1ZMBA

Crystal structure of the putative acetylxylan esterase from clostridium acetobutylicum, northeast structural genomics target car6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
b'MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylxylan esterase related enzyme
publication title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
total genus 94
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.110 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1zmbA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1zmbA01
4K7JA 4OAOA 4RSHA 2WAOA 1VJGA 1FXWF 5BN1A 1ESEA 2O14A 1Z8HA 1FXWA 2HSJA 1BWRA 2VPTA 3C1UA 3MILA 4K9SA 4JJ6A 1JRLA 4K3UA 5HOEA 3DC7A 4H08A 1DEOA 4S1PA 3SKVA 1YZFA 3DCIA 1IVNA 4K40A 1J00A 1VYHA 4PPYA 4JKOA 1BWPA 3P94A 5A4AA 4Q7QA 4I8IA 3U37A 1K7CA 3DT9A 3W7VA 1ESDA 1U8UA 3RJTA 2APJA 4OAPA 2WAAA 5B5SA 5CD9A 4LHSA 1WABA 2WABA 1ESCA 1PP4A 5JD3A 4Q9AA 3DT8A 2W9XA 2Q0SA 1V2GA 4JGGA 1DEXA 1BWQA 1ES9A 4M8KA 4XVHA 4TX1A 3HP4A 4HYQA 4JJ4A 3PT5A 4HF7A 3SLRA 4IYJA 3DT6A 4RW0A 2Q0QA 3BZWA 4JHLA 4NRDA 4DEVA 1ZMBA 3KVNA
chains in the Genus database with same CATH superfamily
1G4HA 1A69A 5CK4A 2X8LA 5DHUA 1B2RA 5L53A 1SQ5A 2HAEA 3Q0IA 3CNOA 1YZUA 4TTJA 1Z8HA 4JI3B 4RGQA 2ERCA 1P2GA 2BSXA 2NVBA 3PCTA 1SC3A 4HSGA 1O4WA 3PE4A 1OHHD 1DS6A 3MWDB 4WBSA 5ALSA 5C1IA 4KI7A 5IKXA 2CUTA 1CQPA 1DBIA 1R15A 2WKRA 1OWNA 4NIMA 3EFEA 1RS0A 5D5HA 1RQLA 1H3EA 3U5TA 4BS9A 5BSKA 2F64A 4CM9D 2Q1XA 3BEDA 3G02A 4TVKA 1FVOA 5EJ2A 4PH1A 1ZH8A 2ERYA 1CF9A 1OAKA 3RUHA 2JLUA 3M49A 3A1VA 3QMWA 4YRKA 4NPHA 4Z4EA 1PX2A 1XJ0A 4IIBA 2JH3A 4YP5A 3ZIAA 3PGLA 2AI2A 1OXMA 1QDLB 2P3OA 3FNGA 4R40A 1ESZA 1XZAA 1ZM4A 3PPWA 1EWQA 1OC2A 3RROA 4QYWA 2GLTA 1W9MA 1H66A 3IA7A 3ZD8A 1C7FA 5JDCA 3A4TA 3NH9A 1VPVA 1Z5OA 2M6KA 3D59A 5DHQA 4L08A 4I50B 3RVNA 4GMHA 1WEKA 3N8IA 5CLFA 1O4VA 2HSZA 5TF4A 2RAPA 3AW8A 1MQSA 3ST7A 1TA0A 3BFKA 3G8YA 2KG8A 3DT9A 4R3NA 4B7UA 4NEGA 4EATA 1IRXA 3G5LA 4F04A 1JT2A 2HB6A 4GBED 2Q5FA 2XQKA 2H0QA 4DBLE 3R41A 2VCHA 3WIVA 1U0OC 4K6OA 1X1QA 5BRNA 4YJGB 3TD6A 3U09A 2YINC 3OP4A 3U7RA 1NQOA 4RY2A 2B4TO 5IANA 3EWIA 4QUGA 2GBLA 1YDFA 5GZ6A 3NM6B 5L3RA 5BWCA 2XA1A 3M4ZA 1IL0A 4ZHQB 3M3PA 4J6EA 3MGCA 3O8CA 3UJBA 1NLFA 5LJLA 3QK7A 2B35A 5A7GA 4CUJA 5HGLA 1YFZA 1ZD9A 1H8HD 1GTMA 2QX8A 2OFPA 2Y1EA 3DOEA 3JQ9A 4JQSA 4WNYA 2BHLA 4OKIA 3NP7A 1NF2A 3OX1A 3SP1A 4WACA 1ZGHA 2JANA 2V7GA 5KKAA 1JIVA 3LM8A 2YWCA 2WMDA 3EDOA 1Z0UA 3PR3A 5ER9A 3CVXA 1GDHA 2VPPA 1B8PA 1AUVA 4MKFA 3G1UA 3A1NA 2HHCA 2ZIFA 3C4VA 3DDWA 1P4GA 3BD8A 3L8DA 5E7JA 1PYOA 1D3AA 3CMEP 2OFWA 1RM4A 2YR0A 3DHVA 5BSRA 1VMAA 1G2IA 3RHFA 2PKXA 3IMFA 4CMEA 3J80A 3H99A 3NRBA 1R8JA 5AH0A 3GEMA 2PKQP 3DC2A 4B40A 3NM4A 1X0XA 2TMGA 4BN5A 1L5KA 5BN5B 2HK6A 2IV3A 1II0A 2FPWA 3SD7A 1I2BA 3TSWA 5CEEA 1CUAA 1UMCB 2YJZA 5C9ZA 3DOFA 4XUEA 3QM1A 2QJOA 1M1NA 3EK2A 3T4XA 3EAFA 4A16A 4BQSA 3QBTA 4OI0A 1XZLA 3I01A 4MRSA 2B4RO 2PU7A 1BRTA 1ODJA 4GICA 3DBVO 1GAWA 3I04A 5CH3A 4ABYA 4AJNA 2LL8A 4F5DA 3R7FA 1L8LA 2K2WA 1HNNA 3HYCA 3REQA 4E0BA 6Q21A 3AVWA 3OCWA 2AUTA 3HADA 3NH6A 1DQNA 2XXJA 1N92A 1UKZA 3VYSB 1P7VA 3V46A 3BWDD 4KFCA 3CT6A 3PC2A 4L0QA 1G3IA 1C30B 1TD9A 2XUQA 4O4HF 5JI2E 1NVWQ 1HRKA 1KVRA 5AUOB 3NOXA 1Z6TA 2JBGA 5KNDA 1KY2A 3C3JA 3CO0S 1PFUA 1XZEA 3ET5A 1ZJ6A 3NR2A 5DHRA 3RYIA 3MPOA 1NQ5A 2YV3A 1M2WA 1CEQA 2AEEA 1WHSA 4O2RA 3BCUA 1PLKA 1Z5VA 2ZIXB 2QLTA 3EG9B 1Z0IA 3JPWA 4L2IB 3SBEA 4F4JA 4FYJA 1G8HA 4QDOA 1ZEJA 2ACKA 5BNIA 3LPCA 1DX4A 2P41A 3E0XA 4JJKA 5JEEA 4IVRA 3M2TA 1JLRA 5HRUA 4KE7A 3DB2A 4MQFA 4Q7MB 3EDRA 2CYAA 2FKAA 3SYMA 1VJ0A 3B53X 2CW5A 4URWR 4C0LA 1DE0A 5IS2A 4NG5A 4FOLA 4EO4A 3TECE 4DA0A 1V39A 2GFQA 4KGVA 2Z2JA 4Y2QA 3C3AA 3FDJA 3GFPA 1L4LA 2ZUBA 1GXSB 4XUCA 1HT3A 4S1NA 4EW1A 5DT9A 3GZMA 1F2UB 1K86A 1QFJA 1IN7A 3K8ZA 1P6XA 3QY0A 1AHPA 4MUIA 1PG0A 1EX7A 3OUZA 2ZM6B 2DWCA 4E6PA 1WWKA 3U3MA 5CAEA 4FINA 1G1AA 3QLTA 1Y0BA 3PDIA 4IDFA 1FQWA 2BJVA 3RJTA 2AVNA 3WRXA 4P82A 5AM4A 3EZFA 1EJ6A 1JLLA 3QELB 1AKRA 2WC1A 2Z6QA 4DCGA 5LQNA 3SQNA 2PTHA 2OTLP 2Q2VA 4LRSB 4X1YB 2PGOA 3TQFA 6REQB 4FOTA 2C7PA 2VNKA 1D1PA 2J87A 3E6AA 3ME5A 5GM1A 2Y0EA 3ER6A 5L4SA 4FLFA 3ORYA 2HCFA 4KXQA 3LQ2A 5CVUA 2BR5A 2W37A 5I47A 1TUGA 1L5ZA 3NS7A 3OW2O 2Y2UA 3Q9UA 3RS9A 1WBJB 3FMIA 2FG6C 4HDKA 4JB8A 3P2OA 3ZZNA 1M6WA 3IVCA 3TLAA 3GJYA 4IX1A 1KSFX 4TTTS 1DCTA 3B89A 3AJEA 2VNAA 4QXRA 1CULC 2MSNA 4NX2A 2Q5IA 3VYUB 1Q3KA 3FUUA 3B7PA 2Q3CA 3LECA 1C1DB 4EFLA 5E1OA 1PI3A 3NNNA 1AB6A 1O95D 2CYCA 1H65A 3AL2A 3FDZA 4EIWA 2ZYRA 3CCCA 3CX8A 3SZUA 4Q1BA 2AFRA 4U9IS 2FLKA 3QYAA 3GX1A 4O25A 5K51A 1I2AA 3ACCA 2WVAA 1NVVQ 4L0MA 1VQ4P 1NHWA 3QX7A 5C8YF 5K1ZA 3UAZA 1GY8A 5K0EA 3I6ZA 1DX9A 2Q8QA 4KMSA 3I0NA 1PR3A 4WD3A 3QIAA 3T7SA 4EO9A 3II6X 3ZTYA 2BEKA 3AUUA 4S24A 4YFYA 2XXAB 3BSYA 4KDCA 3T1VA 1MW8X 4ZJYA 2H1CA 2BBTA 4H17A 4D42A 4U7HA 3AESB 4UQOA 4JGIA 2VQ6A 1YIDA 1O1YA 3LFUA 3X0DA 1MZVA 5H83A 3M4YA 4IO0A 2ZS8A 3ZQ6A 4E4YA 4X61A 5DGXA 4ITRC 1XZHA 2R1ZA 3E9NA 4ZOLF 4IFTA 3KZKA 4B1FA 2HIHA 1KJJA 1P62B 3GKLC 1QIHA 3HFJA 3DFMA 1B3BA 2H17A 3GT3A 3AP3A 3FPFA 1GGMA 1XLUA 4Y98A 3U80A 5F2OA 4K46A 3T5AA 2JCSA 3ABRB 4LJ9A 2XCRB 4HVCA 4ZYVA 3V7FA 4INPA 5DKFA 3QBVA 4F3CA 4DBZA 4MUNA 1QCCA 4HATA 4OI2A 3GUUA 1TTTA 4HYEA 3WLQA 4FB4A 2XGGA 4KUEA 4LA4A 3WGTA 3THWA 3ZDBA 1XCJA 3G0CA 1D1SA 1AN0A 3TDNA 1A8SA 2J3EA 5AXDA 2GZRA 3KPUA 1V5FA 3PEFA 2GYKA 1OYYA 4MA4A 4F12A 3UT6A 3H2GA 4MKHA 5EJIA 2I7TA 1SXGA 1T4GA 3I4LA 3KAQA 5BQ3A 4BFVA 3ZS9A 3OKPA 3H9QA 4HPXB 1H05A 3PQ4A 3UHPA 4CQMA 2GERA 4R0VA 3IMKA 2ZRLA 4ENWA 1GPNA 5A06A 2Z30A 4Q3NA 3LX5A 2ZIEA 1SRRA 3IUNA 1BNCA 3RIMA 3WOVA 3QFTA 4BO6A 4M8NE 3O26A 1H23A 4HXEB 4TYWA 5EMMA 5DBGA 4JDPA 3ZW8A 3F4KA 4I19A 2GAFA 1R5BA 4HAZA 4YCAA 4S1OA 3RTDA 1FFAA 3EXHB 2PENA 2BM1A 1M1YB 1V5GA 4I8DA 2DCMA 2FDRA 4NENB 1O08A 2BSQA 1JT9A 5DM1A 1CY1A 3SM3A 3UN1A 1P4HA 3ZGZA 1UDBA 1DKUA 2QSJA 5A3VA 2M1ZA 1KYYA 2DTEA 4EHHA 3K71B 4JBXA 4L72A 1POWA 2D7CA 1VIYA 1P2VA 4Y6GB 1Z06A 5EL0A 1QIMA 1SHKA 1E8DA 1S89A 4MDFA 4GBMA 3QVGA 5KC9A 1B74A 1KNXA 5FXMA 3Q9LA 1OBFO 4KSBA 2V4MA 1OOEA 5K0SA 1VCMA 5BYKA 1XU9A 3TZHA 3SOPA 3P2KA 1UH5A 3I30X 3OCXA 1YR6A 5K8UA 2WILA 3GELA 3R4CA 1KY3A 3KKKA 1EMVA 3EEFA 1SRQA 3EYAA 2H0AA 4NZMA 2C78A 2V59A 1CUGA 3LMKA 2C2WA 3DTNA 4PW0A 3VC2A 1ENYA 4TMWA 4Q1CA 2VG8A 1ZOSA 2VWQA 2XT6A 3BMCA 3OU2A 4MWBA 1EP2B 3HO1A 1ZD2P 1NC3A 1SWVA 1WHTA 3TGPA 2FGKA 3MB8A 2G9VA 3I9JA 4OFBA 4K6FA 3TW8B 1EZ1A 1VZ3A 1PR5A 1HETA 3DEYX 4WUTA 2HQOA 2VP6A 4YB8A 1LH0A 3Q87B 4L4UA 2YIVX 3VGJA 1FTSA 2PXXA 2VDKB 4DADA 1CJKC 1N0IA 1HH4A 4KQJA 4IICA 2IK8A 2YW9A 2I65A 4HZUB 4XCVA 3OLVA 3QOFA 2DQYA 3WLFA 4DR3B 4KQKA 4KUGA 5ELLA 1EK5A 2C9CA 1YQWA 2VP5A 3HEMA 5HIAA 4V0RA 1VPWA 4O2AA 3PXBA 3PDHA 3FR8A 4UQPA 1CLUA 1JIKA 1BOOA 5DHSA 5ITZA 4I55F 1GQ2A 2ZULA 4C1BA 4WVLA 2J7KA 4KIWA 2PZ8A 4JYZA 1QQAA 1U2EA 3BGDA 1CIPA 1YBFA 1XPJA 1YQQA 2IHYA 2VRWA 2WEKA 3ABSB 5CA1B 3EZGA 3CJRA 2QOEA 3EF0A 2EIHA 3OOHA 3NORA 3L84A 3H83A 4URYR 3V8PA 3RIHA 3FGZA 3KM0A 1RWKA 1HQDA 3JYOA 3L5OA 5DT2A 1AV7A 4XFYA 1NAHA 2JGNA 4GI5A 5E0OA 5F4BA 3U3KA 5A4DA 2JGKA 4ZPJA 3NBQA 2R6ZA 4BKPA 1HO3A 1W5BA 4KN5A 1EPUA 5K3SA 5A3SA 1DIGA 2X5KO 3BMQA 4G37A 1GPDG 4KGXA 2A4KA 4I4NA 3UPTA 2FQ1A 1A5BB 1GA1A 3O8OB 4K9PA 3Q7SA 4FBMA 2R4TA 3NETA 3B1VA 3E23A 4Q00A 4RA9B 1J00A 4KNWA 5C8XA 2PXAA 4Q3KA 4LJ4A 2XUZA 1DAIA 2XVXA 3K2EA 4AMZA 2KLHA 2GN2A 3EIXA 3PGVA 3AFNA 1XAHA 4N7MA 2DY1A 1BVHA 3RAGA 3GMTA 5B1YA 1XMJA 4ND1A 1RYHA 4OO3A 4ZOQI 2NYUA 3GFQA 4FR5A 3SSMA 1BJTA 5IAOA 1B0AA 2K2QB 2I67A 4U0EA 1CD5A 2BM8A 2OBXA 2VEDA 4XR9A 3MAJA 4OLAA 4P84A 1Q1BA 5JRZA 4UXHA 5J5CA 3B6KA 4F38A 2P2LA 4KQHA 1ID8A 3COSA 1XMPA 2Q5OA 1U8YA 2QTFA 5FTKA 3D3EA 3ROTA 3RVOA 2RI0A 4Q9JA 4BTEA 4N8DA 1YQUA 4QGSA 1ADCA 1T3ZA 2PGAA 4CMKA 2WKQA 3KO8A 4D9KA 2H48A 3QVLA 2QX9A 2WABA 4JR2A 4L5IA 3E9YA 3HXTA 2K93A 2PLNA 4LKOA 1XU4A 2QA4P 5DYNA 5HXAA 5K6AC 3I8XA 3IT1A 4YAJA 1L5HA 3EVBA 5KTSA 3DYBA 2FF5A 3UB2A 2VNIA 3FFTA 1KI9A 4WZAB 3EXEB 5HILA 5JQWA 4X6UA 3BD9A 1OTHA 2P35A 5BNFA 1UZNA 5FWXA 1WOYA 3RUDA 4Q1EA 2QTBA 2ZR9A 5DN6A 3S40A 2JI6A 2Z2YA 3PQ2A 1W36C 4F1JA 4KN8A 1RHUA 1HC7A 5DCWA 2B94A 5ALLA 2II6A 4N8EA 4JIGA 3WKAA 2OBMA 1PVVA 1P7CA 4MVJH 2I55A 5T64A 4RDXA 4PIVA 3IAHA 4D43A 2IP1A 2XNJA 4FYWA 1YMQA 4KZKA 5IJ0B 1J97A 2Q4DA 4P2GA 1CHDA 4OV6B 1G8AA 1KC8Q 3L1UA 4LYDA 1GKUB 2YMMA 2WD7B 4UAJA 4EM6A 4JZKA 2E1PA 5JQGA 3DE4X 1ONBA 3CPEA 1E1QD 4Z7NB 1NIJA 1AKNA 4QGFA 4C07A 3EHEA 3ISVA 3O4FA 4K7JA 1R0BA 5DNEA 4B8YA 4E3WA 2M8LA 1LI5A 1HYQA 3C8UA 3ETEA 5CGQB 3COWA 4CW7A 2AFIE 1R6DA 2Y27A 1TUBB 4IZHA 3TSYA 3GVHA 1J5EB 4QTZA 3CPHA 1XTKA 4F2HA 3TL3A 3E2PA 3UJ6A 1NYRA 1T5OA 3Q15C 1U2SA 4P5PA 4RVGA 4FMPA 3TN7A 4R2XA 2ZYGA 1Q21A 5KQMA 3EUAA 2HN9A 3RK0A 3LTNC 4NPCA 1O94C 1I51A 2B8WA 3E8MA 1M72A 4FMDF 1N77A 2OV4A 4IIVA 2WAXA 1EM8B 3K9HA 4EEKA 1N6HA 3RAEC 4IEIA 3OLZA 4IP0A 3TL2A 3UNXA 4Q3LA 4C7OA 3I3OA 2MOKA 1HTWA 2KYRA 5ALUA 4Y9DA 2J4DA 1U2GA 5LA6B 3H9JA 4FHDA 1Q7TA 4MYHA 3WJ1A 2FTKE 2WMYA 3D7NA 4D0SA 2QN8A 4DCJA 3IQFA 4KSCA 4UAVA 1BE0A 1TYAE 3B8EA 1P3DA 2CXQA 3KJHA 4ZEOA 4L8GA 4DWJA 3C6YA 4EI2A 2AG1A 4ZZ0A 1QHYA 4FNOA 2B8TA 4GGOA 4Q19A 1X3OA 2HX1A 4R9VA 3D6JA 3THYB 5KNBH 2R7AA 4JXZA 3MEQA 3M82A 4CIBA 2ZJYA 3UK2A 3T9EA 4MDYA 2QXYA 5IAKA 1ACLA 3ID6C 5I7HA 4JI6B 4IF6A 4BBZA 4R54A 1K6MA 4GQBA 4PPGA 4OXNA 1SCAA 2CE7A 5BS1A 1DC5A 2XR1A 2C2OA 3F90A 1G0OA 1GUBA 4ID9A 4X6XA 4X97A 5KYXB 1U8CB 5AVUA 3CNEA 4YAIA 2Y6UA 4LDRA 3W5DA 5JSQA 1WP9A 4PV7A 1P9LA 2X1LA 3TRKA 1M34E 4EK9A 3O83A 3L92A 4OQLA 2XMPA 3E05A 4UXIA 4BEJA 5LQRA 5KTTA 3RTEA 2X2OA 4P4GA 1F60A 4LWZA 4EJ0A 1IBLB 2ZJ6A 4KO8A 4BDSA 4EZEA 1XEXA 3WLEA 2CHFA 4R8KA 5CVJA 5TQ0B 1FIUA 2UXBB 1DEAA 1IM5A 2X8BA 3GA0A 3MFYA 1T8RA 3NUZA 2QVZX 2IWRA 4CG2A 4C4OA 3ZDEA 4QASA 5LPNA 4QQNA 4MARA 3HXQA 1JU4A 4B47A 1CF4A 1NONA 1N5MA 3FUVA 4MPRA 4QU8A 2C42A 1CJUC 2X22A 3VR6H 5A5FA 5CITA 3L0IB 2FN7A 4RS4A 4EG6A 2A86A 4O5OA 3UTDA 4CN8A 2QTLA 2XZTA 2HMVA 4Y2HA 3ABIA 1LLDA 4G0MA 3WTBA 4DDHA 3TF5A 4DLRA 4I14A 3D6HA 3HLTA 2ONKA 3O7MA 2Z8ZA 4GIBA 4QLOA 5D01A 2GT1A 3KE9A 5ALWA 3CMAP 4L3WA 2UZIR 2GDJA 3F3SA 2C9YA 4JIMA 3ZCXA 3AQ4A 1WVGA 2AI3A 2WA1A 1U31A 3IP9A 3JQFA 3QJ5A 4OB6A 5F77A 4GAEA 1W30A 4KP7A 3RK4A 3PQEA 2FOIA 4ZTBA 1YNSA 4BXOB 2AF8A 2ONCA 4NICA 1L3BA 1YHYA 1IZ8A 1RWVA 2G83A 5LNK6 4KB5A 5ENZA 1W5FA 3I6MA 2DP4E 3PKIA 4QOFA 1YIAA 5TJHA 5FLKA 3G5TA 3S2UA 4RV9A 2EERA 3MHPA 3COZA 3W34A 4LF5B 5K3CA 4DRZA 3QLVC 1HURA 1C9YA 1UKAA 1JEDA 2QRHA 1ESEA 4JAVC 1L4UA 4M0LA 4G1BA 1I1NA 4XYEA 3V4FA 4ATNA 1QVRA 4KO2S 2IX3A 2V6JA 3AB8A 2C03A 3AVYA 2ZRDA 3Q88A 3I62A 1BYUA 3N7TA 3KJQA 5KPJA 2GCPA 1OFVA 1QCZA 4QTTB 4P34A 3VKVA 1YIJP 4LGYA 1VBKA 2DHDA 5AI5A 4F9EA 4FYYA 1ZL0A 3JRNA 1DO8A 4L4ZA 2DU8A 3IEVA 5EKSA 3DR5A 1NC1A 5HX7A 2XE6A 3B1KA 4AVYA 2ZJOA 3S7TA 2C83A 3M3DA 4CDRA 2IBMA 4DA6A 5E9WA 3VBCA 3PT9A 2HA3A 3UUFA 1NW7A 2OORC 1RD4A 4LJRA 2IYFA 3HMKA 5BSWA 2HYDA 2W6QA 3IIIA 4Q16A 2B36A 2PH5A 3P4YA 5DCYA 3E7PA 1WZEA 3F3KA 1HYGA 1KF0A 4GPEA 5L7WA 1UKBA 4LZWA 3VZRA 3R3XA 3EVTA 5JTUA 2WJYA 4RPKA 1OROA 2Y8EA 4KNVA 3WS7A 4G63A 4OXIA 1PFQA 2PV7A 2I80A 4J03A 1NR7A 3OG9A 3BE5A 3HXMA 1MJHA 2XVAA 1FQJA 3ONFA 1IXSB 7YASA 2P79A 4ZD6A 3DEAA 1L5QA 3PGA1 2FDCA 5D87A 3IJPA 2ZRPA 3AI7A 4R8MA 3WK5A 1FJGB 5AHRA 4Y8VA 4DIDA 2BRUC 2WDPA 2HK9A 4J7AA 3UV6A 2IYAA 4A0GA 1P7YA 2AEFA 4OOFA 3KCQA 2YWGA 2CD9A 2H9AA 2QQGA 4IKPA 4MV3A 5AKLA 1OSNA 1J7KA 3T6KA 3F98A 3LUBA 4H6WA 3QTTA 2ZAOA 2C58A 3OPYA 3I05A 1PJ3A 3QX8A 1CSEE 1H1LA 1NFRA 5EKXA 5L45A 2QB5A 2X2PA 4J2HA 3N53A 1AGPA 1ZI6A 3BXFA 4L50A 4MPJA 5GJWC 1F5SA 3WLJA 5FWYA 2FFRA 3FAKA 3NTRA 1E3LA 2V7XA 3VMFA 1G9SA 5DCKA 1SVUA 2A0WA 1H93A 2D0IA 3S7ZA 4IVQA 4IHKA 3RFFA 3I83A 1OX5A 2Q9AA 3E9DA 1GPAA 1P1JA 1XZNA 4WK2B 1JG1A 4RVUA 1DWPA 2VJQA 1U02A 2SBTA 3TZ6A 1ND6A 3ETCA 2A5GA 3F67A 3K1YA 4V0LA 4Y2UA 1Q7CA 4RENA 3TOVA 1F8YA 4M0PA 4I81A 3ZXSA 1H6AA 3Q8WA 4RYDA 1G20A 1MTOA 2QAGA 5HA5A 1Y1RA 4XEUA 4WKBA 4YMHA 5C0OE 1AO0A 4LF6B 1CUHA 2A9JA 1J24A 2WF9A 1EXVA 1UBFA 4CM4B 5FWAA 1N3BA 2H85A 2HNKA 4NMHA 4PCAA 3UFXB 2FZ4A 4LV5B 3N2KA 1JPNA 5FCDA 3ZHUA 3SLRA 4PWVB 1MVOA 4MQBA 4LDNA 1N34B 1TXGA 4YJ3A 1JS1X 2OXEA 4KOAA 5DLEA 1EIWA 1O2DA 4JLKA 5L3QA 2KBFA 4BBAA 3QOXA 2CHQA 4MROA 2WHPA 3NIBA 2W6ID 2WDZA 2V4ZA 1BTOA 2CZGA 3CPJB 1FFWA 1XAIA 5BUCA 2CVOA 2FH5B 2H7YA 2IYPA 3K2BA 3QA3E 1CDOA 3LQFA 3V97A 4CQLA 4IHAA 1KDPA 3IEXA 5CFPA 2WD8A 5LQCA 2ZYHA 3C1UA 4JI0B 2BBWA 2BVNA 1R8QA 2J0VA 3IMGA 3FPGA 5CJJA 4ZI2A 2BW0A 1QC5A 5CFOA 1ZC3A 3RSCA 1A9XA 4ENPA 3M4JA 4ZZ2A 1LZLA 4HUQA 5L7YA 5K20A 4MUXA 1OWOA 2AHRA 3C7TA 1YK1A 1B6GA 3PGJA 2D2IA 3NCTA 1V9LA 4RPLA 3UM9A 2G4VA 3OQPA 2E7ZA 1V1RA 1CEXA 1VHQA 3KKQA 4QYIA 5EJMA 5I9TA 3GXOA 3NY7B 2GPYA 4CTMA 1XIVA 5GONB 2GXUA 2CF6A 2G08A 5CJ2A 3OX3A 3IVGA 4WECA 3B5IA 1XA0A 2Z9BA 3K70D 5CIWA 2AXEA 2XTAA 3MS4A 4RHCA 1G5IA 2QL6A 2RAFA 4PXHB 1I6WA 1OGIA 1SVSA 1E7QA 1HXHA 2EFDB 2IE0A 2IPAB 1N5OX 1U7ZA 3GJRA 2OXIA 2O7SA 2QMEA 4KFRA 1HMYA 2QWXA 4JB2A 3KOYA 3OO1A 1N2JA 3CRZA 3D4BA 1ZUNA 5ECDA 3D7RA 1HTBA 3ZWMA 2ZIVB 4YJFA 5B7NA 4UREA 2I6SA 4YROA 1GADO 4LNUB 4MCAA 1JG7A 4PO3X 2VSNA 1W1IA 2GDZA 4F7WA 2P67A 4CNBA 5A5VA 2ZIGA 4ZRNA 3T5DA 4DUZB 2X76A 2ORED 2A9FA 3VR2A 4Z9YA 2WPNA 2J3KA 2H1LA 1IY9A 3KTFA 4PSVA 5AHOA 3TR6A 4F4DA 5IM4F 3OT4A 4ADSG 1I13A 3LCCA 5A05A 2FUKA 1RWBA 3BE8A 5CD1A 2B5OA 2W2LA 4CLXA 3WRYA 1YB7A 4E5UA 2J0UA 2LKIA 2XV1A 3F8TA 1UPCA 1Z5ZA 3NHMA 3JD1A 4IDBA 4OJKA 4XYMA 2XQJA 3NDBB 4ND3A 1GU1A 2C3YA 3EHDA 1F06A 1PJZA 3BGOS 821PA 3GQBA 4GWKA 4HAUA 2YVQA 1U1EA 4WBXC 3ZHZA 4MHTA 4PX5A 1YDGA 1DKNA 4B3BA 4LJ6A 3BD6A 2QRVB 1MX1A 5KS2A 3QFCA 2BEVB 2YJ6A 3G21A 5DWVA 3HH8A 4CM8B 4IS2A 4YJ2B 5E9AA 3STHA 4XQGA 2JHAA 4QTYA 2DHRA 4C7XA 3R8XA 1QV9A 2YRWA 4LC0A 1T8WA 3QEMB 3OT1B 5HM6A 3JAWA 1JEOA 1UADA 1E6LA 1CDZA 5CLIA 4PZLA 5C8DA 4AZWA 2XOXA 2WWYA 1NQWA 3UOGA 5KTPA 2HXSA 1JV2B 1QGOA 2IDJA 3SE0A 4KXVA 4OBEA 3W1EA 2RD2A 3DV0A 2ZAYA 3IR7A 1JKJA 3MVEA 1XA4A 5D3MB 3UAGA 1MB4A 3RSLA 1JLMA 1G8PA 3N0RA 4CMJA 1CS4C 3KUDA 2Y1WA 4ZVUA 3TLBA 3PLRA 5LIRA 3NAZA 4TM8A 5DW0A 3CWZA 1HZZC 3OU7A 5LB2A 2GYYA 1YQXA 3UG7A 5JEDA 2YHUA 1BG6A 3PNPA 5E7IA 4DPMA 3I09A 3IIMA 4A6XA 5KWJA 5AM0A 1QYRA 1L7NA 3HZQA 1C8BA 2I87A 3DT6A 5LP6A 2M2IA 1B0ZA 1PD0A 2VRCA 4QPDA 4Q4HB 5ADHA 1D2GA 2PMKA 4P4LA 5HMLA 4AP5A 1UJ5A 2A8YA 3AERA 1V4VA 3Q8MA 5DBHX 5FO1A 1UUFA 2VNJA 1GRNA 3AYZB 4RTRA 4ZN6A 4EHIA 1P9OA 1VSQA 3KU4A 3UWOA 5BWLA 3A1FA 3SSNA 3QU4A 2B8NA 4PX2A 3E61A 4ZQIA 4PG4A 3VR5D 2XCUA 4BO4A 3KELA 4JVNA 4AY6A 1ZQ9A 3LDFA 3VVMA 4XLLA 5LZ8A 1S4MA 3KJXA 3MN1A 3TTXA 5ALFA 3ZV4A 3EMDA 3B6EA 1RYEA 4DLNA 5B1EA 1E92A 5JARA 3QX9A 4W9MC 2FPIB 3SXUA 4YJHB 1G17A 4NYIQ 1V45E 1ZR4A 1KZGB 5D6OA 1JG2A 4DV3B 3H1GA 3IX7A 1H6CA 121PA 1CUCA 2WIAA 4BV9A 2PX3A 1MQ8B 3FPEA 4CT4B 1FQOA 1VSTA 5CG2A 5DOZA 1DKLA 3VNVA 1PSZA 3X2FA 3ECSA 3PFBA 1E4EB 2X8JA 4L3OA 2IC5A 1JSXA 2CDNA 4F7DA 1WSDA 3CRRA 2W48A 5JH7F 1Y8CA 5AI0A 4TYNA 2V1XA 3L04A 4G01B 4EG0A 5C18A 4CCAA 3VR3D 3G59A 3H1TA 1EZZA 2OZPA 1E3TA 1QRRA 1Y6JA 2BTQA 2XUAA 4KFSA 3KUUA 3WGVA 4BLPA 4BFLA 5IHPA 4LDAA 1P1HA 3PYXA 2ZJ1A 2OOSA 3UG6A 1IBSA 1MGPA 2A94A 3L8CA 1R5NA 4LTDA 4ZZ3A 1SBZA 1YK0A 4CEJA 1HI9A 1V7CA 4REMA 1K1EA 3I2IA 3ZQ4A 2HJ9A 1XX6A 1I3KA 2EZ8A 3EULA 1F6DA 8GPBA 1XT6A 3L6CA 1M67A 1Q7GA 1PNOA 4LJ8A 4BO0A 2RB4A 3CG0A 2ECQA 2VAVA 3GO4A 4HNAB 4M98A 4G23A 1NVEA 1UP4A 2BR4A 4H3SA 5I5GA 2GBFA 2OV8A 1JFVA 2BHNA 2NU9A 1RZUA 4B6JA 3MYYA 4MP8A 4LDJA 4M2LA 3QPDA 1IAVA 4ITUA 4ZJPA 1U0TA 4NHEA 3H1FA 2O8EB 5K4AA 5BT8A 2J33A 3C7CB 1URPA 2KQUA 4UBKA 9LDBA 1YQ9A 4RM3A 5AHKA 1MU0A 3ZDFA 5IG2A 5KTRA 1QSGA 4TXJA 3VPCA 1A8IA 4H1TA 3SXJA 2RIRA 2Z2IA 3BWYA 4DDUA 4ZI3A 2R5NA 2PLFA 4G4SO 1ZNYA 3CZ9A 4AKSA 5K5EA 2PUHA 1Z6XA 2AQIA 2R6GA 5H4HA 4WJZA 4A10A 4MS3A 4CV1A 1NSTA 5CA0B 1E7SA 2CUKA 5AVXA 3O8NA 1JFSA 2I4IA 1QVGO 3FJYA 1KZHA 4MKIA 3RABA 1TJ5A 1LQTA 3DBLA 3ZR4B 3J81k 3PNOA 4OUKX 2UUPA 5CHYA 2XZLA 1TE2A 4F4UA 2FWMX 4WFQA 3AL0C 4MV9A 1ECBA 4J1TC 2R65A 3EIQA 1T5SA 3LDGA 4LOHA 3LS2A 4IKOA 1RC8A 3NT2A 3I23A 3BMXA 4KVFA 3ETLA 4AN0A 2J3JA 2F4VB 1P45A 2F67A 2ADFA 4M7WA 5C46F 1QQBA 4IAOA 3GIWA 1IOWA 1QV7A 4EA7A 3BSWA 1QIDA 4TT3A 5IJWA 5G02A 2AEMA 3VDXA 3AM1A 1UNKA 3PIIA 3SS9X 4JH0A 2YNMA 2DT8A 2RGRA 1DDGA 1JXOA 3G17A 4MPPA 3OAAA 3PGXA 5B6JA 5GAJA 3W3AH 4BFUA 2XGSA 5ERXA 4ESOA 1SHUX 1NBAA 1H69A 2VIIA 1XWIA 3JX9A 4BAUA 1DTWB 4MITA 1MB9A 1LPNA 5KX5B 2HSJA 5CT4A 3DS0A 1XTIA 3Q9NA 2HWYA 5D8DA 1TADA 4YUWA 1U0EA 4KBYA 2ONTA 2WZQA 3N2IA 3QE3A 5F33A 2E1MA 1G5HA 4K9QA 2M5RA 1UQTA 4GR4A 1OV6A 2GJ9A 1UBEA 3C7KA 4ZKEA 2OCYC 3ROFA 4RQBA 3BRSA 1VLZA 2ZYUX 1JWLA 4F46A 4LGCA 3MTJA 2AN1A 4ZVPA 5TGDA 3LCVB 4I1SA 2BHVA 1N57A 1L7OA 5DULA 3F6CA 2M8NA 5B3LA 4F86A 5ADWA 4GEGA 3GQVA 1ZBQA 2WHRA 5J2UF 1TTHA 1GZDA 2I1QA 2O20A 3D1JA 1DIAA 1NKSA 1TVKB 1YC5A 1N6PA 2YBDA 4N4AA 2E2WA 3ZIAD 1DJPA 4TSFD 3AV0B 1JEYA 3LYUA 4KREA 4BNVA 1WXDA 5DLPA 3QKSB 1I3CA 1SBYA 1Q0LA 2AJBA 2HDNB 3BWBA 3THOA 1HX7A 3GRKA 3VO9A 1T9BA 1DRUA 1ZVJA 4TS9A 2HWUA 3L9WA 3WGUA 5DNYB 1U99A 3LDHA 3WG9A 4P35A 5JU6A 5EUCA 4EJMA 4IIDA 2CNRA 2C3MA 5JAUA 3HMQA 4M0UA 5AVZA 2LUOA 1SVKA 4MUYA 1TT7A 1YOVA 1X7WB 1YR1A 2NTVA 5JNUA 1G66A 1ZVQA 3NO4A 3AR5A 2Y4OA 3F2IA 1MB0A 3WBJA 3T0FA 4ZAWA 3A2NA 3T5MA 2ENWA 1Y81A 1EUDB 4QWMA 3UZUA 3NKFA 1NDHA 4GPBA 4YWHA 1ZUD1 5CYOA 2O05A 3IP6A 2QQ0A 5BR1A 3V4OA 2A3RA 2BCGY 5JMWA 1ZD1A 1NTRA 3IUEA 5TB5A 1B8OA 1EGMB 2YHIB 1U4NA 5JNVA 3D3QA 2EJCA 4PY2A 3BSFA 3JZIA 4QWWA 3SAJA 3N8GA 4G5GA 4OGFA 1J09A 1VKUA 1IULA 2CUNA 1F4LA 2CDAA 3SF0A 3CX7A 5IYZB 1KY5A 6GPBA 3F49S 5JMOA 3I61A 1MTZA 1JF8A 4KITB 1Z6AA 4QXPA 1EKXA 3WL5A 3AM5A 2WYWA 4JBIA 4RVFA 1XTRA 1YZGA 4PC7A 3OUTA 4E30A 2AX3A 2O3TA 4C4ZA 1IBRA 4AL4A 2PT6A 1E5TA 3DMGA 1Z7GA 3HR7A 3REGA 1L4GA 2G17A 1ZM7A 2JW5A 2ZSFA 4N0QA 5IBCA 5EJGA 3D4NA 9GPBA 5HGNA 2QJTA 4PIMA 2HWWA 1Y4ZA 3B70A 3E5MA 4YAEA 2OCKA 4D3DA 4I4TF 4DSTA 1S3IA 4JLPA 5FOWA 2GXSA 1XZBA 3T3PB 1Q44A 4H0FA 4KIJA 3RYFA 4C29A 4QUBA 4QNMA 3U3RA 1QRAA 2OMEA 3R3JA 4J4HA 3VU1A 3X1WA 2WUWE 4J0CA 4EYOA 5FNVF 4AO8A 2IHTA 1GCIA 5LMCA 1LK7A 2JFFA 2OAGA 2ZUDA 4FI3F 2QUAA 3ZX4A 2CY0A 1OXBB 1PWYE 3C43A 2ATVA 4U2BA 3U9LA 4CFSA 4AX8A 2BF7A 2DWPA 3NWOA 4XWGA 4BO1A 3UYKA 4H3KB 4IQ8A 2IXBA 4BNIA 1N75A 4ZKDA 2LKDA 3H9UA 1X80A 2N0SA 5TMDA 3FDXA 3O1JC 5TIIA 4QNNA 4BATA 2X8AA 3BCRA 5EHXA 1LLCA 2GZJA 3IPXA 2C94A 1KH1A 3PCRB 1NMZA 4BECA 3L7LA 3CXRA 1UMBA 4GKBA 5HF6A 5SY4A 3TLCA 4EGSA 2LP4Y 3TYXA 4H6XA 1VQ5P 1E2JA 5CDYA 4DMRA 4GMXA 1I1HA 3H84A 3N1UA 3AFMA 3CUYA 3GD7A 1WMSA 2SCUA 3D5EA 3GRVA 1R1DA 4YMUA 1P8AA 4AIIA 2ODAA 1ISRA 2QRQA 3WGKA 1P5HA 2VJMA 1FLNA 1NZFA 4GWLA 3AFHA 1MNQA 1EZ4A 2VA9A 3EDYA 3I1FA 4HDMA 4P4TA 4UBNA 1E1LA 3LE8A 1KBQA 221PA 3TEFA 4RABA 5EJ7A 1KI6A 2OO3A 5BMVB 1SUEA 2QYOA 1UDCA 1FRVA 4QXMA 1ZY2A 4MEBA 4BFZA 3E5HA 2CFSA 2OG1A 5CDHA 1T0UA 1RRCA 1CQXA 1Y37A 3DMTC 4K86A 5EJ8A 2FMKA 1LTKA 4QVKA 2J59A 3K35A 2O48X 1T9CA 3RTBA 4ND7A 1J5PA 4GKJB 3TSZA 1W93A 2ET6A 2QGFA 4NTZA 2PBLA 1ORIA 3OP1A 4HDNB 5FEUA 3K1TA 1KHHA 3JQ7B 1XCBA 1TX4B 2UYGA 3PNYA 1J0BA 2N1BA 4L1KA 2OC4A 4OMUA 3P8ZA 1QUEA 4WKCA 3AF3A 2NWQA 4MV8A 3H47A 2CJYA 2CWWA 2F59A 3G3EA 2AW5A 1KK2A 3GDGA 4JNKA 3DQZA 4R1NA 1BX3A 1KJWA 1KIFA 3T5BA 1G291 5CB4F 4HFNA 2HADA 4TUYF 1GKYA 3HR4A 5ICCA 2FFJA 3EODA 3MYRA 3CLSC 1FP4B 1B7GO 3TTSA 1I8TA 2YWBA 3A4IA 4O5AA 1ECCA 4QBIA 4C0XA 3A2MA 4AC9A 3ROQA 5K7SA 4I36A 3ZVNA 4LFAB 4ZCQA 1DXQA 2HZBA 4MQEA 1NVVR 4G0ZA 3WGLA 2YOHA 5ALJA 5BV0A 4MYCA 1WOMA 2NACA 4KTTE 4KW7A 4EYQA 2AOVA 3C5VA 5CLLA 3D0RA 5B1SA 2FNAA 3K6JA 1YXMA 1AA9A 1TEVA 1EAYA 3AEKB 5AHWA 4XIIA 1CUYA 5C5EA 3I55P 3COJA 4JOCA 2I22A 5PNTA 4U7PB 3IPCA 3GPBA 1O77A 4YCLA 1EX1A 4UC0A 2E0IA 4X5OA 1B00A 3RUPA 3CNLA 1JAHA 2VHUA 3PPIA 1ZMTA 2VUIB 3ONEA 3ENQA 3CG4A 5FWNA 1RWOA 2I8LA 3GYGA 1BHQ1 5KDDA 1IFXA 5AVTA 1KAOA 3ZDDA 2F1OA 1GNTA 3EW9A 4LVOA 1CQIB 1RVV1 1YRAA 4ODIA 4OHFA 3BK2A 4JC4A 4U2CA 3D0QA 4EG7A 3ADCA 2GDYA 3QEOA 4F5ZA 3KXDA 3EBPA 3ZVMA 4KOEC 2RKBA 2QF7A 4QEDA 1AUQA 3IGFA 1OIVA 1X9HA 2NP7A 1SD1A 3V4PB 3BAZA 1VJGA 2GZMA 4BLVA 3GHHA 5C32A 3IBSA 1EE1A 4BNTA 1XVVA 4LYFA 5LBUA 4FJ1A 3HJUA 4L73A 2H3HA 4BVHA 3I39X 1KPGA 3T7JA 4P7JA 4O29A 4I9NA 5BUQA 3EAGA 2YYSA 3OEYA 4I4LA 4JJ8A 4EX6A 4ZI7F 4ZT5A 3QVKA 1GHTA 4IINA 4J0HA 3GUZA 4WN9B 5G3ZA 3X1ZA 3ZZMA 4BUCA 1ZD3A 1KFBB 2NP6A 3BHNA 2EG9A 2OHVA 2CMFA 2J9RA 1U2DC 3DO8A 1YOBA 3JVEA 4JUAA 1NFFA 1RJ9B 3KV1A 4V0MA 4YP0A 2K7FA 3AZQA 2WHEA 3DE1X 1DAKA 4PYOA 4DLUA 4G0UA 4NEOA 4MP6A 3VZSA 2CLSA 4JLVA 4TKVB 4OHZA 1UOPA 3TR5A 1E2PA 3JQAD 3E9MA 1YZFA 4WQMA 3AVQA 2CXTA 1JQEA 1GVNB 4WK0B 3BXOA 4NEHB 3CGWA 4RE5A 2WSLA 1KWGA 1R2QA 3VAAA 4IDHA 4MUAA 1QH1B 2DCUA 5I4KA 4J49A 3H6KA 4NMXB 4K05A 3K92A 2H7VA 3L40A 5TMBA 1D03A 3WLRA 2MSKA 3NJRA 5BPHA 5KREA 3DCYA 1W29A 1W4ZA 4XDHA 2NPIA 4D41A 1ZO8A 3A6KA 5DSTA 4MJLA 5TGTA 3SC2B 2F43A 3OTOB 3D81A 3NHSA 2ASEA 5L51A 2ZB4A 3ZGYA 1M8PA 2L19A 2ZUUA 5EJFA 5LOVA 4EB6B 1GYRA 2WYHA 1FNNA 1MC4A 3KEQA 3PWKA 4IUCS 5K3FA 4MS4B 1SVNA 1UC4B 4YRIA 1RLUA 4XX1A 4C6HA 2VTDA 3QWAA 3FOFC 2GSWA 4UULA 3K1ZA 5K05A 4WNAB 2GCOB 1EDZA 4D9EA 1W88B 2QA5A 4E2WA 4DABA 1Z0SA 3MK31 4MQUA 4M8SA 4KL8S 4CCYB 4LF4B 1FU4A 5I7WA 5J4YA 1T5DX 3LW7A 1TF5A 1Y3FE 5IH3A 1Y1SA 3PFCA 4BWFB 4YMGA 3TAXA 1OMOA 2C8KA 2ZYSA 5SY9A 1OXUA 4ZPXA 4ZCLA 2NXWA 4INZA 2AFIB 4OD0A 1M2JA 1RWMA 4P7BA 1LPOA 2Q6VA 3MCZA 3MZ0A 2QRJA 2JHGA 4UZSA 1EP9A 1Q2UA 3UWMA 4ECEA 2XQVA 1U0BB 1RKVA 2I1LA 1NVBA 3A4MA 1V11A 3O0DA 1BDHA 4KQIA 4LE1A 3SVZA 3LHDA 1KI7A 1ICEA 2OC9A 2G1UA 1Q83A 2WICA 1BEZA 1HFWA 3AJAA 5BV7A 1CR0A 5I7AA 1U7WA 1QG6A 1E3WB 3V2UA 3CR3C 2WINI 3IVRA 2GZHA 5ERYA 1LGYA 3RWBA 5EN4A 4DUPA 4RAOA 2MSLA 2HPHA 3Q0TA 4I1YA 1M2VB 3IAM1 4JJ4A 1GL6A 3JTMA 4O4HA 4TWAA 3OLXA 1NR1A 2FCAA 2ZIWB 2XDQB 4OAQA 1T8TA 4OH7A 4PFQA 3G85A 3IDSA 1LV7A 5HKOA 4MSUA 4U0KA 4GC9A 3GNLA 2EGHA 1FNCA 4JHXA 4PZ9A 4HMQA 4MIOA 3UAOA 1FS4A 2GD0A 2LDXA 4JLAA 4OSPA 4TSKA 3O2QB 3H1EA 2PS3A 2WLTA 1J8YF 1XHEA 4RSHA 1VRWA 1MKYA 2JFQA 3DS5A 2D1FA 1BXIA 4JK3A 4LY6A 2Y77A 4PYMA 4UBIA 1VG8A 3HL0A 4URUR 4X9XA 3QY9A 5EE0A 4A2CA 2CSUA 2ES4A 1IEQA 3AJ9A 4UCWA 3HA3A 3E22B 4FFWA 4BNXA 4ANFA 2GYUA 3AF4A 2CJWB 3RW9A 1A76A 1NNEA 1H5UA 2XMQA 3EF1A 4M1OA 2Y0PA 3GZLA 2P2ZA 1C1XA 4GPZA 4J2OA 4O4IF 4CLDA 3FVWA 5EQJB 1G8YA 2JD2A 3C3BA 4G2TA 5JCJA 1YGYA 2IT1A 1T91A 3SHFA 1M34B 5ARBA 3U13A 4D4GA 2UZ3A 3PHBE 3P2YA 3I72A 3E82A 2AFHA 2GVZC 5H02A 1UZUA 1DQSA 2I4OA 3AM3A 1Q74A 4CGYA 1QZZA 3WYAA 2CXRA 3G2NA 2BUOA 1LNZA 4F8JA 5JADA 2R7KA 4I7EA 5K0FA 1H0SA 4Q3CA 4KIUA 3D4LA 3NDIA 1QM5A 1JIJA 5TNXA 2FPPB 2E48A 2WZBA 4H35A 5JXWA 3EA0A 2D0PB 2ZWIA 4GXQA 3TOZA 3W5VA 1A72A 2D1QA 1NSYA 3UMGA 1M54A 2FB9A 4N18A 2LIPA 3OQOA 3DHNA 3RK1A 4KMOA 1LCIA 4G0XA 4BQFA 3ZVRA 2HNAA 1Q92A 2BFBB 1K27A 4UD2A 1NUHA 3KT8A 4HC4A 2ASVA 3CSDA 4TZTA 3NBXX 1XTZA 4LG1A 4BFXA 4YDQA 4DR6B 5JJCA 3GFVA 2KE5A 5KYYA 3HLYA 4MUEA 4TYQA 2Y1KA 1KA9H 1YTLA 1D9XA 3OY2A 2CWDA 4BPGA 3VHXB 1XJWA 2P4EA 3CR7A 4OFXA 1UT5A 5EWLA 2IWHA 4PGHA 4EH1A 1DAPA 4DILA 5I7SA 4KG7A 2Z4SA 3EXG1 2XNDA 3JYHA 4LDPA 3SBOA 4EW2A 2H2IA 5FR1A 2PMCA 3CW8X 2X1MA 3NAQA 1PWHA 1Q3TA 2BFFA 4G3XA 5F5NA 1YB4A 3TKAA 1JDBB 4M0IA 1W36D 1HE5A 3EH2A 2ZRGA 3DP7A 2GK6A 2G6BA 4C04A 2QP9X 4JA2A 5AOVA 5CBPA 2DC1A 3AB3A 1Q7EA 4EZIA 1TO2E 1PZXA 3GARA 1JQDA 1KAHA 3A6JA 2RJNA 3K0FA 4PNPA 4ZRMA 2KR5A 4BZZA 5L6MB 4H9GA 1XFAA 1U3FA 5C8YA 4EPRA 1KETA 3C0KA 4XJVA 3V1KA 3WLKX 1JQAA 1MG0A 1Y63A 3BRQA 3GEEA 1W4CA 1G3RA 1KWKA 2YXEA 2H92A 3PENA 3ZBPA 4DSOA 3H5IA 2EKPA 5GQSA 4Z0TA 4Q3OA 5JY6A 2Y3IA 1IUOA 2HJGA 2NNLD 1P0IA 3CJTA 3RC1A 3L1IA 1JSRA 4PLWA 5C51B 1XQ1A 5HGMA 1G16A 2GETA 5TPWB 3WGZA 1RYDA 1NF3A 2JCGA 2P6OA 2WJ6A 3K0EA 2X86A 3KSDO 2C4WA 1PGPA 3MD0A 4OA5A 4DUGD 1BW9A 1JG4A 3E8XA 1SJ9A 4P0TA 5DN6D 4RZHA 5EEGA 1Z6QA 4RSGA 2FYTA 4IIUA 2O6HA 1R50A 3T1YB 3CLRC 3HDYA 2ID9A 3EFHA 3PHIA 2NU8B 2JBHA 3AOEC 1G6OA 4X84A 5EZYB 3S29A 1ZX1A 3PCXA 2QJWA 1KMHB 4RM2A 2BMAA 2BFPA 4AECA 4B6EA 4TXMA 5IAGA 4PXSA 4Q37A 1TGYA 1W8DA 3QMVA 2FEMA 4R83A 3TXAA 1DJNA 3MFQA 4I6GA 1AGXA 3TB6A 4LNHA 3SMVA 3IUQA 2RK6A 1PL8A 1J21A 1K97A 5DLQC 1JJ2O 5KYGA 2BFEA 2GVDC 1M66A 2BKUA 2JAQA 1YFKA 2WWXA 3H0KA 1TA4A 4DNXA 1DB3A 1FXWA 4OLBA 4OK5A 1IY1A 3TSOA 5ALEA 4B4VA 3OMXA 1UDAA 2YC2C 2G5GX 4DSZA 1PS0A 1UBGA 4TYPA 3R7WB 3ESRA 1FOEB 5KJCA 1QK3A 4TXLA 3SC6A 3EDQA 4CI9A 1M6VB 3FKQA 3Q12A 3V48A 4QOEA 4ZU1X 4YT4A 2GAOA 3W1VA 2YXPX 4G9GA 2JI7A 3N0WA 2A5JA 2YFKA 1NHGA 1XYGA 2H2DA 4CU2A 1A2BA 4NH4A 4PM4A 1PIWA 4HAXA 4JOSA 2E85A 2FVYA 4BZQA 3SZLA 3GFBA 3TLKA 1ZS9A 1BH2A 1XL1A 2NMVA 3PVZA 3UKOA 2ORWA 4BCCA 4KX3A 4UNIA 5EGNA 2GJ8A 1T3SA 2PNGA 3CZMA 2DFNA 1UXKA 2IYOA 3MTQA 4GNRA 4N5IX 2FPOA 3TW0A 4CL0A 2NU7B 3F97A 2P9GA 3G2HA 4KKVA 1MAHA 3WIOA 2JIDA 2AOTA 1EBUA 1IATA 3DKRA 1OBCA 1XFDA 2Y71A 3DL0A 3PHCA 5G4KA 3UH0A 4GI3A 5TXGA 1PLLA 2W58A 1ISFA 4YRJA 1U3UA 2CHEA 3GGDA 4DSAA 2HA2A 2J9ZB 1M2KA 2FPXA 2MMCA 4RY0A 4D0LB 4UVIA 5I9LA 2HLHA 2OTJP 2NT4A 3T7TA 1WZCA 1AXGA 1XXHA 5C2JB 4NLLA 3TO5A 4EWLA 1X7HA 2NSYA 1AUOA 4BWYA 5B36A 1NOIA 4BP1A 3IKVA 4A26A 9ABPA 1YJCA 3HXLA 1DBRA 1ONNA 5K0TA 4IZOA 5AK6A 1JSLA 2JCVA 2YWHA 4ZRDA 3T3DA 2CVFA 2QUZA 3G0DA 3IEUA 5TSDA 2XZOA 1ZNVA 1AQIA 5CR9A 2B37A 4YLGA 2QAJA 2J0EA 4LGMA 1B93A 8LDHA 1LW6E 2VXOA 4FJ2A 5EG5A 5B5SA 3GLFE 4A1OA 1G21B 1K4YA 1PGQA 4AD8A 3KT6A 1W8IA 3AFGA 1NBMA 1GG9A 3BGSA 4IXWA 5ARDA 1IUQA 1Z68A 1QYWA 3DT8A 1RC1A 2VXYA 3NBAA 3C8HA 1S96A 1KJNA 3DB1A 4DCCA 4L02A 5BXYA 4CKCB 5TPZA 5HUQA 3ZWDA 1TQ2A 5K3BA 3KV3O 3DBRA 4RXMA 2YWRA 5DBIA 4KPYA 1CY2A 1G19A 2ZSBA 1RI2A 4BNJA 4DRXB 2GFIA 5EP2A 2FRDA 1W85A 2DE0X 3IP7A 3OCCA 2EFEB 4PH0A 2R6R1 5AIBA 2OM2A 5EZQA 4KO4S 1TQHA 1JU3A 2HO5A 1K06A 3N74A 2FY8A 4M0CA 1P4SA 1MO3A 2Z83A 5FPSA 4US2R 4I1VA 4TX1A 1DAFA 4DY4A 2AE1A 4WESA 1Z0FA 3LT0A 2F62A 3PD7A 1HGXA 4P5EA 3C3KA 5HUHA 5JCZA 4JP5A 4CA3A 1RBYA 4YDSA 1XYYA 4YFVA 2A67A 2JH8A 5B3AA 5BN4B 3TLGA 3O4JA 1DO2A 3W9BA 1X7XA 4GYYA 3VPGA 1K8YB 4E15A 1KP2A 3H6HA 4R81A 1DWUA 4C1NA 3EEOA 3G9ZA 1I6MA 2C7VA 1QX3A 1B8UA 1MXFA 2GPTA 2MR8A 1RLJA 2D0DA 3ESAA 5DOVA 3UGJA 2LXNA 1NVAA 1QO9A 3D3NA 5BN1A 2HSDA 2UZAA 1WDTA 2SECE 3DYIA 4F8YA 4Y2JA 2BTEA 1XJQA 1E1YA 5CCEA 3EY9A 4DMGA 5JXHA 4C08A 3OI7A 3MUOA 1W76A 2J09A 2Q8PA 1S2DA 3MNFA 1PL6A 1GUFA 3JQEA 4FOOA 4G8DA 3SIXA 4CM6A 2XCIA 4HAYA 1GTG1 5K0BA 2WPDA 4C3VA 3WBKA 1MH9A 1ZBDA 2EJVA 3RBAA 7GPBA 3T3OA 3QU9A 4QRIA 2IH4A 3FF1A 4JB3A 5G2OA 3U4GA 5LCXA 5HRCA 2XRZA 3G0OA 4MUFA 4QXAA 4WINA 2VDVE 4TLCA 5B4UA 4MTLA 3DOCA 1UJ4A 4DSUA 1HE4A 2VYND 3P32A 4H15A 4UOZA 4RULA 3H4EA 1VBMA 3I8OA 3M9LA 3UCXA 1R7RA 4YMLA 3PE6A 1YU6A 2QKYA 1WF6A 3WKDA 2O5RA 4XX0B 4EX7A 3HB4X 2UYHA 1G8GA 3F6EX 2ZRCA 4LX0A 4G41A 3C70A 1OXVA 1EFHA 2I54A 4XD7D 3U26A 4KRYA 1HQBA 2FAEA 2BSAA 3MMPA 3G2LA 4Q12A 3LH5A 2DKNA 3JQRA 1BU8A 4IY1A 3I64A 3H4MA 3TX6A 2PWYA 4RHXA 5ALDA 1P44A 3EGDB 5K6RA 3A7EA 3AVTA 2O0LA 1DUIA 2QAIA 2QRNA 3JCZA 4ISCA 3CM0A 1E32A 1GNPA 4MAMA 4F72A 2P3SA 4GPD1 3DP9A 2XCLA 3A25A 1I2MA 3HBFA 4Y6PA 3CXCO 2YDXA 1Q0QA 1Z39A 2BUAA 3C6KA 1K8ZB 1NAIA 1T9HA 2IYWA 4H6VA 1VLHA 2I2XB 2RI1A 2GHQA 3LY8A 4FFLA 1NW9B 1K8AQ 1V7QA 3U9TA 3CWCA 1U8UA 4DCVA 3DLBA 3RLFA 3Q3HA 3FTPA 1PFWA 2FWAA 4MWOA 1IY2A 3I1IA 2CVHA 2Q7OE 5DSZA 3HB0A 3W3ZB 2QMUA 3BTVA 3GB9A 3K6SB 4IDAA 3I56P 3NIWA 1RCTE 2Y93A 3ND6A 2VP9A 3L0SA 4Y9TA 4BRUA 5AESA 4RLFA 2OFOA 1KEKA 4F91B 3CH7A 3IE1A 3MF4A 4P3PA 1JPVA 3K0HA 5CCDA 4BTVA 1QP4A 3A1SA 3URKA 1U04A 2OHXA 4BX2A 4ND2A 4NZPA 1K6JA 3JYPA 3HWWA 4HLNA 1F2TA 3DKPA 3STTA 2BMWA 2QR2A 1CQJA 1GQRA 1WLYA 1UK9A 2WNIA 4EI7A 3OEHA 5F64A 3NVDA 3EIWA 4U00A 1MEJA 4WPGA 3D4PA 3RCBA 4BAZA 3TE6A 5KP6B 2ZAGA 3WGHA 2XY4A 1VCIA 5CX1B 1AV6A 1YVDA 3AG5A 2PEIA 4Z3KA 5EXTA 4FNGA 4MQMA 2A1UA 2VF2A 1KSJA 3ZCVA 4MZDA 3CCVP 4WAUA 1G7SA 3SNHA 3OOEA 5AOAA 5K6AA 1OREA 1XCLA 2WR8A 1T3TA 1FPQA 2V8OA 4AURA 1EG7A 1U0JA 4B74A 4DC9A 1D1TA 5KQPA 5AW4A 3FW1A 1ILEA 4LF9B 1XZPA 5L40A 3SG0A 4OJTA 3C41J 1MPXA 2XF2A 2Y1FA 3LUGA 3VH3A 4RQAA 3U1TA 3C39A 1QB7A 2GJ4A 2VYCA 5TMEA 4U39A 3PFFA 3Q5EA 3ZJ5A 1OA0A 4J16A 1IE3A 4TWJA 1XI2A 1YZTA 2ZJ7A 1FDOA 5A62A 2QUHA 3GJ5A 4RMIA 1A77A 3PKZA 3V32A 1P6QA 5K8VA 4HLQB 2IYSA 2BGIA 1XTSA 4BNUA 1EYZA 2GM3A 2ZUSA 1L5SA 4M38A 3N59A 5I4TG 1XO1A 3MQ4A 4C22A 5KB3A 4QPJC 3B2NA 3MAGA 1S1CA 4UUBA 2WG2A 1JRLA 3FI9A 3I1YA 2QN3A 3W5UA 5GZ1A 4G86A 4Y1RA 1ND5A 1GNQA 2Z5FA 2VP4A 3L82B 4HBGA 2J3DA 3HSKA 1IBMB 2AZMA 1DJLA 5T4EA 1VHNA 1PWZA 2Z2XA 4I50F 4FGJA 2VDQB 4BMZA 4D57A 4YR7A 2X1HA 1RRMA 1KAGA 4PAQA 1ZAKA 2F3SA 4UJ3A 5CIYA 1N33B 5D7BA 2ZANA 2GK4A 4YV2A 4P31A 4GQIA 3A9UA 4PBTA 5C7OO 5ESDA 3K73O 1DI0A 1DINA 2GCNA 1IK4A 3ZK7A 3PR2B 1RXYA 1SHJA 4R2LA 4MUHA 4ZDWA 1UFVA 4LK2A 2DOKA 4H2YC 2JAHA 5D1NA 4RZUA 2Q1YA 5DMHA 5EZ6B 4B4OA 2Z95A 3GI1A 1O94A 3DXFA 3S2IA 3NTUA 2R66A 1NX6A 4PSDA 1P7WA 3NC4A 4CBVA 1DQRA 4EGFA 3UXHA 2FKNA 4Z4QA 2BEUB 1LX7A 1ZLYA 4Q1AA 4LJLA 1JR3E 4TQUS 4P33A 1XELA 2HF2A 2XD9A 2VQEB 3MGAA 3U2QA 1FFYA 1YCHA 1UOOA 2FAXA 1WMEA 2IEIA 4O4JF 3IFSA 4E7PA 4DR5B 2QZ9A 3C2QA 3HHPA 1V3VA 1HDZA 1MOQA 3KJIA 4G9BA 4YH1A 3S4YA 4FT2A 4DWWA 1Z2AA 4V3CA 2QZ4A 3LYAA 4YP6A 3AKEA 3UGKA 5DE3A 1M1NB 3KC2A 1NOKA 1MJFA 3H9EO 4E3ZA 1N1MA 4QIHA 1GN9A 1LS6A 1XHLA 2C4VA 2O2JA 1G0NA 2HYIC 4BQRA 4RF5A 2KM1A 1R74A 2ZUCA 4L8YA 1AQJA 1IOZA 4LXUA 3ZXYA 4ENRA 2G40A 1ZGJA 2XUIA 1M1XB 5MN5A 1RTTA 2KWIA 2VTVA 2XMRA 3LAWA 4MS1A 3OKFA 4ZOBA 3EEIA 1WXFA 3UW3A 1XHFA 4RCVA 4C2BA 4D26A 4G0VA 1ZUHA 3KAKA 4HQ0A 3V2IA 2YWDA 4G1CA 3I9NA 4E5KA 1E2EA 1ZMOA 2M6LA 1WA5A 4BMXA 1VIMA 4MVJF 4XB2A 1KYXA 3BB4A 4TPKA 3E70C 4MVJG 2JU1A 3C3YA 1EFPB 1OBOA 1ZSVA 4ZALA 4EG4A 2MF4A 1ZJJA 1RPNA 1K73Q 2XSZD 2Z98A 1O54A 4RELA 5AUQA 3TRJA 2Q3HA 4FKBA 4ZWNA 2X7XA 4HX9A 1WX1A 3GJ8A 1L5LA 1T35A 4RS3A 3SZGA 3TRFA 4PBRA 3FRJA 4ENVA 2XB2A 1YHZA 3GFGA 1Z17A 3MWFA 2J46A 2P1ZA 1SBQA 3MTGA 1TM5E 3HUDA 3I9KA 2PD3A 4P8RA 1X9IA 4MQFB 1PBNA 4B4DA 1JTFA 4KWHA 4KPFC 2ETVA 3NP9A 5JSKA 1TDJA 2ZBGA 5JXGA 4GPAA 4C0SA 1UODA 2FUEA 1DKRA 2ZRFA 4WH0A 4QEZA 4TTRA 1KOFA 2NX2A 4C30A 1TZCA 1EUZA 4UTXA 4B83A 3QLEA 5MGNA 1TUIA 1G2QA 4AZVA 2SKCA 3VNBA 4AP6A 1NU6A 1TVEA 4PG6A 4GRAA 4D56A 3EPJA 3NGLA 2UXCB 5JCOC 1SOAA 2A4MA 1SR8A 2R8YA 3T1TA 4X1IA 4HQKA 1O9HA 1WUYA 3OJWA 3SN6A 4B0OA 4FGLA 3K96A 3TPZA 1F17A 4R41A 3BQNB 1JLLB 4YRMA 1AQNA 3LOUA 4XUDA 4XE5A 2E4YA 3HU1A 5G41A 3WQSB 2RH9B 4I9HA 3TD2A 3DJYA 4ZVQA 1LZKA 2WYVA 4FDVA 5K3EA 3AEUB 4RFSA 4EPYA 1Y7PA 2X6QA 1TMKA 3HN7A 3DE2X 2PSJA 4FZRA 1IEWA 1FW8A 4JYPA 3OQIA 4BN4A 1K3FA 1EWRA 4FILA 3TOCA 4CV3A 2DPHA 2DSNA 3W8FA 3ELWA 2FN4A 4HDKB 2HA5A 2ZJAA 1IG0A 3FMFA 3HE3A 3RKUA 3SJBA 3HZOA 5ECGC 3VI4B 3B6ZA 3ZXXA 4B09A 3EQ6A 1XC7A 4KPUB 3FOWA 4MR8B 1S4QA 3B9QA 2KMLA 4KCGA 3TBFA 2G09A 3DDSA 1OVGA 5ES3A 4L8FA 4YMIA 5AKZA 1JR3D 4HB3A 1YD7A 1AQYA 3WI7A 3GL9A 1QV6A 2I34A 1CBUA 2PKRA 2X40A 3IT3A 4IHJB 4U2KA 2AD1A 4HRVA 5B3KA 1YC2A 4RZIA 1DCKA 3G2IA 1VFPA 2BH9A 1YB6A 2HD4A 2OXFA 2RGCA 3AY0A 3MLBA 4IQ0A 1ULSA 5TT0A 3VR5H 4B32A 2C4NA 2BLNA 5KCMA 3TZLA 3QNMA 2AG8A 3OZRA 4U6NA 4Y6LA 2VWGA 4FVTA 4YP1A 1BHSA 1X14A 1YHNA 2ZRHA 5HGXA 2JCBA 3DEIA 4G09A 4R51A 4PYIA 3EUFA 2EFYA 4UDNA 2NIPA 2D13A 4JZYA 4N0PA 1WW3A 4UNPA 3TNYA 4RTOA 1UWCA 2XJ9A 3H5AA 5JS7A 4PG7A 3UVEA 1PL0A 3OBIA 1Z2CA 3DZKA 2HRCA 3TVTA 3TCXB 5KOJA 1UBCA 4J3JA 2AV6A 4JSRA 4C7JA 1ZVKA 3KOZA 2CXXA 5JNWA 1ANKA 3AF1A 3BGIA 3DTYA 3FR7A 4GM4A 1QZUA 1TEHA 4KYIB 5H0IA 3U0BA 4R9NA 3WWEA 1Y89A 3M4NA 3MUNA 3NGMA 4NCJA 5AMXA 3EPLA 4OA8A 4KX5A 4ZAZA 5A4KA 1XUOA 4B48A 4M8KA 1GYPA 4P83A 2A30A 2FZ5A 1Z0KA 4IKEA 3JQAB 1OX4A 1PT6A 2ZEJA 1GDTA 2H1RA 4RWZA 3QEBZ 2GAIA 2YH2A 4GEKA 2JYGA 1QXSA 1WB5A 1YRHA 2ZYDA 4FYHA 3THWB 2OWDA 3PI7A 2L18A 4OM8A 521PA 3EXHC 5TT1A 4V1CA 3RDPA 3ZU3A 3PWSA 4HJXA 4R1UA 2Q50A 5BV1A 5LWQA 2XEXA 2A0FA 1I4LD 1JE0A 2OR3A 1Z4OA 2ZQ5A 3HKBA 4FN4A 4D8YA 2Y76A 2GRJA 4LMBA 2AH5A 2YNMD 4XZ3A 5LQKA 1NRIA 1PZEA 4ZEWA 2JLRA 4C03A 1VKJA 3NALA 4E1AA 5ECWA 1ZI9A 1P17A 5LDGA 2LDBA 4XJSA 1Z29A 4PSKA 4RA6B 3VZQA 3BXPA 3KYCA 3VUFA 2Z3WA 2H00A 3ZS8A 2PZMA 5KNCD 3BB3A 3GNSA 5F1OA 3CKYA 3TG8A 5FA8A 4DLTA 4AW9A 1MNAA 5AK4A 3WIEA 3DTVA 3U3ZA 1AGYA 2HTEA 5E6UA 4BV2A 2JKZA 3E58A 3S2EA 3G7UA 4TT8A 1JR6A 4Y2SA 3SHOA 1XEFA 2GDWA 1PX0A 5BNWA 3KHTA 3Q6NA 3RASA 5I6DA 3FYUC 4UASA 2GZDA 1Z7YA 3VU9B 2KORA 2HQSA 1KDZA 2VLPA 2Y0DA 4NAHA 3D64A 1B43A 5IM4A 1P74A 1U5BA 2YZGA 3CNQS 4X7RA 2C3PA 4EFNA 1F0NA 2QD2A 4O4LF 4B4WA 3EIOA 3IEPA 5A9SA 3UYLA 2PUJA 3JSXA 2WJZB 5TVKA 1YWGO 1R3UA 1CUBA 3N8DA 1IJEA 2LW7A 2D00A 2QE7A 7MDHA 1RFGE 1H2FA 2KS6A 3DE5X 4KE6A 4BMNA 2QY9A 2INGX 4D6YA 1DIOB 3SSOA 4BNDA 3QA9A 1IYZA 1ST3A 3CRW1 3OEWA 4DMUB 3HXOA 3QXJA 1M0SA 4OYLA 3ZGVA 5FNZA 1C50A 3U37A 5ICGA 2BHTA 3KLNA 5DP2A 3ICQB 3K09A 3U81A 1ZN8A 4NFYA 2J3QA 1OZAA 4N54A 4HGNA 3SGLA 1GZ4A 1R0SA 3JZAA 5IFKA 1RHKA 3DS8A 1ZA2A 3OHSX 2Z43A 3HNPA 5K3AA 2DECA 3VOSA 1T8KA 2Z46A 1YF3A 2AMVA 3BMCB 3GLGE 1FE8A 4OLHA 3IHTA 2BFCA 5C31A 5AVWA 5JNLA 2BFMA 1WHTB 2EV9A 3ZLJA 8ABPA 3EARA 4A2PA 3WHPA 2X4IA 5IXYA 4DB2A 2WSSA 1UP7A 1P7PA 3OD1A 3PC8C 4AJPA 1UBSB 4BP3A 4DQKA 2XTZA 2HJRA 3ZN2A 5K0GA 4EP1A 5FA5A 4F4FA 3GPLA 2VTKA 3ASYA 3CA8A 5IDXA 2HRQA 2IYXA 4JSTA 1FVXA 1G7TA 3KBOA 3EGOA 3THXA 1DNYA 1FRNA 1GQFA 1TCVA 1XD2A 3UKJA 1T2FA 3WKEA 5ITZB 4FT4A 4KGZA 4ND8B 4EKIA 1RACA 4IEEA 4E21A 4QBGB 3OQ1A 1BAPA 3HB7A 3THRA 2C2HA 1JJFA 1ZM2A 3NTEA 1ES9A 5FDFA 5ENDA 5ESXA 5E1BA 2XQFA 1WLSA 4LJKA 4R9RA 4TQAA 1SWWA 1BGWA 3TNFA 5KMGA 1JVSA 4J0EA 3WISA 4RTJA 3HJCA 2NZWA 1K75A 3LUAA 1V71A 2WFAA 4GP6A 5HG0A 3IPRA 1Q5PA 4W5JA 5J5AA 4ZHSA 1Y3DE 4E12A 3UICA 5B12A 3P19A 3IYLW 4XGQA 1SCBA 1Z6PA 2JJ1A 2QRPA 3NYWA 3PF8A 4TROA 1Y1TA 2IS1A 5JZVA 2BI4A 3WWOA 2V1UA 4YAWA 1QORA 1QG2A 1TRKA 2VSFA 2E49A 1Z4JA 3ASVA 2D06A 3T61A 4BFTA 2J6CA 5KUTA 3SQWA 1FLAA 2GO7A 3OHPA 1GZVA 2FMHA 1FTYA 3KJEA 3PDUA 2ARKA 3H5LA 3LL7A 5EIHA 1E2BA 3ASZA 2GZFA 1E94E 3B1YA 4KJZA 4WCFA 1VE3A 2RCYA 1XZQA 1U0LA 4G4GA 1RWPA 1V1JA 3ADKA 3GA7A 3GHYA 4HMPA 4K0RA 4KAAA 4KXWA 4MRMA 1TMYA 2WLSA 2F8TA 3I2FA 1QDEA 1JJ7A 4CHGA 4YASA 1E1NA 5JUWA 2HWKA 4K9KA 4MKRA 1RWQA 3GT7A 3K16A 1CUJA 4ALNA 3H0EA 3F7OA 3LX6A 4ZGWA 2DFLA 2H3EA 2PH3A 4TVSA 2B3DA 4JT8A 1EFVA 2D4HA 2XNCA 5L8VA 3BE4A 5LMNB 2F6RA 2PWAA 2NLOA 3GEHA 3K3PA 3FTDA 1Q6ZA 5JAQA 3EGCA 3RRJA 3GT0A 4MCJA 3QMPA 4B3IA 2AKYA 3EIUA 1TGVA 4LRWA 4IHQA 3W6ZA 1N7IA 4KPEC 3GRZA 3VPXA 1JJVA 2RFLA 4HQNA 1L5HB 4DLAA 2P4QA 4NZ9A 1Y5MA 1A2QA 1KJYA 3DZFA 4AY4A 4RL6A 3PB3A 1NW5A 2YY5A 1IHYA 4PC6A 1QF9A 4QPZA 1VLQA 2IHKA 2I2WA 2HJWA 5INTA 1JPJA 4R16A 4MI9A 1EFAA 1Y7TA 2AX4A 2NM0A 1VQNP 2HREA 2Z6AA 2G80A 1EX9A 1KI3A 3D9QX 4TL6A 1TM2A 5JSFA 4GE0A 3MQ2A 3DE3X 1UEJA 2RHCA 3T99A 3TNLA 3P52A 3E53A 1UJZA 2Q21A 3D5QA 4PTZA 3BIFA 3PPYA 1U1GA 5HCIA 1I7PA 3M8KA 4B2LA 2F55A 1E0DA 2R62A 2I3DA 4GC5A 4X8OA 3TZEA 2ZXEA 1N2CE 1PT7A 3DYVA 3IUMA 3M1YA 4M9ZA 3UHAA 3A9WA 4IH1A 4ISBA 4XB1A 1PJ2A 1M2OB 2QRGA 4ILKA 5E6RB 1TCAA 1RKBA 2DBVO 2P69A 4OF4A 1QO7A 2IH5A 1LI7A 2Y2VA 5C4IA 1SBNE 1A9QA 5JQGB 4EA6A 3SVLA 3WX0A 4GL2A 3TQOA 1PLJA 4LHXA 5BW6B 2VEOA 1SHZA 4XTCS 1RI1A 2CNKA 1YJ5A 1NLMA 4AWBA 1IOVA 3KQPA 4RLSA 1DAGA 1SUIA 3T4EA 2FVEA 2QX4A 3OQHA 3QVOA 1T5BA 3CKMA 2IUFA 2N46A 4OYHA 3GP8A 2CLLB 2DFDA 2GZ1A 4LF7B 3OZTA 1IJFA 3PQCA 1T9KA 2J9FA 4KV7A 2R1TA 1TMGE 3JQQA 4J0QA 4BNMA 3BL5A 1NE7A 4LZJA 1CIJA 2R8BA 3CURA 2H52A 4DHEA 3FDIA 2MU1A 4UAGA 3GUYA 3W5SA 2P2GA 3R5XA 1DRJA 4NBKA 2CBZA 5JW6A 1AH2A 2JKYA 3FETA 1YMVA 4LI0A 3WGJA 4UMEA 3ZDRA 3L0CA 4U02A 1Z73A 1PUJA 4C7OB 1L7VC 3OWOA 5HCNA 3RJZA 3E15A 1QAMA 2NZJA 4L4YA 3JQGA 5P8WA 2PEZA 2VF5X 2ONZA 2G1KA 3GLUA 3M7IA 1XNHA 2COEA 4ROSA 2PEJA 5BN3A 3RAFC 4EHKA 2O0HA 1PEKE 4QOJA 1BKSB 2BDEA 5H9WA 1NGSA 2ZYAA 1UK8A 1NNLA 1J0DA 1OH7A 2IIQA 2OA0A 2PH7A 4G5RA 4YHHB 1A5ZA 1EB9A 2J07A 5B3JC 4RSMA 4MINA 5J2UA 3ITEA 4J1TA 5JXIA 4L9SA 2ZVDA 4B76A 1TQ8A 3JD3A 1V26A 3H86A 4EJ6A 2RKWA 2D1YA 2DFVA 2F8LA 2EARA 2P9TA 2XUFA 4YMWA 3VV2A 3T9BA 4MIYA 6CHYA 3N5KA 1HKHA 2X42A 4IW3B 3ROGA 4XDGA 3M2PA 3ZHOA 4BNGA 3FKSD 3WY9A 1VE1A 2J3IA 3PRJA 4YY3B 1BDIA 4ZANA 3KYDB 2ONJA 4FDAA 1BWSA 3LUFA 2H06A 4JJGA 2AFHE 1C0LA 1CE8B 1QHEA 3B36A 1JFFA 1FDIA 5DFAA 2B0CA 1AKWA 4AG5A 1J22A 2EX1A 1XA3A 1XEXB 4AM8A 4BB0A 2AOXA 4WZBA 3Q20A 4M9UA 4JI7B 1T36B 3S1SA 3IKJA 1L9KA 1I1OA 3VKWA 1DADA 2FPGA 2GHTA 4HY3A 5IDYA 5A3RA 2RI6A 3LXMA 3S3TA 1PYDA 2WJ3A 2XVYA 5BPFA 4BV3A 3T3NA 2VYVD 1CUWA 3RG8A 3HRHA 1P5JA 1RTKA 4EW3A 1FW6A 3B1FA 5FBVB 2PXCA 1WUJS 4ZV4A 2H51A 4BL5A 3KZNA 2V54A 3LWNA 1WR8A 4FYKA 1XRNA 1PFYA 2B9EA 4G5YA 3E35A 3FVTA 5EIWA 1EXDA 3VOBA 2C4UA 4FYIA 3GRPA 4MNTA 3ZZTA 5LQSA 5IUNC 2NSDA 1E2DA 5EKDA 5KKCA 2O5EA 3LKVA 3VNUA 1RJDA 1C9JA 2Q1TA 4JXKA 4PX9A 4L5YA 5TR9A 1J7JA 3DJFA 4RORA 3U4CA 5I7VA 3Q72A 4DEYA 1GRCA 4ETIA 3KQYA 4LPKA 2PQ0A 4CKEB 2CCJA 1QH8B 3W6NA 2W2TA 3G88A 2GHIA 3W4JA 4E2XA 4F4CA 2C0CA 3F6YA 1ZD8A 4FEEA 5DB4A 2RKOA 2R3SA 1UPBA 5E38A 1UJNA 3DD5A 4I4TA 2WB2A 4GR2A 4BPFA 2WTBA 3PHLA 4PNEA 3OA2A 2Z04A 1H6BA 3B78A 5EHQA 2OENG 3KQSA 2V9PA 1N6IA 4DC0A 4DIEA 1YJQA 1SKQA 5M7EA 1VPLA 3TIXB 3JU3A 1SC9A 5DTIA 5FNVA 3T5TA 5LNK1 3E2IA 5ED0A 1WW2A 4BUZA 3OJLA 2NZ2A 4R4JA 2HLNA 4K1LA 3N2ZB 4MQ5A 4P38A 3JTEA 4OQFA 1CYEA 2PJDA 1EVJA 5EHNA 4A0RA 3N86A 2P3LA 3WFIA 1YKSA 1TYBE 3I28A 4LVCA 1UEIA 5ICSA 1JHPA 3ZNNA 2GB4A 1PR6A 1QJ4A 5F78A 4BQEA 1GAJA 1Q12A 1ZYUA 1NJFA 1RRGA 1TC1A 3H9BA 1IHPA 2NXJA 1ITZA 3HN2A 3IOYA 3EFBA 4MV6A 2FPUA 2IZ1A 4IVNA 4MVJM 4BGEA 1WZ2A 4NBNA 1TLTA 1CJCA 3AIKA 2B1RA 2QNBA 3OHMA 1XNGA 4Q9HA 5B6IA 2CFOA 1L0IA 1CERA 2HCBA 1BN6A 3OFSA 4DQLA 2DY0A 3C98A 5KINB 1J2TA 4FGSA 4JHLA 2B1JA 2VLQA 2C92A 4OU5A 1SXPA 3BSSA 1Q7RA 2XXBA 1IMJA 2G70A 3RVQA 2HT6A 1JAXA 3ZHCA 3HR8A 2ZRQA 3WSTA 2JGDA 1A4UA 1Z38A 4B82A 3LA6A 4J0IA 3F5MA 2Q3BA 4FCVA 2A0YA 2NO0A 2CLCX 2VPZA 3W2GA 3WLMA 4IIJF 1VMIA 5AOCA 5G0TA 3ZU5A 3JAKA 2C8VA 2VDOB 4JP2A 3ETGA 2RGNA 1B4DA 1L6IA 3EZ2A 3VO1A 3GLFB 3HJRA 3AG6A 3WB0A 1J8MF 2AC7A 3HXKA 1AURA 2AZDA 3OCYA 4GI2A 4ARSA 3NOOA 3OPYB 4J6FA 1H1LB 2OVFA 1ZA1A 4V3BA 5FTMA 1W34A 4XRQA 3RG2A 4R1LA 1H8ED 2CKDA 3PSHA 4TUYA 2QU8A 2V0CA 3MTEA 1MVNA 2ZI3A 5B2ZA 4R7GA 3LHFA 1GL9B 1RFLA 1RRPA 1H9CA 1DELA 2C8LA 1NTOA 1ISMA 2VP2A 4XWWA 3CCJP 3C3MA 2UV8A 4KDFA 1CRWG 4U5XA 4UVHA 5WRFA 4ZYLA 5IT0A 4HDAA 3U5ZB 2C5LA 4GUAA 4GYWA 4AF8A 2WJHA 2OG2A 3H17A 1JJAA 3TL6A 1YA4A 4F2PA 3MBIA 5JTTA 2E55A 3BF8A 1G20B 1PTJC 2RAUA 2QAGB 1N6LA 2YFHA 3GXBA 4AF7A 2FQQA 3WA7A 3SX0A 4QODA 4CT0A 4DMHA 2Q8NA 3BREA 3RNOA 2DGDA 2M98A 3P2EA 3NEAA 5BWMA 2CNWA 1QFXA 1CUSA 1SCQA 1VJDA 3BXHA 3DE6X 3DM5A 4BPRA 4Y6OA 2Q3LA 5DW3A 3TRHA 4EY7A 1ZHHA 4KQ1A 2ZJZA 1TAQA 1KVQA 2GBIA 4U7WA 1Y8QA 2GF9A 2PEOA 2JASA 2VPQA 3N2GB 4YJ3B 4X63A 5DXFA 4P36A 2OUKA 3CKKA 5SZJA 5JE8A 1RYYA 3GLKA 4AMUA 1AKTA 1BMFA 5L3QB 3CLRD 2WHPB 1N9ZA 1GPJA 1YRLA 3OZGA 2OBBA 2IELA 3MWYW 4B3XA 1P2SA 4GM0A 2XAAA 3IQHX 2SHKA 4CQLB 4DR7B 4ZDKA 2XE4A 4MB0A 4RKYA 1L4MA 2ZB7A 3QEJA 1TYCA 3K30A 1V2GA 2MYTA 4TLMB 1HWYA 3QPUA 1MG5A 4LEIA 4ITVA 5D51S 3SJZA 1ML4A 1YASA 4X6YA 4FC7A 3VUEA 3CCMP 1AB5A 3B3JA 1A9XB 4YMSA 3A4LA 4BO2A 2P11A 4Q9IA 4HUQB 4OOEA 3ZD9A 4Z54A 1QHHA 5ITSA 5JWOA 3M6IA 2NZUG 2EDCA 1JGTA 4UJ5A 3NZEA 3PLAE 1NJSA 4MJXA 2VSQA 3CC7P 1QO0D 1V1RB 2VDMB 3G5AA 4QYIB 5TQVA 3VSEA 3AVXA 2NU6A 3VNSA 1HFKA 1CDEA 1N7GA 2QMYA 1TK3A 1Y1LA 4TRMA 3PQ7A 4WL0A 3B1ZA 3CUTA 4MLCA 4ZCRA 2OV3A 2H31A 2I2AA 4NI5A 1YULA 5BV8A 1E1KA 5FWDA 1RMTA 4Z1MA 1E7RA 1BEUB 1WSAA 1BDMA 5JWHA 1E9DA 3JZMA 2RHTA 4LISA 2IXAA 4IXTA 4QEKA 5CH5A 1W87A 5DMXA 5GADl 4B7ZA 3E3LA 3H1PA 4L7QA 5DPMA 4OAOA 2JFXA 4O2AF 4IJQA 4PHFA 1ZUNB 4C01A 3U4IA 1O87A 5MFZA 3TEJA 4PZCA 4YJFB 2GTHA 3OJCA 2JLZA 1GPUA 2BE9A 2EAUA 4FS8A 4RK6A 4EVQA 3UENA 4LSWA 4FWTA 1JX6A 2QIOA 2B25A 1WG8A 1VC2A 3DXYA 3OOSA 4O1MA 4OBWA 4RESA 4DMMA 3ZV7A 5CXSA 4DIKA 5BWBA 2GF0A 2YRXA 1A9YA 3ABQB 3LT4A 4K3UA 2QNIA 4N65A 3S8EA 2DX7A 3H9GA 3J7TA 4P80A 1JYSA 2VVTA 4HRYA 3FWYA 5AVRA 4ENSA 2J0UB 1NMXA 1MZ8A 1T0HB 1I0IA 1HEUA 4HLUC 4QUKA 2LNDA 3CRVA 2CGQA 1ACMA 1U7HA 2NUBA 3GMIA 3V6LA 4D3ZA 3W6PA 2NN3C 1BD4A 2QRKA 3NTVA 4D4KA 3L6OO 2I3ZA 4JMLA 3GQBB 2NUAB 4IG9A 4LYJA 1TW2A 4EQ6A 4GKKB 2CBXA 1C3OA 2CLFB 4S1VA 1ZZGA 1O8BA 4URFA 1VHJA 2Q4BA 1T8PA 4WX2B 4X00A 4R6WA 4RIEA 1K30A 1SBIA 3UV3A 3HP1A 1ODLA 3ZHRA 2JVIA 1Y42X 1F5NA 1I9CA 1QFYA 4Q4AA 1T9AA 2O2EA 3JAWB 1I4DD 4K03A 3VDQA 4RHFA 2PA0A 3GZNA 4F11A 2IPXA 4XVUA 1U2DA 1FF9A 2GCEA 3OPQA 1KQ3A 3RSHA 3S68A 1THGA 1M6EX 2GN9A 1G38A 2C8JA 3DV0B 2ZKLA 4KIGA 1J49A 2BKLA 1K7CA 3D5TA 3RD5A 3ZY4A 1JKJB 2PWBA 3GU3A 3ZK8A 4DBLC 3PRYA 3EGXA 1R18A 2RHRA 1F8FA 3CIOA 3B9RA 621PA 5K45A 2FUCA 4QXOA 4EI9A 2B34A 4ARVA 1PS8A 1ZSYA 3NWJA 5IKOA 1UM9B 4LZPA 4J7UA 3B3QA 1K5HA 3O3MB 3LQKA 4ZJZA 3I3SR 2Z44A 1QRTA 1MMFB 3K5HA 4UTPA 1J06A 4UM8B 1KMIY 1I0LA 3BD7A 4XRGA 2CV1A 3VJRA 1C3EA 3MT0A 1J39A 1NY5A 4GD3Q 4RTMA 2JIRA 3Q7IA 2L22A 1W5AA 3MD9A 1PDWA 1WPXA 4HB2A 5AT1A 3RH0A 2YVUA 2X2EA 3M9XA 2EYQA 2O19A 4TMFA 1SIOA