3Q20A

Crystal structure of rbcx c103a mutant from thermosynechococcus elongatus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
114
structure length
114
Chain Sequence
MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRAQQLERMTQVSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords RbcX protein
publication title Structure of the RuBisCO chaperone RbcX from the thermophilic cyanobacterium Thermosynechococcus elongatus
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 49
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3q20A00
2PEQA 2Z46A 2PEMA 2PEJA 2PY8A 2PEKA 2Z45A 4GR6A 3HYBA 2PEIA 5BS1A 4GR2A 3RG6C 2Z44A 3Q20A 2PEOA 5BS2A 2PENA
chains in the Genus database with same CATH superfamily
2GDYA 2Z46A 2L22A 1YHQP 3CCLP 3HYBA 2GZEA 5BS1A 3H47A 1D1DA 3B5IA 3CCUP 2JQ4A 1VQ7P 2MY5A 2KOPA 1M1KQ 1A43A 4BPGA 2MD9A 5KP6B 2P9XA 5HVCA 2XT1A 2N50A 2NO8A 1M74A 5JPAA 3G21A 2KGEA 3M1MA 1T8KA 4COCA 2MF4A 2PEKA 2JYGA 1YJWP 1EIAA 2K5XA 1VQMP 2VLQA 2KOSA 2N6ZA 3DPHA 3LRYA 1Q7YQ 4H2WC 2LL8A 2KGCA 3DTJA 2Z44A 2FQ1A 3B4QA 4XROA 1BAJA 2XZ0D 4XFZA 2KWLA 2GZIA 5CZDB 2OTLP 2PEIA 3E2DA 3CCMP 1RO0A 5HGMA 2K0YA 1VQLP 3G29A 4UHPB 2MVVA 2N6YA 1EOQA 2JB0A 3CMAP 5I4TG 1FR2A 5DCKA 2CNRA 3CC7P 5HV8A 4PXHB 1HQBA 2KOQA 2N5HA 3EJDA 1DNYA 4NEOA 3I56P 2LPKA 2GDWA 3CC4P 1VQPP 2MR7A 1EMVA 2KORA 2KOOA 2EG5A 5EJDA 4COPA 3G71P 1MZ8A 5F2OA 1NJIQ 3G4SP 4HKGA 2CWOA 4PWVB 4WYMA 2BUOA 1Q86Q 2CGQA 2JBGA 2E1MA 3CCQP 1KLPA 3GJNA 4PH1A 1K30A 1S72P 1VQKP 1YJ9P 1YI2P 3CC2P 3CCVP 5KP7B 7CEIA 2KODA 3DS2A 3P05A 2PEOA 3GZLA 2X2BA 2K92A 2AVAA 1L0HA 2GYKA 5HGLA 4R0MA 2M8PA 3LMOA 2FVEA 4BPFA 1E0HA 3WBHA 1YIJP 2FHSC 2ONTA 1IMPA 4M0IA 1X3OA 1DV5A 1NQ4A 1VQOP 1KD1Q 2VLNA 2FVFA 2EIAA 2M8NA 1K73Q 1QVFO 3G26A 5EW5E 1OR5A 3RG2A 2MVUA 3DS0A 3CD6P 5F2NA 2MR8A 2JU1A 3CCSP 4XFYA 2FQ0A 3RG6C 2GZJA 2VLOA 2AF8A 4U0FA 1UJZA 2LKIA 4U0CA 3H0DA 1Z6MA 1K8AQ 2ERHA 2K0XA 2PY8A 1QRJA 2FACA 1JJ2O 1AYIA 2KG6A 2M5RA 1E6JP 2PEJA 3HZQA 3GKLC 3VRLC 3G1IA 2QNWA 4U0AA 2QEXP 5F2KA 1UNKA 2K0DX 5KP8B 2FVAA 2K2QA 4QNBA 3G6EP 3DS1A 2KG9A 2L6EA 2CG5B 3H4EA 3DS5A 4U0EA 3U43A 2VLPA 4DG9A 4IPYA 2FADA 4H2YC 1VQ5P 1VQ4P 1KQSO 2L4BA 2DNWA 2N5IA 1BXIA 2KR5A 2XXMA 1KC8Q 2OTJP 1Q82Q 1M90Q 3EJEA 2GDXA 4BPHA 2PNGA 2FAEA 4IZ6A 2KGDA 3CPWO 2VSQA 2EHTA 5BS2A 2AFDA 3I55P 2L9FA 1VQ8P 3CMEP 1GXHA 2GZGA 2L0QA 1K9MQ 2JO0A 4GR6A 2WPTA 3CCEP 2KW2A 2QA4P 4PH0A 4GR2A 3Q20A 2N98A 4MRTC 3MGEA 1CEIA 1AUMA 1N8RQ 1VQ6P 1HY8A 4U0DA 1GPJA 2OARA 1ZNVA 2JYLA 1VQNP 1ZMBA 1YITP 2JU2A 1VHNA 3CE7A 2LIUA 3G1GA 1RO2A 2GZFA 4F37A 2LF4A 2XV6A 2PEQA 1VQ9P 4H2XC 3DS4A 3CXCO 2ROQA 2K93A 2FQ2A 2XZ1C 3NTEA 1IMQA 1QVGO 1L0IA 4XRQA 3NY7B 2CQ8A 1Q81Q 1GXGA 2KG8A 2EHSA 4U0BA 1F80D 1VKUA 1W2BO 1A8OA 1RNIA 3CCJP 4XFXA 2JGPA 2PENA 2Z45A 2DGYA 2LMLA 5HGNA 4QKOA 5HGOA 2EFJA 2LIWA 2AFEA 4CA3A 3CCRP 3G0VA 3GZMA 3OW2O 1AF8A 2BHVA 2LOLA 2JAZA 1IUQA 1M6EX 2PEMA 1M6NA 3EJBA 1ACPA 2KGAA 2M8LA 1YJNP 3DS3A 2LTEA 2K94A 3G28A
chains in the Genus database with same CATH topology
2Z46A 3CCSP 2QA4P 1YHQP 4XFYA 4PH0A 3CCLP 4GR2A 3RG6C 3Q20A 3I56P 3MGEA 4U0FA 3CC4P 3HYBA 5BS1A 1AUMA 1N8RQ 3H47A 1VQ6P 1D1DA 3B5IA 4U0CA 4U0DA 3H0DA 2OARA 1VQPP 3CCUP 2EG5A 2JYLA 4COPA 3G71P 1VQ7P 1VQNP 1M1KQ 5F2OA 1K8AQ 1NJIQ 1ZMBA 3G4SP 1YITP 2PY8A 1A43A 2CWOA 1QRJA 4WYMA 2BUOA 1JJ2O 2P9XA 1Q86Q 2PEJA 1E6JP 2XT1A 3HZQA 3VRLC 3G1GA 3G1IA 1RO2A 2E1MA 3CCQP 4U0AA 2LF4A 2XV6A 2PEQA 1M74A 5JPAA 2QEXP 5F2KA 1VQ9P 3G21A 4PH1A 3DS4A 3CXCO 1K30A 1S72P 1VQKP 3M1MA 4COCA 1YJ9P 1YI2P 3CC2P 4QNBA 3CCVP 3NTEA 3G6EP 1QVGO 2PEKA 4XRQA 3DS1A 2L6EA 2JYGA 2KODA 1YJWP 1EIAA 1Q81Q 3DS2A 1VQMP 3P05A 3H4EA 3DS5A 2PEOA 3DPHA 4U0BA 3LRYA 4U0EA 1Q7YQ 3DTJA 1W2BO 1A8OA 4IPYA 1RNIA 3CCJP 2Z44A 4XFXA 1VQ5P 5HGLA 2PENA 1VQ4P 1KQSO 2Z45A 2M8PA 2DGYA 5HGNA 4XROA 1BAJA 2XXMA 1KC8Q 2OTJP 3WBHA 1YIJP 4XFZA 5HGOA 1Q82Q 2EFJA 2ONTA 3CCRP 1M90Q 3G0VA 3OW2O 4M0IA 2PEIA 2OTLP 3E2DA 3CCMP 1RO0A 1VQOP 1KD1Q 5HGMA 2BHVA 3CPWO 2EIAA 1VQLP 2M8NA 3G29A 5BS2A 3I55P 1K73Q 1IUQA 1EOQA 1M6EX 1M6NA 2PEMA 3CMAP 1QVFO 5I4TG 2M8LA 3G26A 5DCKA 1YJNP 1VQ8P 3CMEP 1K9MQ 2JO0A 4GR6A 3DS3A 3CCEP 3CC7P 3DS0A 3CD6P 5F2NA 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  2Z46 A;  2PEM A;  2PEJ A;  2PY8 A;  2PEK A;  2Z45 A;  4GR6 A;  3HYB A;  2PEI A;  5BS1 A;  4GR2 A;  3RG6 C;  2Z44 A;  3Q20 A;  2PEO A;  5BS2 A;  2PEN A; 
#chains in the Genus database with same CATH topology
 2GDY A;  2Z46 A;  2L22 A;  1YHQ P;  3CCL P;  3HYB A;  2GZE A;  5BS1 A;  3H47 A;  1D1D A;  3B5I A;  3CCU P;  2JQ4 A;  1VQ7 P;  2MY5 A;  2KOP A;  1M1K Q;  1A43 A;  4BPG A;  2MD9 A;  5KP6 B;  2P9X A;  5HVC A;  2XT1 A;  2N50 A;  2NO8 A;  1M74 A;  5JPA A;  3G21 A;  2KGE A;  3M1M A;  1T8K A;  4COC A;  2MF4 A;  2PEK A;  2JYG A;  1YJW P;  1EIA A;  2K5X A;  1VQM P;  2VLQ A;  2KOS A;  2N6Z A;  3DPH A;  3LRY A;  1Q7Y Q;  4H2W C;  2LL8 A;  2KGC A;  3DTJ A;  2Z44 A;  2FQ1 A;  3B4Q A;  4XRO A;  1BAJ A;  2XZ0 D;  4XFZ A;  2KWL A;  2GZI A;  5CZD B;  2OTL P;  2PEI A;  3E2D A;  3CCM P;  1RO0 A;  5HGM A;  2K0Y A;  1VQL P;  3G29 A;  4UHP B;  2MVV A;  2N6Y A;  1EOQ A;  2JB0 A;  3CMA P;  5I4T G;  1FR2 A;  5DCK A;  2CNR A;  3CC7 P;  5HV8 A;  4PXH B;  1HQB A;  2KOQ A;  2N5H A;  3EJD A;  1DNY A;  4NEO A;  3I56 P;  2LPK A;  2GDW A;  3CC4 P;  1VQP P;  2MR7 A;  1EMV A;  2KOR A;  2KOO A;  2EG5 A;  5EJD A;  4COP A;  3G71 P;  1MZ8 A;  5F2O A;  1NJI Q;  3G4S P;  4HKG A;  2CWO A;  4PWV B;  4WYM A;  2BUO A;  1Q86 Q;  2CGQ A;  2JBG A;  2E1M A;  3CCQ P;  1KLP A;  3GJN A;  4PH1 A;  1K30 A;  1S72 P;  1VQK P;  1YJ9 P;  1YI2 P;  3CC2 P;  3CCV P;  5KP7 B;  7CEI A;  2KOD A;  3DS2 A;  3P05 A;  2PEO A;  3GZL A;  2X2B A;  2K92 A;  2AVA A;  1L0H A;  2GYK A;  5HGL A;  4R0M A;  2M8P A;  3LMO A;  2FVE A;  4BPF A;  1E0H A;  3WBH A;  1YIJ P;  2FHS C;  2ONT A;  1IMP A;  4M0I A;  1X3O A;  1DV5 A;  1NQ4 A;  1VQO P;  1KD1 Q;  2VLN A;  2FVF A;  2EIA A;  2M8N A;  1K73 Q;  1QVF O;  3G26 A;  5EW5 E;  1OR5 A;  3RG2 A;  2MVU A;  3DS0 A;  3CD6 P;  5F2N A;  2MR8 A;  2JU1 A;  3CCS P;  4XFY A;  2FQ0 A;  3RG6 C;  2GZJ A;  2VLO A;  2AF8 A;  4U0F A;  1UJZ A;  2LKI A;  4U0C A;  3H0D A;  1Z6M A;  1K8A Q;  2ERH A;  2K0X A;  2PY8 A;  1QRJ A;  2FAC A;  1JJ2 O;  1AYI A;  2KG6 A;  2M5R A;  1E6J P;  2PEJ A;  3HZQ A;  3GKL C;  3VRL C;  3G1I A;  2QNW A;  4U0A A;  2QEX P;  5F2K A;  1UNK A;  2K0D X;  5KP8 B;  2FVA A;  2K2Q A;  4QNB A;  3G6E P;  3DS1 A;  2KG9 A;  2L6E A;  2CG5 B;  3H4E A;  3DS5 A;  4U0E A;  3U43 A;  2VLP A;  4DG9 A;  4IPY A;  2FAD A;  4H2Y C;  1VQ5 P;  1VQ4 P;  1KQS O;  2L4B A;  2DNW A;  2N5I A;  1BXI A;  2KR5 A;  2XXM A;  1KC8 Q;  2OTJ P;  1Q82 Q;  1M90 Q;  3EJE A;  2GDX A;  4BPH A;  2PNG A;  2FAE A;  4IZ6 A;  2KGD A;  3CPW O;  2VSQ A;  2EHT A;  5BS2 A;  2AFD A;  3I55 P;  2L9F A;  1VQ8 P;  3CME P;  1GXH A;  2GZG A;  2L0Q A;  1K9M Q;  2JO0 A;  4GR6 A;  2WPT A;  3CCE P;  2KW2 A;  2QA4 P;  4PH0 A;  4GR2 A;  3Q20 A;  2N98 A;  4MRT C;  3MGE A;  1CEI A;  1AUM A;  1N8R Q;  1VQ6 P;  1HY8 A;  4U0D A;  1GPJ A;  2OAR A;  1ZNV A;  2JYL A;  1VQN P;  1ZMB A;  1YIT P;  2JU2 A;  1VHN A;  3CE7 A;  2LIU A;  3G1G A;  1RO2 A;  2GZF A;  4F37 A;  2LF4 A;  2XV6 A;  2PEQ A;  1VQ9 P;  4H2X C;  3DS4 A;  3CXC O;  2ROQ A;  2K93 A;  2FQ2 A;  2XZ1 C;  3NTE A;  1IMQ A;  1QVG O;  1L0I A;  4XRQ A;  3NY7 B;  2CQ8 A;  1Q81 Q;  1GXG A;  2KG8 A;  2EHS A;  4U0B A;  1F80 D;  1VKU A;  1W2B O;  1A8O A;  1RNI A;  3CCJ P;  4XFX A;  2JGP A;  2PEN A;  2Z45 A;  2DGY A;  2LML A;  5HGN A;  4QKO A;  5HGO A;  2EFJ A;  2LIW A;  2AFE A;  4CA3 A;  3CCR P;  3G0V A;  3GZM A;  3OW2 O;  1AF8 A;  2BHV A;  2LOL A;  2JAZ A;  1IUQ A;  1M6E X;  2PEM A;  1M6N A;  3EJB A;  1ACP A;  2KGA A;  2M8L A;  1YJN P;  3DS3 A;  2LTE A;  2K94 A;  3G28 A; 
#chains in the Genus database with same CATH homology
 2Z46 A;  3CCS P;  2QA4 P;  1YHQ P;  4XFY A;  4PH0 A;  3CCL P;  4GR2 A;  3RG6 C;  3Q20 A;  3I56 P;  3MGE A;  4U0F A;  3CC4 P;  3HYB A;  5BS1 A;  1AUM A;  1N8R Q;  3H47 A;  1VQ6 P;  1D1D A;  3B5I A;  4U0C A;  4U0D A;  3H0D A;  2OAR A;  1VQP P;  3CCU P;  2EG5 A;  2JYL A;  4COP A;  3G71 P;  1VQ7 P;  1VQN P;  1M1K Q;  5F2O A;  1K8A Q;  1NJI Q;  1ZMB A;  3G4S P;  1YIT P;  2PY8 A;  1A43 A;  2CWO A;  1QRJ A;  4WYM A;  2BUO A;  1JJ2 O;  2P9X A;  1Q86 Q;  2PEJ A;  1E6J P;  2XT1 A;  3HZQ A;  3VRL C;  3G1G A;  3G1I A;  1RO2 A;  2E1M A;  3CCQ P;  4U0A A;  2LF4 A;  2XV6 A;  2PEQ A;  1M74 A;  5JPA A;  2QEX P;  5F2K A;  1VQ9 P;  3G21 A;  4PH1 A;  3DS4 A;  3CXC O;  1K30 A;  1S72 P;  1VQK P;  3M1M A;  4COC A;  1YJ9 P;  1YI2 P;  3CC2 P;  4QNB A;  3CCV P;  3NTE A;  3G6E P;  1QVG O;  2PEK A;  4XRQ A;  3DS1 A;  2L6E A;  2JYG A;  2KOD A;  1YJW P;  1EIA A;  1Q81 Q;  3DS2 A;  1VQM P;  3P05 A;  3H4E A;  3DS5 A;  2PEO A;  3DPH A;  4U0B A;  3LRY A;  4U0E A;  1Q7Y Q;  3DTJ A;  1W2B O;  1A8O A;  4IPY A;  1RNI A;  3CCJ P;  2Z44 A;  4XFX A;  1VQ5 P;  5HGL A;  2PEN A;  1VQ4 P;  1KQS O;  2Z45 A;  2M8P A;  2DGY A;  5HGN A;  4XRO A;  1BAJ A;  2XXM A;  1KC8 Q;  2OTJ P;  3WBH A;  1YIJ P;  4XFZ A;  5HGO A;  1Q82 Q;  2EFJ A;  2ONT A;  3CCR P;  1M90 Q;  3G0V A;  3OW2 O;  4M0I A;  2PEI A;  2OTL P;  3E2D A;  3CCM P;  1RO0 A;  1VQO P;  1KD1 Q;  5HGM A;  2BHV A;  3CPW O;  2EIA A;  1VQL P;  2M8N A;  3G29 A;  5BS2 A;  3I55 P;  1K73 Q;  1IUQ A;  1EOQ A;  1M6E X;  1M6N A;  2PEM A;  3CMA P;  1QVF O;  5I4T G;  2M8L A;  3G26 A;  5DCK A;  1YJN P;  1VQ8 P;  3CME P;  1K9M Q;  2JO0 A;  4GR6 A;  3DS3 A;  3CCE P;  3CC7 P;  3DS0 A;  3CD6 P;  5F2N A;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...