TGUG 3S9OA 4PD4H 2RN0A 1MFZA 2YIUC 4H13B 1BXIA 2ZFCA 3AE1C 1USEA 5KLVE 1H8AA 2JKVA 2OYIC 2JEEA 1FC2C 3RG6C 2KS1A 1R5LA 2W90A 2JU1A 5BS1A 3L70E 1KTMA 3VRLC 1FZBA 3L71D 1EOQA 3VP9A 2FYUJ 2Q9IA 1BSHA 1D7MA 3L73J 1JB0J 4OWFA 2GDXA 2JBGA 4L75A 4ZNCA 5CCHA 2MVUA 3RBXA 1L0NJ 1M1JB 1NU1D 5AW4B 4H2YC 1DD4A 1GW4A 3E7KA 3OW2O 5CMZA 1VL2A 1SS1A 2WSEH 3BRTB 2N6ZA 4A7PA 1VHNA 1IUQA 1IO4A 1KV4A 2AEFA 2BASA 1KB9H 5CHXA 1P84E 4C7RA 3HD7A 3NFQA 5KAIH 2IPPA 2BCCJ 5KLIB 3CCLP 1IFJA 3Q5SA 2Y0DA 1SVFA 2E76D 1MZ9A 1PV3A 3G0VA 1LJ2A 1BAJA 3RL0B 5AVZB 1VQ7P 1VPCA 3CX5H 4YPCA 3I5CA 2ZAEB 5AVUB 4RJTA 2H7HA 1QL2A 1R5SA 4D6TE 1NWQA 1JOCA 1VQ6P 1YJ9P 2FHSC 3HYBA 5B66E 4IL6E 2KYVA 3AEGC 2I1JA 2FYNB 3GW6A 4GKGA 3CMEP 2KG8A 3MHVA 3BASA 1RE3C 3T97A 3PRJA 1S5LH 3WU2E 3CXHH 3L72G 2N1TA 5BU8B 1BGYD 1X79B 3HTKB 1BDDA 1NH4A 2V4HA 2CG5B 1NTMK 2LPKA 1KQFB 2A06E 2RH0A 2UWJE 3M9HA 2E42A 3Q1MA 1Y47A 4PD4I 4W7ZA 1WRGA 1OVVA 4R4LA 2OYIB 2K9JB 4HB1A 2L22A 1JCCA 1SQBK 2FFDA 1ZP0C 1RF1C 4XRQA 3ZDMA 2MJZA 5HGOA 1ZLLA 2FYUE 1Q90D 1X8YA 2LMLA 1HJ0A 2P7JA 2XZ1C 1PPJE 4BWNA 4XROA 3CLQA 1N86A 2HLOA 3MGNA 3VMXA 1L0NE 1LTJC 1AVYA 3B8EB 2YMKA 3G4SP 1NHLA 5AVRB 2FQ2A 5AW5B 3TGUE 1BE3J 2WMMA 2BCCE 1NTMD 1SQVJ 1GL2D 2KR5A 1KB9I 4MN4C 4H2XC 1RF1A 1LTGC 1USDA 3VMZA 3CCUP 2KGDA 3EWKA 5EFWB 1VQ5P 2PY8A 3Q5RA 4K3AA 2JQ4A 3CX5I 2IYPA 2KUBA 5KKZB 1S4XA 2IBZI 1LTJA 2Z5HA 2VSQA 2KI7B 1H89A 4MRTC 5AW3B 4PJ0H 3H1JG 2VRSA 3AE4C 3KDPB 4ASVA 4YXWH 1L0LD 3FWLA 3NY7B 3B5NC 1SQQG 2M3BA 3A5TA 1ZXGA 2XXMA 4U0EA 3G1IA 3CXHI 3N7NA 1BCCG 1EZVG 2JYGA 3VMAA 3L75D 1CSBA 3H1IJ 1GL2B 3G9RA 2ZXXA 1SQVK 3TDKA 3CC2P 1FDMA 1RE4C 4PWVB 4R0MA 4W80A 1ZRTE 3WUVA 1JY2N 2XV6A 2WQYC 1GXHA 1NTKG 1N7SD 1T8ZA 1URQC 2XT1A 3TYYA 2E74C 4HJGH 2QJPB 4GT1A 5KAIE 2BQ1E 2XV5A 4UB8E 2QG4A 1S3JA 2QM8A 2H43A 1YBKA 2I8DA 2PRRA 2QNWA 3W67A 1SQXJ 2HODA 2JYLA 1JM0A 1M6NA 3L72E 2WPVB 3BCCG 2QA4P 5APWA 2ITAA 1S9KE 3MTUE 4U0AA 3G71P 2YKPA 3V4WA 1NTZD 1BCCJ 3MP7B 4AQRD 4IFDK 3CC4P 1LTTC 1LT9C 1JNMA 1QEXA 2Y9ZA 2XZRA 1PEQA 2IFNA 3M06A 3M0DC 3RK3E 2PP6A 3O6QA 2KOOA 1L2PA 2POHA 4TT3H 5KLVG 4O9BA 2WSCJ 2XZ0D 1Y8AA 5DCKA 3L71G 1S5LE 1KORA 2KIKA 3Q2YA 2QM7A 3CC7P 4U0BA 1ACPA 1P84H 1NTKJ 3HUSA 1N7SB 3RBZA 1DX7A 1X3OA 4HYTB 3BATA 2JU2A 1QL1A 3DPHA 1SQPD 2ZT9C 1MUUA 1U7JA 3SWFA 1YTZI 1E5WA 1M74A 2NPSC 1PGQA 2G8YA 3BCCJ 3GJNA 1SQXK 3B5NB 1DIPA 4BPGA 2KLVA 3FXEA 3GG2A 3M0DA 2OTJP 1M7LA 1FZCB 1LTAC 2LIUA 1OZHA 4IL6H 2KXPB 2EHSA 3L74D 1KILA 2Y9YA 2K92A 2FADA 4AYCA 3CWBG 4H13C 2OQQA 2RMZA 2WTYA 2FXMA 2LR2A 3EFFK 4WBAA 3V4QA 2EHTA 2D2CC 3P8MC 4WB4A 3L71J 2M8RA 1DV5A 3SFEC 2P58A 1H88A 1UIIA 2JAZA 1HJBA 2NRGA 2QJYC 2GZJA 1URQB 2XNXA 3F89A 1M6EX 2LF4A 1NU1J 1L4AD 1NOHA 1QRJA 4WY4A 2PENA 3H1JE 3NTEA 4LLHA 3V6IA 2NZ2A 1CEIA 1JCDA 3V5BA 1N8RQ 1M1JC 1MFTA 1GU4A 4IFFA 2L91A 1YYCA 3IR9A 1KYOD 5AW0B 1KQGB 2DW3A 5KJ7A 1D1DA 2W27A 1BCCE 1EZVE 3EJDA 3DS4A 4LC1A 1OW6A 1RF0A 1LT9B 2MR8A 2L5GB 3D71A 5CCGA 4KJMA 3D70A 4QNBA 1YJWP 2J59M 5L8RJ 3D6ZA 3JC22 5GTIE 3G6EP 4K35A 1EIAA 1E79H 1NTKE 1M1JA 2VLPA 4GOFA 3H4EA 1EQ7A 1NAYA 2R5DA 2KB7P 5APUA 1GK6A 2Z46A 1P84I 4N78D 3AE3C 1BGYJ 1NU1K 1X9VA 3L73G 2NPSB 2K1AA 3KPEA 2A45H 4WVZA 2CNRA 3BCCE 4NEOA 2O1KA 3W68A 1FZEA 2QRXA 3C8VA 3AE9C 1KFNA 1PEMA 4DG9A 1NTMG 1CZQA 3KZIH 1RO2A 2N9BA 3M0AA 3EJBA 2O1JA 1GU5A 4EOTA 2BCCG 3ABVC 5CJ0A 1WMKA 2Z5IA 5K5GB 4KHXA 2D2CB 1K04A 2R3SA 1SQBG 3L71E 2E76C 1QLED 2A45G 2AXTE 3PTZA 2N98A 2N5HA 2QJYB 4N3YB 1EDIA 1KD1Q 2WSFJ 5APQA 3H1KD 1FS0E 3A7OA 3HTKA 2C0XA 2WSSH 2LKMA 2OYHC 2PGDA 1T2KD 1UJZA 3CMAP 4QMAA 2FQ0A 4WYMA 4QKOA 1AQ5A 2KSEA 2Z45A 1NTMJ 1FZAA 2FXOA 3L70D 2IZ0A 3L75G 4W7YA 1OMIA 1T3JA 3BVHA 2OYIA 3G29A 4UB8H 2K9JA 5KAFH 3CWBE 5KTBA 2ZYGA 3M1MA 1Y9BA 2FAEA 4GDOA 5AW1B 5CCHD 1SQBJ 3I56P 2BUOA 2WWWA 3B5IA 2B88A 1DEBA 3D6YA 3GMAA 4ASWA 4PXHB 2PAJA 5C39A 2ZXEB 2K9YA 5KKZC 4UHPB 3OJAB 2E43A 3HD7D 1L0LJ 3JSVC 2GDWA 4U0DA 2KG9A 1KZUB 1T8KA 2KOPA 3GLMA 5KP6B 1RNIA 5KP7B 1NTZG 3R4YA 3DTJA 5AVWB 1RH5B 2IDBA 2KGAA 4WWIA 3WUUA 3HE4B 3U1CA 3L75J 3P7KA 3EQ2A 4D6TD 5EW5E 2DGYA 3JCUH 1BE3G 1FOSF 4H0LD 3L36A 3I55P 1GK4A 3IFMA 5AW9B 1L0HA 2B89A 4B86A 4GODA 1SQVG 3QWOC 1M56D 1GL2C 3PP5A 3Q5PA 3G3ZA 4GOEA 2E76B 2ZJSE 2LKIA 1ZR4A 2PFXA 2XNDH 5CBOA 1VQ4P 3HE5B 1NQ4A 1RE3A 1RO0A 1FDOA 4BRYB 3VP8A 4JBZA 4BPFA 2E5YA 3L73E 2QJPC 4Z1MH 2OYHB 2KNCB 3U43A 1JTHB 1BDCA 3CE7A 1NKZB 1L0LK 1NAFA 3Q3DA 1CW5A 2VLQA 1NTZJ 1OXZA 4I6MC 2AFEA 1NTME 1GL2A 1L0IA 1KQSO 3S1KA 1FDIA 3WUTA 1PPJD 3H1IG 2M5RA 5TISH 4RKUJ 2WT7B 1SQBE 3OAKA 1IFPA 1OWAA 2CQ8A 2CWOA 3VMYA 1HBWA 1UNKA 2Z44A 3LW5J 1SQPJ 2AEJA 2PEOA 3KZIE 2L6EA 3TGUD 2Y0CA 3VN0A 4XFXA 1DNYA 1N7SC 1IC2A 1L0LE 3AEBC 3SWKA 2L0QA 4OGQD 3M91A 1NJIQ 2WSCH 3H32B 3E1RA 4H44D 4COCA 5AVVB 1SQXG 5GTIH 2LOLA 3L4FA 4U0CA 2QIWA 2LIWA 3AEFC 3L74J 2GYKA 3L75E 3P05A 1NTZK 5AW8B 2YNYA 2KOSA 1FZCC 2KZJA 1JY3O 3AE5C 2E75D 1M57D
chains in the Genus database with same CATH topology
2Z46A 1YITP 1YJ9P 1VQ6P 5I4TG 3DS5A 3HYBA 2BQ1E 1S72P 5F2KA 3CCRP 1KC8Q 2PEKA 4PH1A 3I56P 1K73Q 2BUOA 3CMEP 2EG5A 2M8NA 4COPA 2JYLA 1Q81Q 1M90Q 3CCUP 2BHVA 3B5IA 4XFZA 1M6NA 4M0IA 2P9XA 3Q20A 2M8LA 1YI2P 1E6JP 1VQ5P 2PY8A 2QA4P 1PEMA 1K30A 1A43A 3RG6C 1AUMA 1RO2A 1KQSO 3MGEA 3DS3A 4U0AA 5BS1A 1YJNP 4IPYA 3G71P 2EFJA 1M6EX 5HGMA 3E2DA 2LF4A 3LRYA 5F2NA 2M8PA 3CC4P 3VRLC 1EOQA 2PEQA 3CCMP 1YHQP 1VQ9P 1QRJA 3HZQA 2PENA 2PEIA 4GR6A 3NTEA 5F2OA 4U0FA 5HGNA 5HGLA 4U0DA 3CCJP 1PEQA 4XFYA 1K8AQ 2QEXP 1N8RQ 1RNIA 1Q86Q 3H0DA 2CWOA 1VQNP 2OARA 3WBHA 3DTJA 1JJ2O 1Q82Q 5DCKA 1QVFO 2Z44A 3OW2O 5JPAA 3CC7P 2PEOA 4U0BA 1D1DA 2L6EA 1W2BO 1IUQA 2XXMA 4U0EA 2DGYA 3G1IA 3CCQP 3DS4A 2JO0A 4XFXA 1VQ8P 1KD1Q 1QVGO 3I55P 4XRQA 1VQPP 3CCVP 3CXCO 2JYGA 2PEJA 2KODA 5BS2A 1A8OA 5HGOA 1YIJP 1NJIQ 1K9MQ 4QNBA 1M1KQ 2E1MA 3DPHA 4COCA 1VQOP 1PEUA 4U0CA 4XROA 3CCLP 3CPWO 2EIAA 3G28A 1M74A 1YJWP 2PEMA 3DS2A 3DS0A 3CMAP 4PH0A 3CC2P 3G21A 4WYMA 1PEOA 1VQLP 3G1GA 3G0VA 3DS1A 1BAJA 1ZMBA 3CCSP 1VQ7P 3G6EP 3P05A 1VQ4P 2Z45A 1EIAA 3H47A 4GR2A 1VQKP 1RO0A 3CD6P 1VQMP 2OTJP 2OTLP 3CCEP 1Q7YQ 2XV6A 3H4EA 2ONTA 3G29A 3G4SP 2XT1A 3G26A 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 Q;  3CCL P;  1YIT P;  3CPW O;  1YJ9 P;  1YJW P;  1YJN P;  1QVF O;  3G71 P;  3OW2 O;  1VQ6 P;  3CMA P;  3CC2 P;  1S72 P;  3CC7 P;  1VQL P;  3CC4 P;  3CCR P;  3CCS P;  1KC8 Q;  1W2B O;  3CCM P;  1YHQ P;  3G6E P;  1VQ7 P;  1VQ9 P;  3I56 P;  3CCQ P;  1K73 Q;  1VQ4 P;  3CME P;  1Q81 Q;  1VQ8 P;  1M90 Q;  3CCU P;  3I55 P;  1QVG O;  1KD1 Q;  1VQK P;  1VQP P;  3CCV P;  3CXC O;  3CD6 P;  3CCJ P;  1VQM P;  2OTJ P;  1YI2 P;  2OTL P;  3CCE P;  1VQ5 P;  1K8A Q;  1YIJ P;  2QEX P;  1Q7Y Q;  1N8R Q;  1NJI Q;  1Q86 Q;  1K9M Q;  3G4S P;  2QA4 P;  1M1K Q;  1VQN P;  1VQO P;  1JJ2 O;  1KQS O; 
#chains in the Genus database with same CATH topology
 2W8Z A;  1YIT P;  4PD4 D;  1K05 A;  2WPT A;  5APS A;  3P32 A;  1H0T B;  2BEZ F;  1RQV A;  3FX0 A;  4OVN F;  1N7S A;  4PH1 A;  3CL3 D;  1K73 Q;  4COP A;  2M5A B;  2LXC B;  3Q20 A;  3MUD C;  1PGJ A;  1IK7 A;  1PP9 D;  3H1H D;  1K30 A;  5DJU B;  3RL0 g;  3MGE A;  4XE5 B;  3B5N A;  1SQP K;  2HPC B;  3LMO A;  3PJS K;  5KAF E;  2PNG A;  4U7J A;  1FZC A;  2PEI A;  1F80 D;  4OGQ B;  5F2O A;  4U0F A;  4U3F D;  1NTZ E;  4XFJ A;  3VTP C;  2AXT H;  2FKW B;  4TLF A;  1XTG B;  1FJK A;  1OW7 A;  2Q3I A;  2KGE A;  1DD3 A;  4LGD E;  1OVR A;  4C7N B;  2K93 A;  1FJP A;  2H8P D;  1RE4 A;  1BE3 E;  4L74 A;  4L73 A;  1FE6 A;  1QGK B;  2IX7 C;  4ZMD A;  1KB9 D;  2N5I A;  2C9N Y;  3A0H E;  2E75 B;  1SQV E;  3MUD A;  2K0X A;  4IFM A;  1PIX A;  1JMM A;  5BS2 A;  1EC5 A;  3U59 A;  1SFC D;  1URQ A;  3H25 A;  3L72 D;  2OGU A;  5TJH A;  3P8C D;  3CX5 D;  4UB6 H;  1S9K D;  1AA0 A;  5HVC A;  2IBZ D;  1S1C X;  1JMB A;  1LWU C;  2X2B A;  2JWA A;  1NU1 G;  2P67 A;  1LTS C;  1EZV I;  3JCU E;  2JDI H;  1L4A C;  2JR8 A;  4PV1 D;  2B9B A;  3RK3 D;  2HFE D;  1S72 P;  5APV A;  1LT9 A;  1EDL A;  1Q81 Q;  4I2L C;  1MV8 A;  3CXH D;  3SWY A;  1TU3 F;  3GHG B;  4R4M A;  3HRN A;  1A43 A;  3SFD C;  3DS3 A;  1LNQ A;  2XU6 A;  4IPY A;  3H1I E;  2FY8 A;  3LRY A;  3SSU A;  2M8P A;  2XKM A;  1VF5 D;  1AFO A;  2NO8 A;  1LWU A;  1DH3 A;  4BXL A;  1SFC B;  2H89 C;  2W6J H;  3CCJ P;  3MIW A;  4JYC A;  3AEA C;  3B4Q A;  5AVQ B;  2OAR A;  3H1K J;  2SPZ A;  1GD2 E;  3MD0 A;  2NPS A;  3MZW B;  1QVF O;  2R44 A;  1A02 F;  2YXQ B;  1BSN A;  2WVR A;  3AE6 C;  1OIP A;  1KIL D;  2JO0 A;  5APX A;  1VQ8 P;  1U7M A;  3CCV P;  1BGY G;  1SQX E;  2ZVO B;  4PV1 B;  5TIS E;  3L70 J;  2YO2 A;  2CPS A;  1T6A A;  3H1L D;  3DS0 A;  2E5T A;  4PH0 A;  1X22 A;  1AF8 A;  3CCS P;  2WSF H;  5BU5 A;  2J5U A;  1RHZ B;  2Z4E A;  1S2E A;  3C1L A;  2GM4 A;  2QVA A;  5CZD B;  1J1E B;  3KHU A;  3H1J D;  4WY4 D;  1VF5 B;  2O3J A;  3RK2 D;  3PH0 A;  3NXS A;  1NYH A;  1SQQ D;  1M90 Q;  4N78 E;  4M0I A;  2GZI A;  2GZE A;  5AVT B;  2M8L A;  2K5X A;  1LWU B;  5H2F E;  5KJ7 D;  2ZYD A;  1EZV D;  1S5L X;  1XTC C;  4XA4 A;  1PGO A;  1N73 C;  5EJD A;  2EFJ A;  1L4A B;  5CCG D;  1HGV A;  3VOP A;  1AVO A;  2PEQ A;  1FBM A;  2FVF A;  2K94 A;  2FVE A;  5E79 E;  5HGN A;  4D6T J;  4DT0 A;  1LP1 B;  1T2K C;  2K2Q A;  1K8A Q;  1N2D C;  4NPD A;  3H0D A;  1FR2 A;  5AW6 B;  2QJK C;  3CI9 A;  4H2W C;  4Y99 B;  1IJD B;  4F37 A;  2Q3E A;  4EDF A;  2B87 B;  3E1I A;  3N4X A;  1IFN A;  2AXC A;  3CCQ P;  4YXD C;  1A8O A;  1J1D B;  1M1K Q;  2I1K A;  1N73 A;  5CCH C;  1CI6 B;  3DS2 A;  1X0T A;  5APY A;  1JO5 A;  5AW2 B;  1YQ3 C;  3M9Q A;  1NU1 E;  2KOG A;  3RL0 D;  4ZKU A;  2Q5U A;  3EFG A;  2KK7 A;  2O01 J;  3HD7 C;  3HE4 A;  1L0L G;  1SP4 A;  4I7Z C;  1JY3 P;  2N9Y B;  5KLV D;  1FZG A;  2V7Q J;  5BVZ A;  1KC8 Q;  2PEK A;  3QH9 A;  2EG5 A;  2HR3 A;  3M9B A;  5HV8 A;  4CA3 A;  1YI2 P;  4UB6 E;  2ZYA A;  2IYO A;  4DJG A;  3TNU B;  3V2P A;  3NMD A;  4C46 A;  3NTN A;  3L37 A;  1UIX A;  2H88 C;  4H0L C;  3E2D A;  3HE5 A;  1VKU A;  3CCM P;  4Y28 J;  2GDY A;  3HZQ A;  1G2C B;  2KG6 A;  4BRY A;  1GXG A;  1PP9 G;  2Q6Q A;  1G1J A;  2MKV A;  3H1H G;  2ROQ A;  3TGU J;  4KT0 J;  2ZVN B;  2QEX P;  2OYH A;  1Q86 Q;  3II6 A;  2KNC A;  3R2P A;  2MD9 A;  1ZME C;  1HVV A;  2N1T C;  1JTH A;  1IK9 A;  1OW8 A;  2QE7 H;  3GZL A;  3A0H H;  1P84 D;  2Y0E A;  1N73 B;  3TF5 A;  2WZ7 A;  4U3F G;  2QSI A;  2AVA A;  4DOJ A;  3CWB D;  1BGY E;  1IFI A;  1JY2 O;  2PEJ A;  2KOD A;  2XDJ A;  2GZF A;  2WPS A;  1GW3 A;  2IFM A;  5CJ4 A;  1OFC X;  3CPW O;  3LW5 H;  2A45 I;  2R3C A;  2QJK B;  1HF9 A;  2KS1 B;  2FXP A;  2WT7 A;  3G1G A;  2KOQ A;  2C9L Y;  3IAO A;  2MY5 A;  2FFD C;  1Z6M A;  2FYU K;  1PZQ A;  1VQK P;  3CD6 P;  7CEI A;  1T3U A;  1Q7Y Q;  1L0N K;  2AF8 A;  4GIF A;  3O8Z A;  2KGC A;  2ERH A;  3F5H A;  2IBZ G;  3FGA D;  1PP9 J;  2FAC A;  2GUV A;  3H1H J;  2MVV A;  3V2Q A;  5F2K A;  3AE8 C;  2K0Y A;  2N1T D;  2YIU B;  1QX8 A;  3A0B E;  5AVS B;  3C9I A;  2RKL A;  2WIT A;  4JPZ B;  3H32 A;  3U1A A;  4XFZ A;  2P9X A;  1YTZ T;  1SQP G;  1JUN A;  4U3F J;  1FZF A;  2KWL A;  3HD7 B;  2A06 D;  1YJN P;  4I7Z B;  2K37 A;  1NO4 A;  2VLO A;  2MF4 A;  1OR5 A;  4OGQ C;  2WSE J;  1E0H A;  5KP8 B;  2WPQ A;  4H44 C;  5HGL A;  2LL8 A;  2J58 A;  4XFY A;  3L74 G;  4JF7 A;  3B4S A;  1W2E A;  3AEE C;  3WBH A;  1JJ2 O;  2R32 A;  1H0T A;  2L4B A;  1DEE G;  4EI2 A;  2M5A A;  2FYU D;  1KQL A;  4H0L B;  2AEM A;  1KYO H;  3L72 J;  2E75 C;  1WT6 A;  3L73 D;  2MR7 A;  4HKG A;  1W5C E;  2JWD A;  1GZL A;  1L0N D;  1ZR2 A;  1YIJ P;  3FWN A;  3T97 B;  2HPC A;  2N1T B;  3USS A;  3H47 A;  5GTH H;  2BCC D;  4EYY Q;  3A3Y B;  1AQT A;  3H1L G;  3PLN A;  4C7N A;  1SQB D;  2CPB A;  4IL6 X;  4RES B;  4NPE A;  3LIE A;  1GTW A;  1SLQ A;  3KYQ A;  2N50 A;  3CCR P;  5H2F H;  3GZM A;  2FFD B;  3AE2 C;  2BHV A;  4PD4 E;  3H6P A;  3GHG C;  4N6J A;  2FBW C;  1LT1 A;  3KXD A;  3L35 A;  2W83 C;  1IFM A;  5E79 H;  5B5E H;  1PP9 E;  1RQU A;  3H1H E;  1SFC C;  1HUC A;  4IZ6 A;  1PL5 A;  2G3A A;  3GKL C;  2OTK E;  2BEQ D;  3ITK A;  2KSJ A;  1PGP A;  2AFD A;  3RGU A;  4U3F E;  2HYN A;  5JPA A;  3V2N A;  1YQ4 C;  3H1L J;  1NKN A;  2YMY A;  3AED C;  1W2B O;  1M8O B;  1NGM B;  3K5B A;  3GHG A;  3IF4 A;  3IN6 A;  1RF1 B;  2YKO A;  4H44 B;  4PV1 C;  2DNW A;  1K9M Q;  3RK3 C;  1KB9 E;  4L76 A;  1ZRT D;  1PEU A;  1EMV A;  4NPF X;  2EIA A;  1HWT C;  1GMJ A;  2O01 N;  2PEM A;  1EDK A;  1U57 A;  2R5B A;  4HH2 A;  3H1J J;  1PEO A;  1SFC A;  1VQL P;  1ZMB A;  1Z56 A;  2YXR B;  4GR2 A;  1LTJ B;  2KP8 A;  2N6Y A;  3S4R A;  3B5N D;  3OA7 A;  1VQM P;  2FVA A;  2OYO A;  2OTL P;  3P8C E;  3CX5 E;  3HUS C;  1J1E C;  2WPR A;  2VLN A;  1SQQ J;  4JYB A;  2IBZ E;  2LXB A;  2M3E A;  3G26 A;  1VF5 C;  1R8E A;  1KYO I;  1ZN5 A;  2JP3 A;  4DZO A;  2YO3 A;  1IFD A;  4I1L A;  3H1K G;  3PHL A;  4M3L A;  1LTI C;  2JO1 A;  1HTL C;  4AUW A;  1SQP E;  5CBN A;  1BE3 D;  4IOI H;  2K3R A;  1FOS E;  2K0D X;  2L9F A;  1SQV D;  1KIL C;  3A2A A;  3CXH E;  4DCK A;  1FAV A;  1G1I A;  1URQ D;  3L70 G;  2E74 D;  1YHQ P;  2GA1 A;  1AYI A;  3L74 E;  4GR6 A;  1RY3 A;  1GDT A;  3AE7 C;  3LID A;  1EXI A;  1MZ8 A;  2K88 A;  4Y99 C;  1Q82 Q;  3RG2 A;  2KOR A;  2KLU A;  1ZOY C;  1LTB C;  1QVG O;  5AVY B;  4WY4 C;  3CXC O;  1LGH B;  2HOD B;  1J1D C;  5B66 H;  1SQQ K;  3RK2 C;  1JY2 P;  1L4A A;  2E1M A;  1HY8 A;  1KIL E;  1KMI Z;  2M0B A;  1GPJ A;  3G28 A;  2W6B A;  3AEC C;  2Q1K A;  3FXD A;  3DS1 A;  1EXJ A;  3BRV B;  3WU2 H;  1LP1 A;  2Q7C A;  5KJ7 C;  5KLV J;  1KN7 A;  4OH8 B;  2LTE A;  3H1L E;  3V2R A;  3H1I D;  1RF0 C;  3CCE P;  2FYZ A;  1KYO E;  5CCG C;  2CK3 H;  3RK3 B;  2B87 A;  3O6Q B;  4D6T G;  2E74 B;  3A0B H;  2GUS A;  2P1J A;  1NTK K;  2ZT9 D;  2M8N A;  2NPS D;  1ZV8 A;  3WMM 0;  1N7L A;  2O01 H;  1ZNV A;  1CI6 A;  1E6J P;  5AW7 B;  4EIJ A;  1JY3 N;  1IZN B;  3HUS B;  5GTH E;  1AUM A;  3KQG A;  1SQQ E;  5DJT B;  2V7Q H;  1SQX D;  2KW2 A;  5HGM A;  2HG5 D;  5F2N A;  2P2U A;  3GF3 A;  4RO0 A;  1VQ9 P;  3TK1 A;  4H13 D;  1OX3 A;  3CWB J;  2W6A A;  1OVU A;  2A06 G;  5KLI C;  3VYI A;  2GZG A;  1VQN P;  4BPH A;  1BCC D;  2D2C D;  1HGZ A;  4ZKP A;  1ZW0 A;  4PJ0 E;  1IMQ A;  3RL0 C;  1KIL B;  4YTP C;  5KLV K;  1IMP A;  3UIA A;  1HQB A;  1KFM A;  2JB0 A;  1Q2N A;  1J2J B;  2YKQ A;  1JEK A;  1VQP P;  4JQ0 D;  3GF7 A;  2KZI A;  5B5E E;  3TNU A;  4CPG A;  2FQ1 A;  5AVX B;  1VQO P;  4HKZ H;  2FYU G;  1PFI A;  2ZT9 B;  1NTK D;  1AV1 A;  2JGP A;  1PPJ G;  1HH0 A;  2FYN C;  1G2C A;  2JJL A;  3G21 A;  1VDF A;  3EJE A;  1A02 J;  1L0N G;  3B71 A;  2C0W A;  1NVO A;  5M1B A;  2P10 A;  1AJY A;  3TSI A;  4WY4 B;  2ONT A;  5APT A;  3RK2 B;  1EDJ A;  1MKM A;  2IZ1 A;  3BCC D;  1KLP A;  1FU1 A;  5I4T G;  3DS5 A;  2CGQ A;  3H1K E;  3TGU G;  3S9O A;  4PD4 H;  2RN0 A;  1MFZ A;  2YIU C;  4H13 B;  1BXI A;  2ZFC A;  3AE1 C;  1USE A;  5KLV E;  1H8A A;  2JKV A;  2OYI C;  2JEE A;  1FC2 C;  3RG6 C;  2KS1 A;  1R5L A;  2W90 A;  2JU1 A;  5BS1 A;  3L70 E;  1KTM A;  3VRL C;  1FZB A;  3L71 D;  1EOQ A;  3VP9 A;  2FYU J;  2Q9I A;  1BSH A;  1D7M A;  3L73 J;  1JB0 J;  4OWF A;  2GDX A;  2JBG A;  4L75 A;  4ZNC A;  5CCH A;  2MVU A;  3RBX A;  1L0N J;  1M1J B;  1NU1 D;  5AW4 B;  4H2Y C;  1DD4 A;  1GW4 A;  3E7K A;  3OW2 O;  5CMZ A;  1VL2 A;  1SS1 A;  2WSE H;  3BRT B;  2N6Z A;  4A7P A;  1VHN A;  1IUQ A;  1IO4 A;  1KV4 A;  2AEF A;  2BAS A;  1KB9 H;  5CHX A;  1P84 E;  4C7R A;  3HD7 A;  3NFQ A;  5KAI H;  2IPP A;  2BCC J;  5KLI B;  3CCL P;  1IFJ A;  3Q5S A;  2Y0D A;  1SVF A;  2E76 D;  1MZ9 A;  1PV3 A;  3G0V A;  1LJ2 A;  1BAJ A;  3RL0 B;  5AVZ B;  1VQ7 P;  1VPC A;  3CX5 H;  4YPC A;  3I5C A;  2ZAE B;  5AVU B;  4RJT A;  2H7H A;  1QL2 A;  1R5S A;  4D6T E;  1NWQ A;  1JOC A;  1VQ6 P;  1YJ9 P;  2FHS C;  3HYB A;  5B66 E;  4IL6 E;  2KYV A;  3AEG C;  2I1J A;  2FYN B;  3GW6 A;  4GKG A;  3CME P;  2KG8 A;  3MHV A;  3BAS A;  1RE3 C;  3T97 A;  3PRJ A;  1S5L H;  3WU2 E;  3CXH H;  3L72 G;  2N1T A;  5BU8 B;  1BGY D;  1X79 B;  3HTK B;  1BDD A;  1NH4 A;  2V4H A;  2CG5 B;  1NTM K;  2LPK A;  1KQF B;  2A06 E;  2RH0 A;  2UWJ E;  3M9H A;  2E42 A;  3Q1M A;  1Y47 A;  4PD4 I;  4W7Z A;  1WRG A;  1OVV A;  4R4L A;  2OYI B;  2K9J B;  4HB1 A;  2L22 A;  1JCC A;  1SQB K;  2FFD A;  1ZP0 C;  1RF1 C;  4XRQ A;  3ZDM A;  2MJZ A;  5HGO A;  1ZLL A;  2FYU E;  1Q90 D;  1X8Y A;  2LML A;  1HJ0 A;  2P7J A;  2XZ1 C;  1PPJ E;  4BWN A;  4XRO A;  3CLQ A;  1N86 A;  2HLO A;  3MGN A;  3VMX A;  1L0N E;  1LTJ C;  1AVY A;  3B8E B;  2YMK A;  3G4S P;  1NHL A;  5AVR B;  2FQ2 A;  5AW5 B;  3TGU E;  1BE3 J;  2WMM A;  2BCC E;  1NTM D;  1SQV J;  1GL2 D;  2KR5 A;  1KB9 I;  4MN4 C;  4H2X C;  1RF1 A;  1LTG C;  1USD A;  3VMZ A;  3CCU P;  2KGD A;  3EWK A;  5EFW B;  1VQ5 P;  2PY8 A;  3Q5R A;  4K3A A;  2JQ4 A;  3CX5 I;  2IYP A;  2KUB A;  5KKZ B;  1S4X A;  2IBZ I;  1LTJ A;  2Z5H A;  2VSQ A;  2KI7 B;  1H89 A;  4MRT C;  5AW3 B;  4PJ0 H;  3H1J G;  2VRS A;  3AE4 C;  3KDP B;  4ASV A;  4YXW H;  1L0L D;  3FWL A;  3NY7 B;  3B5N C;  1SQQ G;  2M3B A;  3A5T A;  1ZXG A;  2XXM A;  4U0E A;  3G1I A;  3CXH I;  3N7N A;  1BCC G;  1EZV G;  2JYG A;  3VMA A;  3L75 D;  1CSB A;  3H1I J;  1GL2 B;  3G9R A;  2ZXX A;  1SQV K;  3TDK A;  3CC2 P;  1FDM A;  1RE4 C;  4PWV B;  4R0M A;  4W80 A;  1ZRT E;  3WUV A;  1JY2 N;  2XV6 A;  2WQY C;  1GXH A;  1NTK G;  1N7S D;  1T8Z A;  1URQ C;  2XT1 A;  3TYY A;  2E74 C;  4HJG H;  2QJP B;  4GT1 A;  5KAI E;  2BQ1 E;  2XV5 A;  4UB8 E;  2QG4 A;  1S3J A;  2QM8 A;  2H43 A;  1YBK A;  2I8D A;  2PRR A;  2QNW A;  3W67 A;  1SQX J;  2HOD A;  2JYL A;  1JM0 A;  1M6N A;  3L72 E;  2WPV B;  3BCC G;  2QA4 P;  5APW A;  2ITA A;  1S9K E;  3MTU E;  4U0A A;  3G71 P;  2YKP A;  3V4W A;  1NTZ D;  1BCC J;  3MP7 B;  4AQR D;  4IFD K;  3CC4 P;  1LTT C;  1LT9 C;  1JNM A;  1QEX A;  2Y9Z A;  2XZR A;  1PEQ A;  2IFN A;  3M06 A;  3M0D C;  3RK3 E;  2PP6 A;  3O6Q A;  2KOO A;  1L2P A;  2POH A;  4TT3 H;  5KLV G;  4O9B A;  2WSC J;  2XZ0 D;  1Y8A A;  5DCK A;  3L71 G;  1S5L E;  1KOR A;  2KIK A;  3Q2Y A;  2QM7 A;  3CC7 P;  4U0B A;  1ACP A;  1P84 H;  1NTK J;  3HUS A;  1N7S B;  3RBZ A;  1DX7 A;  1X3O A;  4HYT B;  3BAT A;  2JU2 A;  1QL1 A;  3DPH A;  1SQP D;  2ZT9 C;  1MUU A;  1U7J A;  3SWF A;  1YTZ I;  1E5W A;  1M74 A;  2NPS C;  1PGQ A;  2G8Y A;  3BCC J;  3GJN A;  1SQX K;  3B5N B;  1DIP A;  4BPG A;  2KLV A;  3FXE A;  3GG2 A;  3M0D A;  2OTJ P;  1M7L A;  1FZC B;  1LTA C;  2LIU A;  1OZH A;  4IL6 H;  2KXP B;  2EHS A;  3L74 D;  1KIL A;  2Y9Y A;  2K92 A;  2FAD A;  4AYC A;  3CWB G;  4H13 C;  2OQQ A;  2RMZ A;  2WTY A;  2FXM A;  2LR2 A;  3EFF K;  4WBA A;  3V4Q A;  2EHT A;  2D2C C;  3P8M C;  4WB4 A;  3L71 J;  2M8R A;  1DV5 A;  3SFE C;  2P58 A;  1H88 A;  1UII A;  2JAZ A;  1HJB A;  2NRG A;  2QJY C;  2GZJ A;  1URQ B;  2XNX A;  3F89 A;  1M6E X;  2LF4 A;  1NU1 J;  1L4A D;  1NOH A;  1QRJ A;  4WY4 A;  2PEN A;  3H1J E;  3NTE A;  4LLH A;  3V6I A;  2NZ2 A;  1CEI A;  1JCD A;  3V5B A;  1N8R Q;  1M1J C;  1MFT A;  1GU4 A;  4IFF A;  2L91 A;  1YYC A;  3IR9 A;  1KYO D;  5AW0 B;  1KQG B;  2DW3 A;  5KJ7 A;  1D1D A;  2W27 A;  1BCC E;  1EZV E;  3EJD A;  3DS4 A;  4LC1 A;  1OW6 A;  1RF0 A;  1LT9 B;  2MR8 A;  2L5G B;  3D71 A;  5CCG A;  4KJM A;  3D70 A;  4QNB A;  1YJW P;  2J59 M;  5L8R J;  3D6Z A;  3JC2 2;  5GTI E;  3G6E P;  4K35 A;  1EIA A;  1E79 H;  1NTK E;  1M1J A;  2VLP A;  4GOF A;  3H4E A;  1EQ7 A;  1NAY A;  2R5D A;  2KB7 P;  5APU A;  1GK6 A;  2Z46 A;  1P84 I;  4N78 D;  3AE3 C;  1BGY J;  1NU1 K;  1X9V A;  3L73 G;  2NPS B;  2K1A A;  3KPE A;  2A45 H;  4WVZ A;  2CNR A;  3BCC E;  4NEO A;  2O1K A;  3W68 A;  1FZE A;  2QRX A;  3C8V A;  3AE9 C;  1KFN A;  1PEM A;  4DG9 A;  1NTM G;  1CZQ A;  3KZI H;  1RO2 A;  2N9B A;  3M0A A;  3EJB A;  2O1J A;  1GU5 A;  4EOT A;  2BCC G;  3ABV C;  5CJ0 A;  1WMK A;  2Z5I A;  5K5G B;  4KHX A;  2D2C B;  1K04 A;  2R3S A;  1SQB G;  3L71 E;  2E76 C;  1QLE D;  2A45 G;  2AXT E;  3PTZ A;  2N98 A;  2N5H A;  2QJY B;  4N3Y B;  1EDI A;  1KD1 Q;  2WSF J;  5APQ A;  3H1K D;  1FS0 E;  3A7O A;  3HTK A;  2C0X A;  2WSS H;  2LKM A;  2OYH C;  2PGD A;  1T2K D;  1UJZ A;  3CMA P;  4QMA A;  2FQ0 A;  4WYM A;  4QKO A;  1AQ5 A;  2KSE A;  2Z45 A;  1NTM J;  1FZA A;  2FXO A;  3L70 D;  2IZ0 A;  3L75 G;  4W7Y A;  1OMI A;  1T3J A;  3BVH A;  2OYI A;  3G29 A;  4UB8 H;  2K9J A;  5KAF H;  3CWB E;  5KTB A;  2ZYG A;  3M1M A;  1Y9B A;  2FAE A;  4GDO A;  5AW1 B;  5CCH D;  1SQB J;  3I56 P;  2BUO A;  2WWW A;  3B5I A;  2B88 A;  1DEB A;  3D6Y A;  3GMA A;  4ASW A;  4PXH B;  2PAJ A;  5C39 A;  2ZXE B;  2K9Y A;  5KKZ C;  4UHP B;  3OJA B;  2E43 A;  3HD7 D;  1L0L J;  3JSV C;  2GDW A;  4U0D A;  2KG9 A;  1KZU B;  1T8K A;  2KOP A;  3GLM A;  5KP6 B;  1RNI A;  5KP7 B;  1NTZ G;  3R4Y A;  3DTJ A;  5AVW B;  1RH5 B;  2IDB A;  2KGA A;  4WWI A;  3WUU A;  3HE4 B;  3U1C A;  3L75 J;  3P7K A;  3EQ2 A;  4D6T D;  5EW5 E;  2DGY A;  3JCU H;  1BE3 G;  1FOS F;  4H0L D;  3L36 A;  3I55 P;  1GK4 A;  3IFM A;  5AW9 B;  1L0H A;  2B89 A;  4B86 A;  4GOD A;  1SQV G;  3QWO C;  1M56 D;  1GL2 C;  3PP5 A;  3Q5P A;  3G3Z A;  4GOE A;  2E76 B;  2ZJS E;  2LKI A;  1ZR4 A;  2PFX A;  2XND H;  5CBO A;  1VQ4 P;  3HE5 B;  1NQ4 A;  1RE3 A;  1RO0 A;  1FDO A;  4BRY B;  3VP8 A;  4JBZ A;  4BPF A;  2E5Y A;  3L73 E;  2QJP C;  4Z1M H;  2OYH B;  2KNC B;  3U43 A;  1JTH B;  1BDC A;  3CE7 A;  1NKZ B;  1L0L K;  1NAF A;  3Q3D A;  1CW5 A;  2VLQ A;  1NTZ J;  1OXZ A;  4I6M C;  2AFE A;  1NTM E;  1GL2 A;  1L0I A;  1KQS O;  3S1K A;  1FDI A;  3WUT A;  1PPJ D;  3H1I G;  2M5R A;  5TIS H;  4RKU J;  2WT7 B;  1SQB E;  3OAK A;  1IFP A;  1OWA A;  2CQ8 A;  2CWO A;  3VMY A;  1HBW A;  1UNK A;  2Z44 A;  3LW5 J;  1SQP J;  2AEJ A;  2PEO A;  3KZI E;  2L6E A;  3TGU D;  2Y0C A;  3VN0 A;  4XFX A;  1DNY A;  1N7S C;  1IC2 A;  1L0L E;  3AEB C;  3SWK A;  2L0Q A;  4OGQ D;  3M91 A;  1NJI Q;  2WSC H;  3H32 B;  3E1R A;  4H44 D;  4COC A;  5AVV B;  1SQX G;  5GTI H;  2LOL A;  3L4F A;  4U0C A;  2QIW A;  2LIW A;  3AEF C;  3L74 J;  2GYK A;  3L75 E;  3P05 A;  1NTZ K;  5AW8 B;  2YNY A;  2KOS A;  1FZC C;  2KZJ A;  1JY3 O;  3AE5 C;  2E75 D;  1M57 D; 
#chains in the Genus database with same CATH homology
 2Z46 A;  1YIT P;  1YJ9 P;  1VQ6 P;  5I4T G;  3DS5 A;  3HYB A;  2BQ1 E;  1S72 P;  5F2K A;  3CCR P;  1KC8 Q;  2PEK A;  4PH1 A;  3I56 P;  1K73 Q;  2BUO A;  3CME P;  2EG5 A;  2M8N A;  4COP A;  2JYL A;  1Q81 Q;  1M90 Q;  3CCU P;  2BHV A;  3B5I A;  4XFZ A;  1M6N A;  4M0I A;  2P9X A;  3Q20 A;  2M8L A;  1YI2 P;  1E6J P;  1VQ5 P;  2PY8 A;  2QA4 P;  1PEM A;  1K30 A;  1A43 A;  3RG6 C;  1AUM A;  1RO2 A;  1KQS O;  3MGE A;  3DS3 A;  4U0A A;  5BS1 A;  1YJN P;  4IPY A;  3G71 P;  2EFJ A;  1M6E X;  5HGM A;  3E2D A;  2LF4 A;  3LRY A;  5F2N A;  2M8P A;  3CC4 P;  3VRL C;  1EOQ A;  2PEQ A;  3CCM P;  1YHQ P;  1VQ9 P;  1QRJ A;  3HZQ A;  2PEN A;  2PEI A;  4GR6 A;  3NTE A;  5F2O A;  4U0F A;  5HGN A;  5HGL A;  4U0D A;  3CCJ P;  1PEQ A;  4XFY A;  1K8A Q;  2QEX P;  1N8R Q;  1RNI A;  1Q86 Q;  3H0D A;  2CWO A;  1VQN P;  2OAR A;  3WBH A;  3DTJ A;  1JJ2 O;  1Q82 Q;  5DCK A;  1QVF O;  2Z44 A;  3OW2 O;  5JPA A;  3CC7 P;  2PEO A;  4U0B A;  1D1D A;  2L6E A;  1W2B O;  1IUQ A;  2XXM A;  4U0E A;  2DGY A;  3G1I A;  3CCQ P;  3DS4 A;  2JO0 A;  4XFX A;  1VQ8 P;  1KD1 Q;  1QVG O;  3I55 P;  4XRQ A;  1VQP P;  3CCV P;  3CXC O;  2JYG A;  2PEJ A;  2KOD A;  5BS2 A;  1A8O A;  5HGO A;  1YIJ P;  1NJI Q;  1K9M Q;  4QNB A;  1M1K Q;  2E1M A;  3DPH A;  4COC A;  1VQO P;  1PEU A;  4U0C A;  4XRO A;  3CCL P;  3CPW O;  2EIA A;  3G28 A;  1M74 A;  1YJW P;  2PEM A;  3DS2 A;  3DS0 A;  3CMA P;  4PH0 A;  3CC2 P;  3G21 A;  4WYM A;  1PEO A;  1VQL P;  3G1G A;  3G0V A;  3DS1 A;  1BAJ A;  1ZMB A;  3CCS P;  1VQ7 P;  3G6E P;  3P05 A;  1VQ4 P;  2Z45 A;  1EIA A;  3H47 A;  4GR2 A;  1VQK P;  1RO0 A;  3CD6 P;  1VQM P;  2OTJ P;  2OTL P;  3CCE P;  1Q7Y Q;  2XV6 A;  3H4E A;  2ONT A;  3G29 A;  3G4S P;  2XT1 A;  3G26 A;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...