3Q20A

Crystal structure of rbcx c103a mutant from thermosynechococcus elongatus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
114
structure length
114
Chain Sequence
MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRAQQLERMTQVSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RbcX protein
publication title Structure of the RuBisCO chaperone RbcX from the thermophilic cyanobacterium Thermosynechococcus elongatus
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Chaperone
total genus 49
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3q20A00
2PEJA 2Z46A 2PEOA 2PEQA 4GR2A 5BS2A 3RG6C 3Q20A 2PEMA 2PEIA 2PENA 2Z45A 3HYBA 4GR6A 5BS1A 2PEKA 2Z44A 2PY8A
chains in the Genus database with same CATH superfamily
2MY5A 3CCSP 2LIWA 1FR2A 5HGLA 2OTLP 3G1GA 1OR5A 1JJ2O 5HGOA 1N8RQ 2VLPA 2MR8A 3I56P 2AVAA 2MR7A 5KP8B 4BPHA 3VRLC 4PWVB 2BUOA 2FVAA 1KQSO 5JPAA 2KOPA 2MF4A 1VHNA 2KG6A 2PEIA 2JYGA 3E2DA 2AF8A 3DS1A 5DCKA 3G4SP 3CCMP 1E0HA 2M8NA 2CWOA 2JQ4A 2EIAA 1K8AQ 1M1KQ 4PH0A 1Q81Q 2MVVA 2PEOA 3CE7A 2KG9A 2ONTA 1VQ5P 1YITP 2K0YA 1VQ7P 7CEIA 2ROQA 2PEQA 2Z44A 3G71P 2MVUA 2K92A 2EHSA 2GZJA 3DS5A 4UHPB 2EG5A 3CCEP 2JU2A 1A43A 2GZEA 2CG5B 3B5IA 3DS4A 1L0HA 1E6JP 3GJNA 2PENA 1UJZA 3CPWO 2QA4P 1UNKA 3M1MA 2FVEA 2KGCA 5HV8A 1QVFO 5KP6B 4IZ6A 4XFXA 4QKOA 4H2WC 3DPHA 3RG6C 1M6EX 2KWLA 2L22A 4M0IA 4COPA 3H47A 3G6EP 3CCUP 2GZGA 5I4TG 3CCLP 3H4EA 4QNBA 2LIUA 3P05A 2LL8A 2FVFA 2E1MA 1Q7YQ 1VQOP 4DG9A 2KGDA 3GZLA 3NTEA 4MRTC 2VLOA 2M5RA 2L9FA 5F2NA 5CZDB 2DGYA 3CXCO 1RNIA 1Q86Q 2KOSA 2CNRA 1QRJA 1ACPA 1BAJA 2PNGA 2N98A 1IMPA 2KOOA 2LMLA 4CA3A 2XV6A 4HKGA 4BPFA 3CC7P 2N6YA 2Z46A 2XZ1C 4XRQA 5BS1A 1KLPA 1VQLP 2OARA 5EJDA 3EJBA 3GKLC 1AUMA 2KOQA 3CCJP 2GYKA 2K2QA 3LMOA 1VQPP 4XFZA 2PY8A 1YIJP 2LF4A 2K94A 1X3OA 4GR2A 1EOQA 3U43A 2JU1A 2WPTA 2JBGA 4XROA 4U0AA 4BPGA 3HYBA 3G1IA 2GDYA 1AYIA 1QVGO 2KR5A 2DNWA 5HGNA 2KORA 3RG2A 1VQMP 2KGAA 2KW2A 2N6ZA 5F2KA 2VSQA 2LKIA 1M90Q 2CQ8A 3DTJA 3G0VA 2P9XA 5HVCA 2K93A 4NEOA 3G29A 4PXHB 1HQBA 1VQ4P 1KC8Q 5F2OA 1VKUA 2NO8A 2M8PA 4U0FA 1GXGA 2JB0A 3EJEA 4COCA 2JYLA 1VQ6P 3CD6P 1DV5A 3G28A 5EW5E 2N5HA 1NJIQ 2FHSC 2LTEA 2VLNA 2L4BA 1L0IA 2XT1A 2AFDA 2QNWA 1D1DA 3LRYA 4U0EA 3CCRP 2L0QA 2LPKA 2PEKA 3B4QA 3DS3A 1CEIA 2K5XA 1W2BO 3WBHA 2PEJA 4IPYA 2K0XA 4WYMA 1YJWP 2PEMA 2JGPA 4H2XC 2N50A 3G26A 5BS2A 1BXIA 2M8LA 1T8KA 1MZ8A 1F80D 1K9MQ 1GPJA 2BHVA 1Q82Q 2KGEA 1VQNP 1IMQA 2GZFA 1ZNVA 1VQKP 2K0DX 2XXMA 1RO0A 1IUQA 2AFEA 2N5IA 2XZ0D 2QEXP 3HZQA 4U0BA 2FQ1A 3G21A 3EJDA 1ZMBA 1EMVA 3CCQP 1YJNP 1YI2P 1YHQP 1S72P 1RO2A 2FQ0A 2GZIA 3Q20A 2MD9A 4U0DA 2LOLA 4GR6A 4PH1A 2OTJP 3H0DA 2ERHA 5KP7B 2KG8A 4XFYA 1M74A 5HGMA 3OW2O 1M6NA 3CCVP 1EIAA 2FADA 3GZMA 1YJ9P 3CC2P 2CGQA 1AF8A 2GDXA 4R0MA 2GDWA 3I55P 3NY7B 4H2YC 2Z45A 3CMAP 3DS2A 2FQ2A 1KD1Q 2L6EA 2EHTA 3MGEA 1HY8A 2FAEA 1Z6MA 2JO0A 4F37A 2KODA 1DNYA 2VLQA 3DS0A 3CC4P 1VQ8P 1K30A 2EFJA 1A8OA 1NQ4A 4U0CA 2X2BA 1K73Q 1GXHA 2FACA 1VQ9P 3CMEP 2JAZA
chains in the Genus database with same CATH topology
4XFXA 3CCSP 4XROA 1VQKP 2XXMA 4U0AA 1RO0A 3DPHA 5HGLA 3HYBA 1IUQA 2OTLP 3G1IA 3G1GA 1JJ2O 3RG6C 5HGOA 1M6EX 1N8RQ 1QVGO 4M0IA 5HGNA 3I56P 2QEXP 3HZQA 4U0BA 4COPA 3VRLC 3H47A 3G21A 1ZMBA 1VQMP 2BUOA 3G6EP 3CCUP 5I4TG 3CCLP 3H4EA 3CCQP 4QNBA 5F2KA 3P05A 5JPAA 1YJNP 1M90Q 1KQSO 1YI2P 1YHQP 1S72P 1RO2A 3DTJA 3G0VA 3Q20A 2PEIA 2E1MA 2P9XA 1Q7YQ 4U0DA 1VQOP 3G29A 2JYGA 3NTEA 4GR6A 3E2DA 4PH1A 1VQ4P 1KC8Q 3DS1A 5DCKA 3G4SP 2OTJP 5F2NA 3CCMP 2M8NA 3H0DA 2DGYA 2CWOA 1RNIA 3CXCO 5F2OA 1Q86Q 2EIAA 2M8PA 4U0FA 4XFYA 1M74A 5HGMA 4COCA 1M6NA 3CCVP 3OW2O 4PH0A 1EIAA 1K8AQ 1Q81Q 1M1KQ 2JYLA 1QRJA 1VQ6P 3CD6P 1BAJA 2PEOA 3G28A 1YJ9P 3CC2P 1NJIQ 2ONTA 1VQ5P 1YITP 2XV6A 2XT1A 3I55P 3CC7P 1VQ7P 2Z46A 2PEQA 1D1DA 3LRYA 2Z45A 4U0EA 4XRQA 3CMAP 3CCRP 3DS2A 2PEKA 2Z44A 5BS1A 3G71P 3DS3A 1VQLP 1KD1Q 2L6EA 2OARA 3MGEA 1W2BO 3WBHA 1AUMA 3DS5A 2PEJA 4IPYA 2EG5A 3CCJP 3CCEP 1VQPP 1A43A 4WYMA 2JO0A 4XFZA 1YJWP 2PY8A 3B5IA 3DS4A 2KODA 1YIJP 1E6JP 2LF4A 2PEMA 3DS0A 3CC4P 3G26A 1VQ8P 5BS2A 4GR2A 2M8LA 1K30A 2EFJA 2PENA 1EOQA 1A8OA 4U0CA 3CPWO 1K9MQ 1K73Q 2QA4P 3M1MA 2BHVA 1QVFO 1Q82Q 1VQNP 1VQ9P 3CMEP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEJ A;  2Z46 A;  2PEO A;  2PEQ A;  4GR2 A;  5BS2 A;  3RG6 C;  3Q20 A;  2PEM A;  2PEI A;  2PEN A;  2Z45 A;  3HYB A;  4GR6 A;  5BS1 A;  2PEK A;  2Z44 A;  2PY8 A; 
#chains in the Genus database with same CATH topology
 2MY5 A;  3CCS P;  2LIW A;  1FR2 A;  5HGL A;  2OTL P;  3G1G A;  1OR5 A;  1JJ2 O;  5HGO A;  1N8R Q;  2VLP A;  2MR8 A;  3I56 P;  2AVA A;  2MR7 A;  5KP8 B;  4BPH A;  3VRL C;  4PWV B;  2BUO A;  2FVA A;  1KQS O;  5JPA A;  2KOP A;  2MF4 A;  1VHN A;  2KG6 A;  2PEI A;  2JYG A;  3E2D A;  2AF8 A;  3DS1 A;  5DCK A;  3G4S P;  3CCM P;  1E0H A;  2M8N A;  2CWO A;  2JQ4 A;  2EIA A;  1K8A Q;  1M1K Q;  4PH0 A;  1Q81 Q;  2MVV A;  2PEO A;  3CE7 A;  2KG9 A;  2ONT A;  1VQ5 P;  1YIT P;  2K0Y A;  1VQ7 P;  7CEI A;  2ROQ A;  2PEQ A;  2Z44 A;  3G71 P;  2MVU A;  2K92 A;  2EHS A;  2GZJ A;  3DS5 A;  4UHP B;  2EG5 A;  3CCE P;  2JU2 A;  1A43 A;  2GZE A;  2CG5 B;  3B5I A;  3DS4 A;  1L0H A;  1E6J P;  3GJN A;  2PEN A;  1UJZ A;  3CPW O;  2QA4 P;  1UNK A;  3M1M A;  2FVE A;  2KGC A;  5HV8 A;  1QVF O;  5KP6 B;  4IZ6 A;  4XFX A;  4QKO A;  4H2W C;  3DPH A;  3RG6 C;  1M6E X;  2KWL A;  2L22 A;  4M0I A;  4COP A;  3H47 A;  3G6E P;  3CCU P;  2GZG A;  5I4T G;  3CCL P;  3H4E A;  4QNB A;  2LIU A;  3P05 A;  2LL8 A;  2FVF A;  2E1M A;  1Q7Y Q;  1VQO P;  4DG9 A;  2KGD A;  3GZL A;  3NTE A;  4MRT C;  2VLO A;  2M5R A;  2L9F A;  5F2N A;  5CZD B;  2DGY A;  3CXC O;  1RNI A;  1Q86 Q;  2KOS A;  2CNR A;  1QRJ A;  1ACP A;  1BAJ A;  2PNG A;  2N98 A;  1IMP A;  2KOO A;  2LML A;  4CA3 A;  2XV6 A;  4HKG A;  4BPF A;  3CC7 P;  2N6Y A;  2Z46 A;  2XZ1 C;  4XRQ A;  5BS1 A;  1KLP A;  1VQL P;  2OAR A;  5EJD A;  3EJB A;  3GKL C;  1AUM A;  2KOQ A;  3CCJ P;  2GYK A;  2K2Q A;  3LMO A;  1VQP P;  4XFZ A;  2PY8 A;  1YIJ P;  2LF4 A;  2K94 A;  1X3O A;  4GR2 A;  1EOQ A;  3U43 A;  2JU1 A;  2WPT A;  2JBG A;  4XRO A;  4U0A A;  4BPG A;  3HYB A;  3G1I A;  2GDY A;  1AYI A;  1QVG O;  2KR5 A;  2DNW A;  5HGN A;  2KOR A;  3RG2 A;  1VQM P;  2KGA A;  2KW2 A;  2N6Z A;  5F2K A;  2VSQ A;  2LKI A;  1M90 Q;  2CQ8 A;  3DTJ A;  3G0V A;  2P9X A;  5HVC A;  2K93 A;  4NEO A;  3G29 A;  4PXH B;  1HQB A;  1VQ4 P;  1KC8 Q;  5F2O A;  1VKU A;  2NO8 A;  2M8P A;  4U0F A;  1GXG A;  2JB0 A;  3EJE A;  4COC A;  2JYL A;  1VQ6 P;  3CD6 P;  1DV5 A;  3G28 A;  5EW5 E;  2N5H A;  1NJI Q;  2FHS C;  2LTE A;  2VLN A;  2L4B A;  1L0I A;  2XT1 A;  2AFD A;  2QNW A;  1D1D A;  3LRY A;  4U0E A;  3CCR P;  2L0Q A;  2LPK A;  2PEK A;  3B4Q A;  3DS3 A;  1CEI A;  2K5X A;  1W2B O;  3WBH A;  2PEJ A;  4IPY A;  2K0X A;  4WYM A;  1YJW P;  2PEM A;  2JGP A;  4H2X C;  2N50 A;  3G26 A;  5BS2 A;  1BXI A;  2M8L A;  1T8K A;  1MZ8 A;  1F80 D;  1K9M Q;  1GPJ A;  2BHV A;  1Q82 Q;  2KGE A;  1VQN P;  1IMQ A;  2GZF A;  1ZNV A;  1VQK P;  2K0D X;  2XXM A;  1RO0 A;  1IUQ A;  2AFE A;  2N5I A;  2XZ0 D;  2QEX P;  3HZQ A;  4U0B A;  2FQ1 A;  3G21 A;  3EJD A;  1ZMB A;  1EMV A;  3CCQ P;  1YJN P;  1YI2 P;  1YHQ P;  1S72 P;  1RO2 A;  2FQ0 A;  2GZI A;  3Q20 A;  2MD9 A;  4U0D A;  2LOL A;  4GR6 A;  4PH1 A;  2OTJ P;  3H0D A;  2ERH A;  5KP7 B;  2KG8 A;  4XFY A;  1M74 A;  5HGM A;  3OW2 O;  1M6N A;  3CCV P;  1EIA A;  2FAD A;  3GZM A;  1YJ9 P;  3CC2 P;  2CGQ A;  1AF8 A;  2GDX A;  4R0M A;  2GDW A;  3I55 P;  3NY7 B;  4H2Y C;  2Z45 A;  3CMA P;  3DS2 A;  2FQ2 A;  1KD1 Q;  2L6E A;  2EHT A;  3MGE A;  1HY8 A;  2FAE A;  1Z6M A;  2JO0 A;  4F37 A;  2KOD A;  1DNY A;  2VLQ A;  3DS0 A;  3CC4 P;  1VQ8 P;  1K30 A;  2EFJ A;  1A8O A;  1NQ4 A;  4U0C A;  2X2B A;  1K73 Q;  1GXH A;  2FAC A;  1VQ9 P;  3CME P;  2JAZ A; 
#chains in the Genus database with same CATH homology
 4XFX A;  3CCS P;  4XRO A;  1VQK P;  2XXM A;  4U0A A;  1RO0 A;  3DPH A;  5HGL A;  3HYB A;  1IUQ A;  2OTL P;  3G1I A;  3G1G A;  1JJ2 O;  3RG6 C;  5HGO A;  1M6E X;  1N8R Q;  1QVG O;  4M0I A;  5HGN A;  3I56 P;  2QEX P;  3HZQ A;  4U0B A;  4COP A;  3VRL C;  3H47 A;  3G21 A;  1ZMB A;  1VQM P;  2BUO A;  3G6E P;  3CCU P;  5I4T G;  3CCL P;  3H4E A;  3CCQ P;  4QNB A;  5F2K A;  3P05 A;  5JPA A;  1YJN P;  1M90 Q;  1KQS O;  1YI2 P;  1YHQ P;  1S72 P;  1RO2 A;  3DTJ A;  3G0V A;  3Q20 A;  2PEI A;  2E1M A;  2P9X A;  1Q7Y Q;  4U0D A;  1VQO P;  3G29 A;  2JYG A;  3NTE A;  4GR6 A;  3E2D A;  4PH1 A;  1VQ4 P;  1KC8 Q;  3DS1 A;  5DCK A;  3G4S P;  2OTJ P;  5F2N A;  3CCM P;  2M8N A;  3H0D A;  2DGY A;  2CWO A;  1RNI A;  3CXC O;  5F2O A;  1Q86 Q;  2EIA A;  2M8P A;  4U0F A;  4XFY A;  1M74 A;  5HGM A;  4COC A;  1M6N A;  3CCV P;  3OW2 O;  4PH0 A;  1EIA A;  1K8A Q;  1Q81 Q;  1M1K Q;  2JYL A;  1QRJ A;  1VQ6 P;  3CD6 P;  1BAJ A;  2PEO A;  3G28 A;  1YJ9 P;  3CC2 P;  1NJI Q;  2ONT A;  1VQ5 P;  1YIT P;  2XV6 A;  2XT1 A;  3I55 P;  3CC7 P;  1VQ7 P;  2Z46 A;  2PEQ A;  1D1D A;  3LRY A;  2Z45 A;  4U0E A;  4XRQ A;  3CMA P;  3CCR P;  3DS2 A;  2PEK A;  2Z44 A;  5BS1 A;  3G71 P;  3DS3 A;  1VQL P;  1KD1 Q;  2L6E A;  2OAR A;  3MGE A;  1W2B O;  3WBH A;  1AUM A;  3DS5 A;  2PEJ A;  4IPY A;  2EG5 A;  3CCJ P;  3CCE P;  1VQP P;  1A43 A;  4WYM A;  2JO0 A;  4XFZ A;  1YJW P;  2PY8 A;  3B5I A;  3DS4 A;  2KOD A;  1YIJ P;  1E6J P;  2LF4 A;  2PEM A;  3DS0 A;  3CC4 P;  3G26 A;  1VQ8 P;  5BS2 A;  4GR2 A;  2M8L A;  1K30 A;  2EFJ A;  2PEN A;  1EOQ A;  1A8O A;  4U0C A;  3CPW O;  1K9M Q;  1K73 Q;  2QA4 P;  3M1M A;  2BHV A;  1QVF O;  1Q82 Q;  1VQN P;  1VQ9 P;  3CME P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...