3Q20A

Crystal structure of rbcx c103a mutant from thermosynechococcus elongatus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
114
structure length
114
Chain Sequence
MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRAQQLERMTQVSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the RuBisCO chaperone RbcX from the thermophilic cyanobacterium Thermosynechococcus elongatus
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Chaperone
molecule keywords RbcX protein
total genus 49
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3q20A00
4GR2A 2PEOA 2PEJA 5BS2A 3Q20A 2PEIA 4GR6A 2PEQA 2Z45A 3HYBA 3RG6C 2PEKA 2PY8A 5BS1A 2Z44A 2Z46A 2PEMA 2PENA
chains in the Genus database with same CATH superfamily
2VSQA 3CCLP 1FR2A 4H2YC 1IMPA 3G0VA 1S72P 1F80D 2MD9A 1Q7YQ 4COCA 1VQ9P 4U0DA 2FQ0A 1RO0A 3EJDA 4MRTC 2GZIA 1YHQP 5HVCA 2M8LA 1ZMBA 2X2BA 1QVFO 5EJDA 2QEXP 2MY5A 2LOLA 2JQ4A 2K5XA 2DGYA 1K9MQ 2BUOA 3G71P 2AVAA 4F37A 2Z46A 1VQOP 2KOOA 3RG2A 1A8OA 2ERHA 1Q86Q 2FVFA 1VQ5P 2KG8A 2GZJA 5KP7B 3CPWO 1OR5A 1E6JP 1M90Q 1GXHA 3I56P 2FAEA 5I4TG 2EHTA 2GZFA 2KWLA 3G1IA 4XFZA 4PH1A 2BHVA 2K92A 1M1KQ 2XXMA 3NY7B 1KD1Q 2MVUA 1BXIA 2Z45A 2L22A 5HGLA 2K94A 2KGCA 3HZQA 1HY8A 2QNWA 3GJNA 3G1GA 2P9XA 2VLPA 2OARA 1YJWP 2PEKA 1CEIA 4QNBA 1UJZA 2FACA 3DS5A 5KP8B 1YJ9P 1W2BO 2FQ1A 4XFYA 5BS2A 3RG6C 2KG6A 2OTLP 1NQ4A 2FQ2A 2CG5B 5JPAA 3WBHA 2K0YA 3H4EA 2JYLA 2LIWA 1Q82Q 3G4SP 1D1DA 3E2DA 4COPA 1AF8A 3DS3A 1VQ6P 1NJIQ 1VHNA 1DV5A 1VQ8P 4DG9A 2ROQA 2JGPA 4NEOA 2N5IA 3G26A 1VQMP 5DCKA 3CCVP 4WYMA 4PWVB 3EJBA 2EHSA 2MR7A 5EW5E 3B5IA 2M8NA 1VQNP 3U43A 2KGDA 5F2OA 1MZ8A 3CC7P 2L6EA 1RO2A 5F2NA 2PY8A 2KGAA 2KG9A 3GZLA 2AFEA 1YITP 1T8KA 2JU1A 3NTEA 3LMOA 1L0IA 2GYKA 4IPYA 3Q20A 1UNKA 1DNYA 1M74A 2FVAA 3B4QA 2GDXA 2XZ0D 3G29A 2KORA 2MVVA 2LIUA 3CE7A 2FVEA 2K0DX 2LKIA 4UHPB 1X3OA 1N8RQ 1VQ4P 1QRJA 1M6EX 3GZMA 2PEIA 2EFJA 4H2XC 3DS1A 2CWOA 3HYBA 2LL8A 5HGNA 3MGEA 1Q81Q 2L9FA 4BPFA 1IUQA 4U0FA 2Z44A 4H2WC 1BAJA 2KOQA 3CD6P 1EIAA 4U0CA 2LF4A 2WPTA 3M1MA 2M8PA 2AFDA 2N98A 3CCUP 2GDWA 1VQKP 2VLOA 3H47A 1K73Q 2LMLA 5HGMA 4R0MA 2PEJA 1IMQA 2MR8A 2PEQA 2XV6A 1KQSO 7CEIA 5KP6B 2KW2A 1K30A 3DS0A 3CCQP 2PEOA 2CGQA 4U0EA 2QA4P 4HKGA 3CCSP 1Z6MA 3CCJP 4PXHB 5CZDB 2PENA 3CCEP 2XZ1C 4QKOA 5F2KA 2K2QA 4XFXA 2KGEA 3OW2O 3G6EP 3CXCO 1AYIA 1YI2P 1VQPP 4U0BA 2NO8A 1KLPA 2VLQA 1AUMA 2KOSA 2CNRA 1YJNP 5BS1A 3CMEP 1KC8Q 2E1MA 2N6ZA 2LPKA 1ACPA 3EJEA 2K93A 4CA3A 3CCMP 3I55P 1K8AQ 1VKUA 1RNIA 5HGOA 1M6NA 2JO0A 2K0XA 3DTJA 1VQ7P 1L0HA 2JB0A 2EIAA 2PEMA 2XT1A 3CC4P 3GKLC 1YIJP 2LTEA 2N5HA 2N6YA 1ZNVA 2M5RA 2KR5A 3LRYA 2JAZA 2JU2A 3P05A 1EOQA 3CC2P 1GXGA 3VRLC 2CQ8A 1E0HA 4XROA 3CMAP 1JJ2O 2KODA 4XRQA 4GR2A 2MF4A 2L0QA 2EG5A 3CCRP 2L4BA 4IZ6A 2GZEA 2FHSC 3G21A 3H0DA 2OTJP 4PH0A 1GPJA 4M0IA 4BPHA 1HQBA 1QVGO 2ONTA 2GDYA 2JYGA 3DS4A 1VQLP 4BPGA 1EMVA 3DPHA 2VLNA 4GR6A 2FADA 3DS2A 2AF8A 4U0AA 2DNWA 2PNGA 2N50A 3G28A 2KOPA 2GZGA 2JBGA 5HV8A 1A43A
chains in the Genus database with same CATH topology
5HGNA 3DS5A 3CCLP 1M6NA 1YJ9P 1W2BO 2JO0A 3G0VA 3MGEA 3DTJA 4XFYA 1Q81Q 5BS2A 1VQ7P 1S72P 3RG6C 1IUQA 4U0FA 2Z44A 4COCA 1Q7YQ 2EIAA 2PEMA 2XT1A 1BAJA 4U0DA 1VQ9P 3CC4P 1YIJP 5JPAA 3CD6P 3WBHA 1RO0A 1EIAA 1YHQP 4U0CA 2LF4A 2JYLA 3H4EA 2M8LA 1Q82Q 3G4SP 1ZMBA 3M1MA 1D1DA 2M8PA 1QVFO 3E2DA 4COPA 3LRYA 3CCUP 3DS3A 2QEXP 1VQ6P 1NJIQ 1VQ8P 3P05A 1EOQA 1VQKP 1VQMP 3G26A 5DCKA 3H47A 3CC2P 2DGYA 3CCVP 1K73Q 5HGMA 1K9MQ 2BUOA 3VRLC 3G71P 4WYMA 2PEJA 3B5IA 2M8NA 1VQNP 2PEQA 4XROA 2XV6A 3CMAP 1KQSO 2Z46A 5F2OA 3CC7P 2L6EA 1VQOP 1RO2A 1A8OA 5F2NA 2PY8A 1JJ2O 2KODA 1Q86Q 1K30A 3DS0A 1VQ5P 4XRQA 3CCQP 4GR2A 2PEOA 2EG5A 1YITP 3CPWO 4U0EA 3CCRP 2QA4P 1E6JP 1M90Q 3CCSP 3NTEA 3CCJP 3I56P 3G21A 2PENA 3H0DA 3CCEP 5I4TG 2OTJP 4IPYA 3Q20A 3G1IA 5F2KA 4XFXA 4PH0A 3G6EP 3OW2O 3CXCO 1M74A 4XFZA 4M0IA 1YI2P 1VQPP 4PH1A 4U0BA 2BHVA 1QVGO 3G29A 2ONTA 3DS4A 2JYGA 1AUMA 1M1KQ 2XXMA 1KD1Q 1VQLP 2Z45A 5HGLA 1YJNP 5BS1A 3CMEP 2OTLP 1KC8Q 3DPHA 4GR6A 3DS2A 2E1MA 4U0AA 1N8RQ 1VQ4P 1QRJA 1M6EX 3HZQA 2PEIA 3G28A 3G1GA 2P9XA 2EFJA 2OARA 3I55P 3CCMP 1YJWP 1K8AQ 3DS1A 2CWOA 3HYBA 1RNIA 2PEKA 5HGOA 4QNBA 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR2 A;  2PEO A;  2PEJ A;  5BS2 A;  3Q20 A;  2PEI A;  4GR6 A;  2PEQ A;  2Z45 A;  3HYB A;  3RG6 C;  2PEK A;  2PY8 A;  5BS1 A;  2Z44 A;  2Z46 A;  2PEM A;  2PEN A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  3CCL P;  1FR2 A;  4H2Y C;  1IMP A;  3G0V A;  1S72 P;  1F80 D;  2MD9 A;  1Q7Y Q;  4COC A;  1VQ9 P;  4U0D A;  2FQ0 A;  1RO0 A;  3EJD A;  4MRT C;  2GZI A;  1YHQ P;  5HVC A;  2M8L A;  1ZMB A;  2X2B A;  1QVF O;  5EJD A;  2QEX P;  2MY5 A;  2LOL A;  2JQ4 A;  2K5X A;  2DGY A;  1K9M Q;  2BUO A;  3G71 P;  2AVA A;  4F37 A;  2Z46 A;  1VQO P;  2KOO A;  3RG2 A;  1A8O A;  2ERH A;  1Q86 Q;  2FVF A;  1VQ5 P;  2KG8 A;  2GZJ A;  5KP7 B;  3CPW O;  1OR5 A;  1E6J P;  1M90 Q;  1GXH A;  3I56 P;  2FAE A;  5I4T G;  2EHT A;  2GZF A;  2KWL A;  3G1I A;  4XFZ A;  4PH1 A;  2BHV A;  2K92 A;  1M1K Q;  2XXM A;  3NY7 B;  1KD1 Q;  2MVU A;  1BXI A;  2Z45 A;  2L22 A;  5HGL A;  2K94 A;  2KGC A;  3HZQ A;  1HY8 A;  2QNW A;  3GJN A;  3G1G A;  2P9X A;  2VLP A;  2OAR A;  1YJW P;  2PEK A;  1CEI A;  4QNB A;  1UJZ A;  2FAC A;  3DS5 A;  5KP8 B;  1YJ9 P;  1W2B O;  2FQ1 A;  4XFY A;  5BS2 A;  3RG6 C;  2KG6 A;  2OTL P;  1NQ4 A;  2FQ2 A;  2CG5 B;  5JPA A;  3WBH A;  2K0Y A;  3H4E A;  2JYL A;  2LIW A;  1Q82 Q;  3G4S P;  1D1D A;  3E2D A;  4COP A;  1AF8 A;  3DS3 A;  1VQ6 P;  1NJI Q;  1VHN A;  1DV5 A;  1VQ8 P;  4DG9 A;  2ROQ A;  2JGP A;  4NEO A;  2N5I A;  3G26 A;  1VQM P;  5DCK A;  3CCV P;  4WYM A;  4PWV B;  3EJB A;  2EHS A;  2MR7 A;  5EW5 E;  3B5I A;  2M8N A;  1VQN P;  3U43 A;  2KGD A;  5F2O A;  1MZ8 A;  3CC7 P;  2L6E A;  1RO2 A;  5F2N A;  2PY8 A;  2KGA A;  2KG9 A;  3GZL A;  2AFE A;  1YIT P;  1T8K A;  2JU1 A;  3NTE A;  3LMO A;  1L0I A;  2GYK A;  4IPY A;  3Q20 A;  1UNK A;  1DNY A;  1M74 A;  2FVA A;  3B4Q A;  2GDX A;  2XZ0 D;  3G29 A;  2KOR A;  2MVV A;  2LIU A;  3CE7 A;  2FVE A;  2K0D X;  2LKI A;  4UHP B;  1X3O A;  1N8R Q;  1VQ4 P;  1QRJ A;  1M6E X;  3GZM A;  2PEI A;  2EFJ A;  4H2X C;  3DS1 A;  2CWO A;  3HYB A;  2LL8 A;  5HGN A;  3MGE A;  1Q81 Q;  2L9F A;  4BPF A;  1IUQ A;  4U0F A;  2Z44 A;  4H2W C;  1BAJ A;  2KOQ A;  3CD6 P;  1EIA A;  4U0C A;  2LF4 A;  2WPT A;  3M1M A;  2M8P A;  2AFD A;  2N98 A;  3CCU P;  2GDW A;  1VQK P;  2VLO A;  3H47 A;  1K73 Q;  2LML A;  5HGM A;  4R0M A;  2PEJ A;  1IMQ A;  2MR8 A;  2PEQ A;  2XV6 A;  1KQS O;  7CEI A;  5KP6 B;  2KW2 A;  1K30 A;  3DS0 A;  3CCQ P;  2PEO A;  2CGQ A;  4U0E A;  2QA4 P;  4HKG A;  3CCS P;  1Z6M A;  3CCJ P;  4PXH B;  5CZD B;  2PEN A;  3CCE P;  2XZ1 C;  4QKO A;  5F2K A;  2K2Q A;  4XFX A;  2KGE A;  3OW2 O;  3G6E P;  3CXC O;  1AYI A;  1YI2 P;  1VQP P;  4U0B A;  2NO8 A;  1KLP A;  2VLQ A;  1AUM A;  2KOS A;  2CNR A;  1YJN P;  5BS1 A;  3CME P;  1KC8 Q;  2E1M A;  2N6Z A;  2LPK A;  1ACP A;  3EJE A;  2K93 A;  4CA3 A;  3CCM P;  3I55 P;  1K8A Q;  1VKU A;  1RNI A;  5HGO A;  1M6N A;  2JO0 A;  2K0X A;  3DTJ A;  1VQ7 P;  1L0H A;  2JB0 A;  2EIA A;  2PEM A;  2XT1 A;  3CC4 P;  3GKL C;  1YIJ P;  2LTE A;  2N5H A;  2N6Y A;  1ZNV A;  2M5R A;  2KR5 A;  3LRY A;  2JAZ A;  2JU2 A;  3P05 A;  1EOQ A;  3CC2 P;  1GXG A;  3VRL C;  2CQ8 A;  1E0H A;  4XRO A;  3CMA P;  1JJ2 O;  2KOD A;  4XRQ A;  4GR2 A;  2MF4 A;  2L0Q A;  2EG5 A;  3CCR P;  2L4B A;  4IZ6 A;  2GZE A;  2FHS C;  3G21 A;  3H0D A;  2OTJ P;  4PH0 A;  1GPJ A;  4M0I A;  4BPH A;  1HQB A;  1QVG O;  2ONT A;  2GDY A;  2JYG A;  3DS4 A;  1VQL P;  4BPG A;  1EMV A;  3DPH A;  2VLN A;  4GR6 A;  2FAD A;  3DS2 A;  2AF8 A;  4U0A A;  2DNW A;  2PNG A;  2N50 A;  3G28 A;  2KOP A;  2GZG A;  2JBG A;  5HV8 A;  1A43 A; 
#chains in the Genus database with same CATH homology
 5HGN A;  3DS5 A;  3CCL P;  1M6N A;  1YJ9 P;  1W2B O;  2JO0 A;  3G0V A;  3MGE A;  3DTJ A;  4XFY A;  1Q81 Q;  5BS2 A;  1VQ7 P;  1S72 P;  3RG6 C;  1IUQ A;  4U0F A;  2Z44 A;  4COC A;  1Q7Y Q;  2EIA A;  2PEM A;  2XT1 A;  1BAJ A;  4U0D A;  1VQ9 P;  3CC4 P;  1YIJ P;  5JPA A;  3CD6 P;  3WBH A;  1RO0 A;  1EIA A;  1YHQ P;  4U0C A;  2LF4 A;  2JYL A;  3H4E A;  2M8L A;  1Q82 Q;  3G4S P;  1ZMB A;  3M1M A;  1D1D A;  2M8P A;  1QVF O;  3E2D A;  4COP A;  3LRY A;  3CCU P;  3DS3 A;  2QEX P;  1VQ6 P;  1NJI Q;  1VQ8 P;  3P05 A;  1EOQ A;  1VQK P;  1VQM P;  3G26 A;  5DCK A;  3H47 A;  3CC2 P;  2DGY A;  3CCV P;  1K73 Q;  5HGM A;  1K9M Q;  2BUO A;  3VRL C;  3G71 P;  4WYM A;  2PEJ A;  3B5I A;  2M8N A;  1VQN P;  2PEQ A;  4XRO A;  2XV6 A;  3CMA P;  1KQS O;  2Z46 A;  5F2O A;  3CC7 P;  2L6E A;  1VQO P;  1RO2 A;  1A8O A;  5F2N A;  2PY8 A;  1JJ2 O;  2KOD A;  1Q86 Q;  1K30 A;  3DS0 A;  1VQ5 P;  4XRQ A;  3CCQ P;  4GR2 A;  2PEO A;  2EG5 A;  1YIT P;  3CPW O;  4U0E A;  3CCR P;  2QA4 P;  1E6J P;  1M90 Q;  3CCS P;  3NTE A;  3CCJ P;  3I56 P;  3G21 A;  2PEN A;  3H0D A;  3CCE P;  5I4T G;  2OTJ P;  4IPY A;  3Q20 A;  3G1I A;  5F2K A;  4XFX A;  4PH0 A;  3G6E P;  3OW2 O;  3CXC O;  1M74 A;  4XFZ A;  4M0I A;  1YI2 P;  1VQP P;  4PH1 A;  4U0B A;  2BHV A;  1QVG O;  3G29 A;  2ONT A;  3DS4 A;  2JYG A;  1AUM A;  1M1K Q;  2XXM A;  1KD1 Q;  1VQL P;  2Z45 A;  5HGL A;  1YJN P;  5BS1 A;  3CME P;  2OTL P;  1KC8 Q;  3DPH A;  4GR6 A;  3DS2 A;  2E1M A;  4U0A A;  1N8R Q;  1VQ4 P;  1QRJ A;  1M6E X;  3HZQ A;  2PEI A;  3G28 A;  3G1G A;  2P9X A;  2EFJ A;  2OAR A;  3I55 P;  3CCM P;  1YJW P;  1K8A Q;  3DS1 A;  2CWO A;  3HYB A;  1RNI A;  2PEK A;  5HGO A;  4QNB A;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...