The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
94
|
sequence length |
284
|
structure length |
284
|
Chain Sequence |
MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb |
source organism |
Clostridium acetobutylicum
|
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Acetylxylan esterase related enzyme
|
total genus |
94
|
structure length |
284
|
sequence length |
284
|
chains with identical sequence |
B, C, D, E, F
|
ec nomenclature | |
pdb deposition date | 2005-05-10 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03629 | SASA | Carbohydrate esterase, sialic acid-specific acetylesterase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A | Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | SGNH hydrolase |