1ZMBA

Crystal structure of the putative acetylxylan esterase from clostridium acetobutylicum, northeast structural genomics target car6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Acetylxylan esterase related enzyme
total genus 94
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.110 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1zmbA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1zmbA01
1JRLA 1ESCA 5A4AA 1ESEA 2WAOA 4HF7A 2VPTA 4M8KA 1DEXA 4JHLA 4LHSA 4K9SA 1PP4A 2HSJA 3P94A 3SKVA 1J00A 1YZFA 1VYHA 4JGGA 5HOEA 1ESDA 4RW0A 4JJ4A 4HYQA 2Q0SA 2WABA 2APJA 3RJTA 1Z8HA 2Q0QA 4JKOA 4H08A 4IYJA 4Q9AA 4I8IA 4PPYA 1IVNA 4K3UA 2O14A 3BZWA 3DT6A 5BN1A 4S1PA 4JJ6A 3DT8A 1ES9A 1FXWF 2WAAA 1ZMBA 5CD9A 1WABA 4NRDA 4XVHA 3KVNA 4K7JA 4RSHA 2W9XA 3DCIA 3W7VA 4Q7QA 1BWRA 4OAOA 5B5SA 1VJGA 4DEVA 3HP4A 4OAPA 1U8UA 4K40A 3DC7A 1BWPA 5JD3A 1V2GA 3U37A 1BWQA 3DT9A 3SLRA 1K7CA 1FXWA 4TX1A 3C1UA 3PT5A 1DEOA 3MILA
chains in the Genus database with same CATH superfamily
4WY2A 3T5GA 3FOFC 1Z4OA 5HIAA 5KYYA 4TV9B 1NBMA 2NXEA 4RQUA 4UM9D 3C8HA 1S3SA 3JZFA 2R6GA 4OI1A 3UGTA 2OFXA 3AR8A 3JQ7A 5E2AA 2WSLA 3KIPA 1XZGA 2JIMA 5J3JA 3B3FA 5FNVA 5ESDA 4QOGA 4A0QA 4J8PA 4OHMA 3H2ZA 5U1PA 4PGGA 3L7OA 4EVQA 1GG8A 4I9NA 2JJMA 3EXFB 2J09A 1JU4A 3GJNA 3SKVA 4A23A 1FFAA 4K8RB 4F37A 4UOQA 5K3FB 3KU4A 2GBFA 4CW7A 1GTL1 1UBCA 2M9MA 3GG2A 1WULS 3I9OA 4F1KA 2BTQB 4KITB 4WZBE 3SJ7A 3BEDA 5HA5A 1BAJA 4YMWA 3GCGA 4K9RA 3UK1A 4A36A 1F9EA 3C5WP 2OAEA 3A3YA 3IAEA 4XEHA 3STYA 3ICEA 1ISJA 3TTVA 2EKQA 1K9VF 1L7RA 4FYVA 3U40A 2PZJA 3IV7A 3UHPA 1BYUA 5HIJA 5BPFA 3O26A 5L6LB 4G9BA 4U7FA 3ZD6A 4E21A 3MJEA 4PIVA 2BELA 5ICEA 1TTPB 3DWGA 4PBTA 1BIFA 3OEEA 5E9JA 4RYLA 4BQEA 2PEIA 1JR4A 1VKJA 3A1TA 5FBLB 5H9VA 4LOKA 1WDWB 4L16A 4P3PA 2O14A 1JHOA 4YXWD 1IK6A 1LSOA 1EWYA 1XEXB 3OKPA 2QL9A 4LXQA 4HDMA 4ZGWA 4YY3B 1UDCA 4OGFA 3OTGA 4ZVQA 1U04A 3QPDA 5GJWC 1FX1A 2C8LA 2ZIVB 5IMBA 1LRLA 3ETGA 1PUIA 3NQ41 4FBMA 2R00A 2EWVA 4DWWA 3L6UA 2DYKA 2O6LA 5D85A 4FR2A 1G8HA 4ZHQB 1U65A 3O8NA 4PLGA 3QXJA 4J2TA 4F4IA 4HGQA 3L1IA 5K3SA 1OI4A 3IEIA 2YV2A 4D4IA 3VO9A 1LJ8A 1SVWA 2IPXA 2JLAA 1TRHA 2JIPA 3Q7PA 4LUCA 5G4LA 1HFWA 3ROTA 1Q6ZA 5J1TB 3BFJA 3SX2A 4BQSA 2I67A 2CT8A 3ZWPA 1G55A 1KAOA 1P73A 2AE2A 2G25A 2OGUA 3T34A 3T99A 4NE9A 2FXVA 4YXFA 4EM6A 1I6LA 4DRYA 3LS2A 3R3UA 2H1VA 3H17A 1NY5A 3QFFA 3EOZA 1ENOA 1A9TA 1H1LA 2X6RA 4BGEA 4TL9A 1E3LA 4LWPA 2PG3A 1G8YA 3AU8A 4LXIA 3T41A 2YDXA 3DFKA 1DX4A 2WLSA 4QRDA 4MEAA 4X20B 1TI7A 1P7PA 2AVNA 3DMPA 1GWNA 4RDIA 1QP0A 4X3PA 2QRQA 1POWA 3SN6A 2IYTA 4K40A 2WJ6A 4JJ8A 5JI2E 1CZKA 1GP2A 2QRLA 4U2KA 3G17A 2AX3A 2OILA 1U7DA 2QW1A 4WXHA 4I4NA 9ATCA 3SLRA 3ZE7A 1QIKA 1FPQA 2FN9A 4ITRC 3DVLA 3ZDEA 3T0GA 1N4AA 1U0SY 5TMDA 2GHIA 1M67A 3VUFA 1FDTA 1KJQA 1R9NA 4JLWA 1C5KA 3E1GA 3KR9A 1U3GA 4JXJA 5BSMA 3IBSA 1K2WA 3TRHA 3JRNA 4UPEA 5IDQA 1VHQA 5AW3A 1DT5A 1AQUA 3MJTA 1UNKA 1Z88A 1SXJD 4I8DA 4K1XA 3GFVA 3DCNA 4TTAA 2CSXA 3SS9X 4ZXPA 4LFAB 3OCUA 4MPRA 2AOVA 1AV7A 3W9BA 2OHOA 3R3HA 3GZNB 3LKVA 4LNHA 4WY5A 3WLKX 3LXXA 5K45A 1U3TA 2VH2A 1E5VA 1CR2A 1M76A 2FSUA 3GIWA 4P33A 1V47A 4HMQA 3IP6A 3OZSA 5DWQA 1YE8A 4OHOA 3O3OB 1L4LA 3F4BA 3PKZA 2PEYA 3SKXA 1L8OA 2VHTA 1WMDA 2CLFB 3PITA 1JWBB 3D02A 1Z33A 1NVMB 4PC1A 3MOIA 2QMQA 3WGQA 4W6ZA 4Q9LA 4EPRA 3OEYA 4OUDB 3GUYA 4NNJA 2P6RA 3KOZA 2P9YA 2B6NA 2CB9A 2YIMA 4FQ5A 4NCNA 4B2YA 1ZQ1A 2PZ8A 1KPGA 2O2GA 3N5CA 4HSEA 1UKYA 1QBKC 2G6TA 3PNMA 4YAUA 3GLSA 3L7CA 5KAMA 4EK9A 4KE6A 3B7GA 5B53A 5KVVA 4QDXA 1XMQB 1FFHA 1ZH0A 3FNIA 3MGAA 4QPJC 1G5HA 4CKEB 2BEUB 3ZDFA 4CFZA 5HW0A 5FNVF 2MOKA 2X86A 2GZRA 3TNFA 1C9EA 2OBMA 3E7DA 3USCS 3WKBA 5KB3A 4IQ0A 3UFXA 4EOGA 1XEFA 4YP7A 4EFMA 3WX0A 5HR5A 2QZZA 1E6LA 4X95A 4UNRA 4OP2A 3IQXA 1TU0A 4YYEA 1NNI1 3HLYA 1NBMD 2WDZA 3PPWA 4Y1EA 1K63A 2L69A 3DKKA 3LPDA 2D54A 1O5OA 1J90A 2IHZA 3JQEA 4DYVA 521PA 5G3ZA 4ZO7A 4H7IA 1TVMA 2O2ZA 3OZXA 4HUJA 4BX0A 4F12A 4DA7A 4Z4FA 3NAMA 3R20A 1Q92A 1BDBA 3SHFA 4HPWA 4EI9A 5B6IA 1H3EA 5DLDA 3QXXA 4L27A 4IO0A 1K6XA 4POOA 2IEIA 1TO1E 2IUUA 1NX6A 2GX6A 1T9BA 2X4GA 3EIHA 3GFQA 3LBHA 3NAGA 3PDUA 3EAGA 4H18A 4W5HA 3SLKA 1VE7A 1G9TA 4IDBA 3BZUA 1SRRA 3ET5A 1N32B 1CRLA 1WBBA 3PPYA 1UQUA 4EYOA 1UJ6A 4MR7B 3ZTWA 1R8SA 2RHRA 4KAJA 4AF6A 3U60B 2WYIA 1YR8A 1YOBA 3FOCA 3RU3A 3P2IA 3JQ9A 2H59A 2QTCA 4RKWA 4A2QA 2C54A 2JFBA 1J2YA 3OTWA 1LFAA 2DY0A 4FMPA 4UU1A 4DDVA 1VCOA 3TLZA 5FPKA 5HX7A 3KFXA 1EFPB 1PSDA 2YFQA 3ABZA 1EQUA 4Z9AA 3MD9A 4IW3B 3G2MA 5GY7A 1WU8A 4R98A 2XBUA 1IPEA 1Z68A 2QV0A 4TS3A 4MW0A 2QN8A 4QDUA 1BWPA 5C5DA 3K70C 1Z2DA 3QRWA 3R4CA 3X43A 1E7YA 1RAIA 1KJNA 4MUGA 5J63A 3H11B 2FQWA 1QJ4A 4MP8A 4EHFA 1QUEA 4IH1A 3ASYA 4MWBA 5I7SA 3FOEC 1LDBA 3EEOA 4EYKA 1PIWA 3CFYA 2H48A 2KGAA 1YRYE 3M1AA 4EQ6B 5K51A 3GQBA 1LPMA 4Q7MB 2HQOA 2CDCA 4I46A 3LY5A 3GP3A 3JALA 4IEIA 4TRJA 3OZTA 3PQ5A 3PNKA 5HQTA 1KY4A 2NXCA 1U2GA 1L4MA 5GM2A 1MX1A 1XMPA 3D3KA 4Q05A 4TTQA 3UMCA 3ZE2B 1NF8A 4JJ7A 4TWIA 1UDAA 2VF5X 4BPFA 5JDCA 2TSYB 3ZOZA 2BGRA 4RQTA 2HI0A 3DVQX 2J7PA 1K8AQ 2D06A 2AV6A 4QTZA 4ASUA 1CD5A 5K3FA 3QP9A 2FN8A 3SQXA 1JNXX 1JFFA 4J49A 1ISFA 1CEIA 4X1YB 5COBA 4L4SA 4L4YA 5D6OA 3DV2A 5BYJA 4ETIA 1WPGA 4JQSA 1RAGA 3GMSA 4JT8A 2IPAB 4KZPA 3QQPA 5I45A 1KOJA 2BEWB 4ER0A 1R88A 4P81A 3IUQA 4HJRA 1W581 4XA8A 1F1BA 1O94D 3R41A 2FOIA 3N8GA 3KQHA 4U2FA 3BICA 1I5RA 3IVRA 4FE7A 5AW9A 4HB0A 1MBZA 3ZHSA 3WK6A 5GTDA 3KXLA 1E61A 4GPIB 3B6ZA 1YB6A 1YI0A 5JCZA 4G5RA 3OY2A 4INAA 3CGWA 3OTQA 4TXMA 2RHTA 2M5RA 1IZ9A 4JB3A 1IJEA 1SU8A 2AFIB 4TRRA 5AVKA 2YJ6A 2YWJA 3GLVA 3OWHA 1G8JA 1Y3HA 3DHWC 1Y81A 2FR0A 3ZR4B 1U4NA 1SCUA 3H0KA 3AHCA 3VVMA 4HYQA 2W2KB 5IXYA 5LXTA 4E14A 3GRUA 3EQ8A 2YXDA 1L1FA 1ID8A 3K6SB 4KXMA 4WLFA 4WPGA 5KQMA 5FOXA 3RBZA 4GBJA 2UYGA 4G3XA 1L7AA 4CKWA 3F97A 4LF8B 1U6JA 3QYJA 1LK0A 2GN8A 4CKBA 2XOEA 4DUPA 2XZ1C 1GA6A 4QUAA 4C0QC 2AC2A 3VPCA 1RRMA 2XMDA 1VQPP 1W85B 2AN1A 4ZV7A 3SC2B 1T5DX 1XAGA 1AF7A 3TAXA 3SCZA 3CF4G 5EIHA 1UM8A 2ZIXB 4Q3DA 3KWMA 4M9RA 1CUSA 1RM3A 2D1QA 5FNZA 3FF1A 3HV0A 4JKIA 1QRAA 3NH9A 3PU6A 2C2KA 4JFRA 4CTJA 4CKCA 2EQBA 2PX0A 3VR6H 4D6PA 3CVJA 4M0LA 2JAHA 4RLSA 3MSXA 5BSKA 1E1RA 1EA5A 2ZSIA 4ER7A 1FDSA 1NW5A 3B6IA 2RHCA 1HYHA 4Z1MA 1AH2A 2X7XA 5K8VA 1J70A 1JAYA 1ULUA 5DGCA 4D92A 5EG5A 2WHEA 4I0WB 2HSGA 5K5EA 2QTZA 3H5TA 4D4KA 2J9GA 1CY0A 2O57A 1UZNA 3G5MA 5CX4A 1XX6A 3LSTA 4PAOA 4CZ2A 2XNHA 4MW4A 3CRMA 4ABYA 4I19A 1ZGCA 3BRWD 5TDHA 4MYSA 3K3PA 1II0A 4EMSA 2O1EA 4FFNA 4Q1FA 3G23A 3SQWA 3JAMA 1TYAE 5L8VA 5EPUA 2CNLA 1J0CA 3GOHA 1JLKA 2O07A 2C8JA 3TB6A 1OGJA 3EVEA 2P90A 1DJNA 2XYPA 3KSUA 5JY1A 1C4KA 3BZBA 3PT9A 3KAQA 3LWNA 3MRTA 2WINI 1DC4A 1E5XA 4W9RA 1TL7C 3T5DA 2LL8A 3R0VA 1I4WA 2OQRA 3I01A 3WLQA 1EMDA 4WUVA 3F9CA 2DKFA 1S89A 2EP7A 2R6JA 4DMRA 4RM2A 5IFKA 2V55B 3OHPA 4DR1B 2IXTA 2VHCA 3LXMA 3T5AA 1B2LA 4BO0A 1IY8A 4MRRA 4R41A 3CZMA 2PGNA 2Q1UA 4Q93A 1VMIA 5CVVA 1CU1A 3NFRA 2AUMA 1RACA 1CQJB 3A6EA 4RD6A 3V8QA 4HVTA 2C94A 1IXKA 4GT1A 4MH0R 3ZUGA 3G0GA 3WMGA 1W59A 2Z2XA 1YS6A 4O5OA 4LJLA 5ER6A 3WGLA 3COZA 1CS0B 2VZEA 3A1NA 1OI3A 3DO5A 2PT5A 1WM1A 2P65A 2ZQ5A 3C1TA 1R6TA 4OV6B 1NATA 2WRZA 1SUDA 3VZDA 2F8LA 2IT1A 3PTAA 1C7ZA 1FOEB 1XV5A 2VCYA 1NF3A 2AMJA 4ON9A 3MUOA 3EQZA 2PQ6A 3KFVA 4JBNA 3W90A 3T3OA 3LDFA 3A3PA 3EXEA 1T6YA 1SHUX 4GR6A 1YMQA 5DGHA 3AY3A 4X00A 1UC8A 5AJYA 5C9ZA 2Q8NA 1AG9A 1G8FA 2WQ6A 4GEGA 2PH5A 4XFJA 4IVPA 3GPLA 2BUBA 4S35A 2F90A 5FBRB 1MRZA 4ZVKA 4UE6A 3U9LA 1EUCA 3D5TA 1XZEA 3FROA 4QU8A 3IMGA 3F6BX 1RJ9A 1UZAA 3OF3A 3R7NA 1VQMP 4HEQA 1PEDA 3GPIA 1JSLA 1LI4A 2QA5A 1N2SA 3OQPA 3WNBA 6NULA 2YNMC 3Q87B 4J6EA 4XOIA 4GVPA 1M2FA 3VHQA 3KE8A 1UC4B 3DBIA 3KJZA 3N58A 2B4KA 4L7QA 2YOHA 2C0PA 4GI1A 4P6VF 3EXHB 3U4DA 1RKUA 4W8HA 1U2SA 3PGKA 4NS1A 3IYLW 1T9DA 2JATA 4PG8A 4KYTA 4W1SA 1FBTA 2RG7A 2SBTA 5J4HA 3PQ8A 1XJ0A 1GZSA 3W04A 4F72A 1QYDA 1KTIA 5BWCA 3AG6A 1IVYA 3INRA 2QDKA 5FQNA 1GQRA 4FQ7A 1SG0A 4Q1VA 4L57A 1G41A 3FTQA 4XJSA 4Y6PA 1XXHE 1CTQA 4DSNA 4EEXA 2Q9UA 4CODB 4RHXA 5HJ7A 4Z3DA 3B13B 1SVSA 4ZMSA 3CVYA 1EB8A 1G3MA 1XLUA 1R4ZA 4ETMA 3R5SA 3TCNA 5I9BA 2GFIA 1IRXA 4R5MA 4UBNA 4ARSA 3LHKA 5AW8A 4BXOB 4U0BA 3C16C 3KT8A 1U9JA 3O0DA 4EVRA 2IE0A 2UYYA 1GAEO 4QU0A 3HYCA 3IEKA 4U2BA 2NU9B 2JS7A 3DPUA 3I1YA 2A5JA 1P4RA 2FMIA 3B82A 5DTJA 4Q5IA 1QX3A 1NQXA 4MKXA 4M53A 2AYZA 3SYNA 4B71A 4CM6A 4WGFA 1U6IA 3NHYA 4BMCA 1V41E 3JAKA 1UF9A 2ODQA 4A8JA 3PDCA 3RD5A 1PQWA 1QJCA 2O8EB 2YXNA 2HIHA 4N12A 5ALYA 4JI5B 4A8HA 4KJZA 2Q41A 1NNSA 3VDMA 4E5MA 3H18A 1LLCA 1LU9A 2AVAA 5FO0A 4DRXA 1DG1G 3N28A 5CJPA 3DTJA 3VBEA 5JH7F 1JIVA 1DUVG 1KKMA 4EUNA 1GPNA 1ZC3A 3F7MA 1V43A 4P35A 1JLHA 3PUHA 2Y0BA 1O77A 4BRSA 1V95A 1JTFA 2C5GA 2FUEA 2OQIA 3BWCA 1O94C 3OSZA 4B4UA 3JYOA 1IDN1 2HSDA 1HDRA 1GU1A 3AIMA 4U63A 3HUEA 3MZ0A 1Z0UA 2HIAA 3MT0A 4F1WA 3EE6A 2Y6UA 4WZAA 1E89A 1VKZA 4TLDA 2PJDA 2JD0A 1Y9DA 1ESNA 1RYNA 4HHEA 4TMTA 3WGVA 1YL5A 1DJOA 1OKKA 2EFCB 2N9UA 3I4LA 5DCWA 2VRNA 3JQQA 4GS5A 5K3BA 3JV7A 2IZ7A 3OO0A 2WV9A 1OLUA 2JLWA 3N8IA 1HYEA 1E1DA 2OPHA 3P9SA 4KXVA 3TJMA 2HJSA 1P77A 2O4UX 1E98A 8GPBA 2HPAA 3O2NA 3Q12A 4DZTA 9ABPA 4BUCA 4JVMA 5BT8A 5D5HA 2W93A 1AN0A 3FKJA 1QB8A 4AQ7A 4RA9B 2GM3A 4IWXA 4V38A 4CHTA 5KDOA 3B1FA 2UKDA 1K6JA 1L4EA 3SC6A 3ESAA 3L6DA 1CETA 4PS1A 1FVXA 3NS7A 3AKCA 4CUZA 1P0MA 2IZ6A 4MOWA 3CCUP 1TMKA 3VYUB 1NJ6A 2A78A 4QAJA 3MINA 1SIBE 5TEVA 2FZCA 3DLIA 3UK0A 4DMGA 1JZTA 5REQB 3W9SA 5JZ9A 4I6EA 4KFRA 3K0EA 3ZS8A 3MLEA 1NN5A 4QUKA 2I4RA 4OHVA 4QUHA 2X0NA 3WAGA 1V1JA 1PEAA 5L3ZA 1IB0A 4CEIA 5AOVA 5H9WA 1KIMA 1MB0A 5HUJA 3KPJA 4FEYA 2N75A 1Y34E 2FF7A 1UJ2A 3P4XA 3B1ZA 4HYEA 5DGIA 4HKTA 3V7NA 5EL0A 1RLTA 1OT5A 1KK0A 3E9DA 1EZZA 2FZWA 1ULHA 2EZ8A 2P79A 3I01M 4HKGA 3JYHA 4ARAA 2QTVA 3WIUA 2A9QA 3KHUA 3L7AA 1JYEA 2JC3A 5EXTA 2WUDA 5JVDA 2W4MA 3ORQA 4ZOLF 2ZJ7A 1U0JA 2OE2A 1P9RA 4Z9YA 1YT5A 2F48A 3QNUA 5GWXA 3ECCA 4J9UE 3H3FA 2RGRA 5H81A 1TPZA 1QVAA 3WV4A 1E3EA 5I4TG 3GRKA 4LZWA 4WX2B 5FH9A 3GN2A 3VRHA 1KY2A 1SXQA 3G79A 1QYCA 3A9CA 2IXDA 5CW1A 1KMCA 3DFMA 5A3VA 1S01A 1B6TA 1LBQA 3KVNA 2B9VA 1WAMA 4Q66C 4UM8B 4X97A 3GEBA 4ARIA 3GLQA 2RHLA 4L08A 1WU7A 2LR0A 3EIOA 1HT2E 1ZNWA 1KTVA 2NXNA 1Z8DA 2NUPB 1T26A 1X0XA 3KAPA 4PG7A 3RHFA 2AXPA 4LWQA 5A5GA 2BR4A 2ZUWA 4ZVPA 1QVZA 1XKTA 3ZZMA 3OM1A 2JGMA 4OGGA 3FSRA 2J4DA 3A9WA 4TMZA 3HJBA 3S2UA 4Z9BA 4AJNA 5BR8B 1KF0A 1TM7E 1DAKA 2GDWA 2CDBA 1ZHFA 1L7OA 3TW0A 3WGKA 5CFZA 5HRAA 1T8TA 1DTEA 1JHPA 3H1AA 3H16A 2Y6VA 3PFBA 3LKBA 5FQOA 3AERB 2EKPA 2ZKIA 1A98A 4YJDA 1EP1B 1PUXA 4O4JA 4JWTA 4BV2A 2M8LA 2PKCA 2R8ZA 3RUFA 3I5XA 4R3WA 1VQ5P 1NUTA 1V1RB 4BO7A 4IIBA 3QFHA 1BFDA 3ZZTA 5K20A 2XA2A 4EARA 4BQRA 4RULA 1ZIDA 4JI1B 1RZVA 2ARKA 2WFLB 3HHEA 3RSLA 3KQVA 3STWA 5K6RA 1YAJA 3DB1A 3P9PA 3PTLA 4HWGA 2RH8A 3Q0TA 1QMGA 4RMIA 3UGJA 3EGDB 1JU9A 1ZCJA 3RBAA 4ZOCA 2N0SA 1WLYA 3JY6A 5HPYB 4ZYXA 2PWZA 2PUJA 3P27A 4OJQA 2C99A 4HGZA 3E2IA 1B8OA 1XD9A 5JQGF 1HPLA 2GEUA 2GN9A 1NULA 2JFUA 3H2KA 3L0ZA 5K0EA 5E2BA 4J1SA 1Y1TA 2CSUA 2GCGA 2C2HA 2XCUA 2XE7A 1XCGB 4MI3A 4D9KA 3RW9A 5F1OA 4G23A 1NLUA 2AGVA 3VZBA 3X2FA 5CXUA 5HQ3B 3OQNA 4B4WA 1V7CA 2WFMA 3UWPA 4MVWA 4WNIA 5MN6A 1QOPB 3OJFA 4L0MA 1XRNA 1E66A 1O9BA 1J56A 1T0BA 1W2WB 5FXMA 1W49A 4ICIA 5HJEA 3KSBC 3FLBA 1M2OA 4GOJA 1U5AA 5HSGA 3U7HB 5BN4A 3A2MA 2NUTB 2V6JA 3IEUA 4NJOA 3S28A 2JAZA 2GH1A 3TFWA 3T7JA 2X0RA 1BGWA 4FGKA 4KR9A 1F60A 4M1KA 1JSCA 3LH5A 4IDPA 4G9GA 1Z4LA 3T5PA 3GJ4A 1GA4A 3BBLA 3GMTA 3IJEB 5D3ZA 3TW4A 3WL5A 1ONSA 2DR0A 4IHJF 4U0AA 4LBZA 5CH3A 1QNFA 3ZJUA 2EFDB 2ISQA 5DO9A 4F3TA 5F33A 2P4HX 5CT9A 2ZIEA 4D57A 2QR3A 5A4KA 3EPKA 2XITA 4ENPA 4IXTA 2ZE8A 2P5TB 2CDRA 4MPPA 1HNNA 3UUWA 2H2WA 3M83A 3ITKA 5EOVA 5JROA 3K09C 4E2YA 1DUIA 1WRBA 4FJ2A 4P4SA 3C3JA 5E1DA 2VP3A 4ZYUA 1JPJA 5FX2A 1ZAYA 4B3SB 2B37A 3TQCA 2VLIA 2CFOA 3HVHA 1NZFA 1W5TA 1R4MA 3CEAA 3QY9A 1G8AA 3AM3A 5JPAA 5DCYA 1B0PA 4QBIA 3I6MA 3N0WA 2I78A 2L18A 3QXGA 1M6WA 2XTJA 1SEVA 3UW1A 1HE1C 5J1SB 1BOFA 2QJFA 3ER6A 3NVMB 4JC4A 3U13A 4RLFA 1WMSA 3WKAA 1JTEA 1NUQA 1NRIA 3M3PA 5DCUA 4CLDA 2B2XA 1EXVA 3Q9UA 3V1LA 4ZDWA 4BP3A 1JVBA 3DS0A 2POQX 1HDYA 3EQ9A 3CINA 1B93A 1DHTA 1R9JA 3WYNA 3KAJA 1BXZA 2GILA 2OCYC 4LX0A 3DYIA 4V0SA 3V80A 3WMRA 1ATIA 2CMFA 1QANA 4PAGA 4JI4B 3K9WA 3OJCA 1E9RA 1Z5ZA 2V3VA 5TX7A 1QOQB 4WRRA 3RH0A 3VR3D 3VPHA 4B3IA 3HCNA 5C3MA 2ZZNA 3EG5A 2XT6A 1BDIA 2QDXA 1RLMA 3EBLA 5E0OA 1F6DA 1U3DA 1GZUA 3P32A 1Q1ZA 4JVSB 5DKFA 5F3RA 1YL7A 2QI9C 1L7BA 2HMTA 2LKCA 2LPMA 5D01A 3ENZA 4E32A 1LPBB 1OHHA 1AO0A 3TGPA 4ALKA 5GAJA 3V7WA 3NT5A 4EGJA 4PR3A 1M72A 2QEXP 4WK0B 3ZCVA 1YJNP 3H47A 1DEHA 1SRQA 2YRWA 1R10A 2H65A 2V45A 3ADKA 4KQMA 5CR9A 3UTDA 3VR1A 3MHPA 4IUYA 3HR4A 4C21A 4F2HA 1ZI9A 1V5FA 4C05A 1ODIA 1WDTA 2V6IA 3AT1A 2DX7A 4N9QA 1RJFA 3D7NA 4L74A 5HS4A 2VSXA 1M1YA 1L7NA 1X70A 4GZLA 3PXCX 1GPUA 1FRFS 5C8DA 2YVKA 4KRYA 2ZDHA 4NAUA 3V1YA 3CJQA 3TSCA 5A9RA 2VRCA 2FHSA 4LOLA 3OEWA 1K3UB 4QYWA 4XWWA 3VH2A 1DDIA 2B2CA 3GN1A 2NVWA 1VL6A 4KWTA 5BV2P 1JXOA 3ACBA 2Y8EA 2ONZA 1R5BA 3FYUA 3B3GA 4EPXA 2J3IA 1ZW1A 4JEUA 4XWKA 2IYQA 2TS1A 2ZREA 1JHDA 5IC5A 3NPMA 4D56A 3DGFC 1WQ4A 2JFZA 3U80A 2I29A 2FPGB 3Q2OA 1QE5A 5D00A 1UK8A 1C8KA 3KQLA 1IMQA 4PH1A 1JI3A 5AHOA 5DTEA 2ZFUA 1SOMA 3CPWO 1R4NB 5C1IA 1EM6A 3OICA 4YRQA 1OC2A 1PZGA 2AFHA 1CR0A 1KU0A 4R6XA 3ZE6A 3ZHTA 2WC1A 1S2MA 4OO3A 3C0KA 5EESA 2XUPA 3ZK9A 4COCA 5D7BA 3BB4A 1H0KA 2B7BA 1N6IA 4YUZA 3FI0A 3OZGA 4FGZA 4YALA 3NTUA 1V3VA 3NJ8A 3RR2A 5LLDA 2VAPA 3D6TB 4RESA 1M0EA 2ZZKA 1W73A 3O84A 4U1RA 4CM1A 1PR2A 3AVXA 3KB8A 2PUTA 3NEAA 5ERXA 5HK9A 1N6KA 3DO6A 4LYAA 1VP3A 4PZPA 3GEIA 3FFXA 2ZUVA 5CCDA 4C5CA 2IHVA 3JRWA 4LQDA 3RADC 3U39A 2W6NA 8AT1A 2VNIA 1EH5A 3W2EA 1YK0A 2F43A 3K5HA 3L4BC 4IVRA 4DNXA 5SY4A 1RKVA 2FUG6 1VDZA 1VKNA 1YITP 1W8IA 2YJGA 4L7VA 4AJHA 5LOVF 2HW8A 3ABQB 3AERA 3D9QX 3GX1A 1AURA 1XLWA 5JDCC 2JVKA 2R96A 1P9OA 2WPDA 4MRNA 4BNZA 5ITZA 1N2CE 1F80D 1QHFA 2GTHA 3P2YA 3PQ7A 1QG6A 3LNTA 5HRUA 2OFFA 4C43A 3KELA 1UMCB 1A95A 2ZTMA 3C3EA 4JAVC 4Q4JA 5FFMA 1KQ3A 3PHBE 3CE7A 4C87A 5KTPA 4UBKA 1FS4A 1X92A 1IAVA 2ADOA 2ZAMA 3CISA 4WESA 2IXAA 3GVPA 1YUNA 4B43A 1X9IA 2CJFA 2QBYB 2PEQA 3H2SA 1PL0A 1VJ0A 3TW6A 2A1UA 6YASA 3LTNC 2Q29A 3C48A 3GLHE 1M83A 1LUAA 5L9AA 3F3SA 3CRZA 4CEJA 2VA9A 3HNOA 4F38A 5L4SA 2WMNB 1EK1A 4HXGA 1HDGO 1ZN9A 4P58A 4OX9B 3E70C 1P7YA 1TO2E 4NZYA 2QVYX 3GT4A 3THOA 1HT3A 3WIDA 3M5CA 5M29A 4OSEA 1TU4A 5JSQA 3QKSB 1QG4A 1RQXA 2FA9A 4BLWA 3L2OB 2DKNA 2DUUA 3DZDA 4YJKA 3ZNPA 4LRSB 4WOCA 1NXXA 3FZGA 3B3AA 4B40A 1PJCA 1Q3KA 3GYGA 3FETA 4L4UA 4ER3A 2UYCA 3WA7A 1JQEA 2BM1A 3F5MA 2R8EA 1DBRA 1S6YA 1XEAA 1Y7LA 2OG2A 1SC1A 2WTNA 2FR1A 4G6ZA 2YWHA 4EVSA 4MO9A 3PA8A 1KL7A 1YHYA 1M34B 2WYHA 3D5QA 3R3ZA 4WKOA 1EAMA 1XEWX 3G8AA 3O31A 4Y2TA 5KVQA 3IP5A 5GP1A 3WNZA 3I58A 3GWZA 4J0GA 4EATA 2ASEA 2AOTB 4PYQA 1PLJA 1R8JA 4B4OA 1OT3A 2NTEA 3HJRA 3R4VA 4TYWA 1BCRB 1AZSC 2Z4TA 3UC9A 3F6EX 2GARA 5EY5B 1YR9A 1DHRA 1KIAA 2VNAA 3MRSA 1L6RA 3RVQA 2AW5A 3GP5A 1SMKA 2BCJQ 4E0BA 3FN4A 3BHNA 1VBMA 2CDNA 1YJWP 4M7PA 2OCXA 1IJBA 1TK2A 3FVWA 3CM0A 4GYKA 2DOKA 4GOND 4WA7A 3H19A 3D6UA 5ECYA 3MS7A 2H6EA 3WLEA 1IK4A 1W1WA 3DMNA 2O9JA 3HWWA 4Q3CA 1VBNA 1W35A 5I47A 5IVPA 2CVHA 1QHXA 2B8WA 4KSCA 5TJ9A 5CEEA 2Q4RA 1RZRD 4OXKA 3KEQA 4X45A 4IYJA 1P29A 3E3LA 3HSSA 2JIQA 2PH3A 3HYTA 4PQFA 3QF7A 1NVUQ 4DNPA 1XTVA 1TVCA 4UTXA 1NRXA 4J3FA 4RTRA 3C43A 4E1AA 2ZUSA 2VPQA 4HD8A 2YN2A 4L4ZA 2GYYA 4G25A 3EF3A 4JLKA 5CLGA 3VNRA 1Z0DA 3NIDB 3AFMA 4NCBA 2A0WA 3ZHOA 2EZ4A 2I4MA 4KWHA 1JEYA 1CW2B 3GGOA 4BRUA 5JSKA 4HN4B 1A5TA 2N47A 3EVFA 5CX1B 2OB2A 4EHKA 1KEWA 1X2BA 1ZEMA 4TTTS 5CK4A 2GS9A 5ALZA 1K3FA 2NTVA 1YDHA 2QM7A 4BFLA 1K86A 5DN6A 1YGPA 2MTBA 2GKSA 3GVXA 1P9LA 1TTQB 3DS2A 3PDIA 4KR6A 4QQNA 2CBXA 2H1SA 3H2BA 4XXHA 3RVPA 4AF8A 4Q4AB 2E2WA 1E9DA 1UEXC 3QXHA 1XT6A 5D87A 3PS9A 3EPLA 1GYPA 3PC3A 4JI2B 1ODCA 3F5QA 1WUKS 1E1NA 3BFXA 3GKLC 1CDEA 1AIPA 2YFYA 4B3BA 1YRHA 4ALNA 4YQFA 5ITWA 3TR6A 2RGEA 1K66A 4BZQA 3QVTA 3G9ZA 1G16A 4HNAB 2AT1A 1IPFA 2O3JA 1DEKA 1ZCBA 2JAUA 2JCSA 2VBFA 3B1XA 2VK4A 3H2IA 3R75A 4KPYA 1QF6A 4QPDA 1F6WA 4FINA 4OK5A 4G84A 3LC0A 4X60A 2AZ4A 2BDTA 3ZGZA 2Y27A 1UH5A 3DE7X 3Q8XB 2ZS7A 4DM4A 5HIMA 5ALQA 2EG9A 4V39A 5TEWA 2HNAA 3G5UA 2H17A 5B7GA 1U8CB 1OLUB 4ESOA 4LHEA 3M6AA 4OFXA 4AB1A 1ECLA 5EP1A 4XOUA 4M54A 4UBLA 1ML4A 1RABA 4Z7NB 3HDQA 5DYGA 3SQLA 3P4YA 4JI0B 3GW8A 8ADHA 4FFSA 4YHHB 4WH0A 3IUMA 4ALMA 3KTAA 4Z9FA 2Y1OA 3PD1A 2CHQA 2XXBA 3UOGA 4BWYA 3B7PA 4DUZB 3M6WA 1Z6ZA 4UQPA 3CSUA 1UM9B 5EN4A 1DC8A 2O5EA 3DV0B 5LQKA 4L95C 2IXGA 1AV6A 2ZJ0A 1PFVA 1QE3A 4UPVA 2A8YA 2B4RO 4U6SA 1AHHA 1BZYA 4F06A 3VDQA 2VHYA 2YL2A 4BPRA 2JFPA 2IYNA 3TRKA 3O3MB 3KYIB 1QK5A 1W46A 2OLEA 3TZHA 4YRKA 4TQAA 1D2NA 3V4OA 4Q15A 3PC6A 4KQGA 3VU9A 4KH1A 3ZZUA 1DXYA 4JYMA 3SIXA 4WVFA 1FUYB 2WTEA 2OZVA 3HO8A 3LUCA 4RNCA 1ZDMA 4AL4A 1X8LA 3UAXA 1NIPA 1GNSA 5LQNA 4BMZA 1QTQA 4QT0A 5A7HA 2CL7X 1XQXA 2GQ0A 2EIXA 2JFYA 3JQAB 2WSIA 3VRLC 3VAZA 5AI8A 2NZUG 3PGJA 1VGQA 2H5EA 2IOHA 2QTWB 2W6CX 3GCXA 5AKJA 3AR7A 2MYUA 2ONCA 2YXEA 4KMSA 4ZEVA 4A1FA 3S8EA 3GLIB 7GPBA 1NTRA 3ZTTA 5FNVB 3PFIA 2PLRA 1TLFA 2ZATA 3WIVA 4WXRA 5A02A 4P3NA 1Z22A 2XGOA 4EG0A 3ANMA 4GLOA 3CV3A 1A77A 2C5LA 4H08A 1ENYA 2RI6A 2D4AA 1CF2O 1CUCA 3IPRA 3LUHA 3RQIA 3VC2A 1SO8A 4LI0A 1QG2A 3BAFA 3AR6A 3ILVA 4ML3A 4BE4A 4DDHA 3TXXA 3M2TA 1TFRA 3LCCA 5LYJA 5KC9A 2BGKA 2A9OA 3PHLA 2AKAB 5DB4A 5C1BA 2D7JA 4QARA 5FFFA 5KYKA 3QVGB 3PVCA 1G5IA 1EIZA 1VSUA 5DEIA 2KWLA 3IBGA 5ALLA 2HHLA 1X8XA 3MTGA 2OYCA 4CL0A 4MUAA 3NY7B 1IY1A 4RL6A 2ZZMA 1J07A 6Q21A 1SUBA 3AKDA 4MYUA 1Z63A 2ZSEA 4I4TF 5CT6A 1PYOA 1POXA 3BH7A 4GPEA 4JR2A 3V42A 5A2GA 4OCZA 4EY3A 2C4MA 3JAWB 3DAFA 1OBOA 1L1EA 1H0SA 2SKEA 1Z6PA 3D8BA 1F2DA 3LT2A 3OUUA 2F6RA 3DDHA 3AF4A 2V8BA 1O6CA 4FU0A 3UT5A 3G68A 3PNSA 5KJFA 2QBYA 2QVGA 2JIDA 4YQZA 1OZHA 4YJGA 3N2KB 2NAPA 3LUAA 4H7HA 1L3BA 2ZU6A 3CBGA 2HYDA 5JS1A 1G60A 3QW4B 2IU3A 1OFGA 4R2HA 4UAGA 1WP4A 3I8SA 2ZUTA 3WYBA 4DA6A 3EC7A 3EXIB 3AL3A 2PS3A 1N8KA 3REGA 3RLFA 4HQLA 5LP6C 4RBNA 4Z7OB 5IYZB 2PKWA 5CRIA 2YQZA 1C8VB 1O95C 2Y76A 2YBEA 1V7PC 4ZEWA 1T5OA 2HPVA 1X7ZA 2BUOA 2PL1A 2VXBA 2JK0A 2OHFA 5AJXA 3SFTA 1IWPB 2ISCA 5K0TA 3U6BA 4R1MA 1IVSA 3KLNA 2QJTA 1RC0A 2H2AA 2ZEJA 1S2DA 3DBHA 3L8FA 3LZCA 4S2EA 4ETNA 1Q83A 4ZHQF 2DQKA 3IXQA 3NM6B 1W36D 1CDZA 3HKBA 5EQTA 3WGGA 4U7TB 1L7EA 5I4KA 2C2BA 1V35A 2Z04A 1S5PA 4ZAYA 3SEAA 3FMPB 5DNVA 3HSYA 4ZCSA 3LIPA 3DPSA 2Z46A 3LMKA 4CL8A 1L7QA 1E8DA 1FVFA 3DA8A 3SNHA 1ZISA 1XP5A 2W6PA 4UVDA 3KJEA 4BWFB 2VF4X 3QPUA 4JGBA 4MV8A 2ID8A 2FWPA 4GZ3A 2QRMA 4KYIB 4HC4A 5H80A 4A6EA 2HJVA 2J3QA 2Q3BA 4PZYA 4F2WA 1I7LA 4RTNA 2J3HA 1ELOA 2NV6A 2XBLA 3COWA 2GASA 3IAM1 3ILHA 1WEHA 1P0QA 1M6VB 3PUJA 2QG9A 3NAZA 3PNLA 2PT7A 4LS3A 5EJ2A 3ZIDA 5LM3A 2WAYA 1EX6A 2IF0A 3K6SA 4NCIA 4HDQB 4U5QA 4DDUA 1B23P 4EZBA 4EKYA 1IHYA 1U4SA 2VTEA 2PMWB 1MAUA 3X1XA 5HZMA 2MJLA 1Y7TA 5LU8A 5P21A 1KSHA 4TKUB 4ZQEA 5LYJB 4KLZA 4P22A 2LCQA 2P3LA 5A9SA 1ZOOA 4RIIA 2FVFA 3G9TA 2D74A 3OTHA 2INGX 3H97A 4IO1A 2O2CA 4U3JA 2OY0A 5JT1A 1UK7A 2QQGA 4LGYA 4YP9A 1JKXA 2QJWA 1H8ED 4O25A 1YHNA 2KOSA 1Q7BA 2PNFA 4X63A 1Y8RB 5IAGA 2Q5JA 3AR9A 1LWOA 1EWKA 2QUBA 1V6AA 1YGYA 1OWMA 2X1HA 4N7JA 4AG6A 1J0XO 1DNPA 4H4DA 4CFYA 3MOGA 3WS7A 3G02A 3G2QA 2DH5A 3AHGA 1OZ0A 1N0VC 1SKQA 1TEVA 2CXQA 2JGRA 3D4IA 3HE3A 5TVKA 1HY8A 1FUIA 2X0EA 2W6QA 3SEQA 4AN1A 1XCOA 1XRQA 5EJ7A 1QGZA 1SZJG 5LUBA 1ZVQA 4XI9A 3ZGVA 5LDDC 2YWFA 4BPBA 4LJRA 3OOWA 1SWVA 4R4JA 3L92A 3FMOB 5BN1A 5C8YF 2VN8A 5AOAA 2KBEA 5I5GA 4DMHA 1LBEA 3ELDA 3SBEA 4H2WC 1N2XA 5EJ6A 1RLIA 3CXRA 5K3EA 5HKOA 5JSZB 4KV9A 4JBGA 3VX4A 4WBNB 3KSAC 2BH2A 3D7KA 4NBRA 1UZMA 3ZDRA 4E5YA 2AR0A 3RB8A 4FB5A 5KQGA 1OXSC 1LNSA 5ILQA 2ZXFA 4AG5A 3A6HA 4CKYA 4RDXA 1TZBA 4B7UA 1JBQA 1P81A 3DNPA 1PQUA 1RVV1 2XOKA 3GFOA 4LCEA 5C80A 1JT9A 1BQ4A 4IR7A 3OIVA 2M8NA 2FJPA 3CZCA 2JW5A 5AVQA 5FRDA 3P0JA 3HK2A 2ODAA 3FAZA 4BPGA 1I9CA 3UA4A 1HDZA 4CR6A 4BNDA 2FQYA 2VA8A 2VFAA 3CZRA 3CGGA 2JARA 2WT8A 1QGDA 4X8MA 2R7AA 4N6GA 3I72A 4DQKA 3N8NA 2ETVA 1KH2A 1ZYUA 4UNIA 4OAPA 1LK7A 1QVRA 3K94A 4HB4A 3SNKA 1VFPA 3VSEA 1Z06A 1ZCAA 2VAWA 2PXHA 3HLKA 2FLKA 3IHKA 4LCJA 4LJKA 4MIKA 3QBJA 5AKEA 3ZHXA 1X7XB 1DLIA 3IDZA 1GN8A 4PC3A 3VX3A 1VSBA 3DNFA 3IVXA 3JARB 3AUUA 3LGSA 3MTEA 4G5GA 4E51A 4B82A 1PDWA 2GEJA 2CD7A 2XD4A 3KKEA 3CB4A 2Z9DA 3PQDA 4IGEA 4LDAA 4X1KB 1Y5RA 3M4XA 4ZAFA 2Q7OE 3TRFA 3M6UA 3HFGA 1FYDA 2OV6A 1Z26A 1XTKA 3IUNA 2X4LA 4QQ8A 3LRXA 4RSRA 1W2BO 1M2EA 4U7JA 1ADYA 5D2CA 5L7WA 2ETXA 1RRKA 2A0YA 4GLBA 1W8DA 2Q3HA 2VT2A 2ZYDA 5DHPA 2IV2X 5BNZA 1A2OA 1KO8A 1NX9A 1C50A 2VR1A 5AJUA 5DXJA 3G6KA 2QJRA 2KBFA 4X1OA 4CKEA 3L0OA 4DLYA 1PYGA 2QSZA 4AFNA 1XBTA 5CFLA 2K7ZA 4YRBA 4JXZA 3WLFA 5I6DA 3IAS6 4CMEC 2VO1A 1RPAA 1MIOB 4ENRA 1LEHA 2A9RA 3GLHA 1B73A 4RU1A 3ZU6A 4PQGA 3CC7P 5SYNA 2WW8A 3N86A 3VVLA 3KKNA 4CMJA 1C1HA 3LLSA 5HGOA 2GEVA 3Q11A 3ZE8A 3A1SA 1E3QA 2F3UA 3GVCA 4XVUA 5JSUA 3AEZA 821PA 4GKVA 1QRUA 4OY3A 1SCUB 2GF0A 2YQ4A 3LUJA 4OIFA 4EI2A 5B58C 2C7RA 1X74A 3SXPA 2AJBA 1QWOA 4WLNA 4AXBA 5THKA 2QAJA 2YJNA 2ZJ2A 3QE2A 4HGYA 2ERXA 4EG5A 5LLSA 1FXSA 4AKGA 3DH0A 1E59A 1G20A 7ADHA 1DCFA 4JELA 5B2ZA 5L7TA 5F9HA 4MVJD 1HNZB 4AUMA 4EB3A 2LCIA 1F5NA 4NC9A 1R15A 4EPVA 4WDRA 1OTHA 2HMYB 5A0VA 3MD0A 4XVCA 2Z30A 4B0OA 2G9RA 4BNIA 4D4GA 1EHIA 1QH9A 2G67A 3QGMA 2XNDD 5FR1A 2HRZA 1T35A 3TBHA 4EMUA 1DU4A 1ITZA 2X1LA 1BU8A 3JCZA 5AD1A 4E70A 2Y67A 3B6MA 2QT0A 3A2LA 5F12A 1GD1O 2EAUA 2V4MA 4TV8A 5TQVA 5IG2A 5K8JB 1EVLA 4C4YA 2WK1A 3LE8A 3LU1A 2D1TA 3CCCA 3PPIA 5ALSA 3LOQA 2QRKA 3PPVA 2F43B 1IN1A 5DZSA 1FSZA 3OOYA 3GJ5A 2JKYA 4LPKA 4RK5A 3ASVA 3BKWA 5B5SA 1Z6AA 3IDFA 2R7KA 2QYOA 4XQEA 1RQ7A 2FFQA 4AIRA 1AF4A 2H7YA 4NMMA 1RP1A 1E9VA 3HBMA 2UYHA 4CL3A 1Y33E 3O2QB 1BA3A 1Z15A 4V1CI 3LO5A 3LY8A 4B33A 1P1IA 1RYZA 3KUXA 5LZ2A 1P2UA 5CLFA 3SP1A 4DN6A 1V5WA 2DQSA 2JFHA 3R0ZA 1GAWA 3UG6A 4RVCA 5KWIA 3R40A 1ZK2A 1E3MA 2V6BA 3LQ4A 5G40A 3G0HA 4A27A 2HEGA 1QQ7A 4WACA 4CMEA 1FSPA 3GDHA 4PZZA 1Q2XA 2A9JA 2C77A 2GNPA 4NBSA 2A9KA 2XTMA 5C34B 1X1SA 2JI6A 1SUIA 4HNHA 3AHFA 5GMOA 1W25A 3UB3A 1VKHA 1VGRA 3CWZA 2A5DA 1VG1A 2NNLD 5DIFA 4DXAA 4KUGA 2DTXA 4DJDC 4P34A 5HIIA 1IQRA 1DRVA 4JR1A 2AKEA 3FCYA 4G5OA 2BT4A 1W30A 4OXYA 4IGAA 3NIFB 3BRSA 4E09A 3GBSA 1M1YB 1RMQA 4O4JF 3RRNA 1E9FA 3CCMP 1AGRA 2KG6A 2JNWA 4FZ5A 2R0QC 2D4HA 5G4KA 3A06A 3AESB 4MS3A 3OZCA 1U0GA 3CYFA 3L1UA 1DZ3A 4PYNA 3ZV3A 5BQ3A 2CUZA 3GLGA 1N77A 3R9XA 1FBNA 3JQRA 1GZ5A 4RY0A 4URWR 1XK7A 1RTKA 4L3OA 4AZSA 5JS8A 3KETA 1Q5PA 1K0FA 1DS6A 4NEQA 3DKIA 4PPFA 2FPWA 5ALVA 5ESRA 4IF4A 4A6DA 5MN4A 1OB5A 2A92A 5ALGA 1O95D 3UXYA 4D0RA 1UPBA 3EWNA 2O5RA 1WUIS 2Q27A 3MJRA 4OQXA 4RPJA 3HP1A 3IQZA 4PQEA 2HLDD 3KCQA 4R54A 5EKUA 1JI0A 2QSUA 3HDVA 3GLKA 1T91A 2WKPA 1GV1A 3TX2A 3ZWAA 1SR8A 3K4QA 3RU7A 1SVNA 1GNPA 1XQ9A 1QAMA 1RJGA 3QNWA 2HQ1A 3DVRX 3ZLJA 4NHEA 2HUPA 4R1SA 5FUYA 1GQFA 1V9SA 1WG8A 1MC8A 1DBIA 1IC6A 2FMHA 2IIQA 4BLSA 4ER5A 4EHIA 4ZDKA 4OJYA 3AL0C 3UAOA 3UH1A 2B78A 2JO0A 3KWLA 1L2TA 1V16A 2VHJA 2M6KA 5DM70 5ANRB 3SAJA 2IODA 4TN5A 3P0IA 5BS1A 3EIUA 5C0OE 1LVUA 1Q1NA 2IOYA 1JKJB 3E0QA 3B8EA 3CC4P 4RTSA 1L4FA 4J0CA 2QORA 3V4VB 2JA1A 1JH9A 2JZCA 1PF7E 3HY6A 2RK3A 5B3LA 3EEIA 5CVCA 2JGIA 3C14C 3RVJA 4KYUA 4YP6A 2KGCA 1BCSA 1N0HA 4AP6A 3W5VA 3KYDA 3IDAA 2R11A 4NSNA 3Q2IA 4HXYA 3R6WA 4J0IA 1I5EA 4I99A 2ZSDA 4R6WA 4IHJA 1PV4A 1A8QA 3D4OA 2WJWA 5GADl 2VLQA 5BUSA 4CM9A 1SXGA 4DBVO 3BCRA 2OQVA 3KZVA 1DDOA 3TJZA 5LVAA 4TT3D 5IBQA 5E4YA 2V03A 4OM8A 5BXQC 4EW2A 4UAVA 3WYFA 3E8SA 2GDZA 4Y9SA 3GAAA 2L17A 1WMEA 1ISSA 1CT9A 2ZRHA 3JTMA 1SAYA 4Y2RA 1Z17A 2CNOA 2VDKB 2OZLA 3SJZA 3SQNA 4LYDA 4BB9A 5JADA 1EE2A 1RXCA 1MD9A 3IP9A 4QYSA 4WLEA 1UFRA 4B6RA 1AS3A 3CW9A 3N2EA 4BZXA 1MO3A 5BN3B 2P8SA 1ODKA 3M89A 1Y6QA 4ND6A 3TIIA 1PFYA 4RZXA 3ASUA 3HDHA 2X14A 2FLWA 3FOWA 4JLDA 4TTPA 3VV2A 4MROA 5FAKA 4GYYA 2ES4A 2NO9A 4E4TA 3KVRA 3DUFA 2XSZA 4MCHA 1XRJA 2B8NA 3AEKA 1II8B 1E4EB 2FGJA 2GXAA 3P9YA 3TMAA 2ZM5A 3G1GA 1LH0A 4Y9DA 5HWSA 3G0CA 2B94A 3DQQA 1GCGA 4OQZA 5JW6A 3T12A 3RSHA 1K06A 1T10A 3OFVA 4FZJA 2Y9MB 1KZGB 2HU8A 421PA 4DG5A 1IY9A 2IEZA 5FA8A 1Z0KA 3HY3A 4HJXA 3UUFA 4EY5A 2PRIA 2DQ4A 2ODPA 5DGDA 2PUHA 1BSVA 1LBHA 5DHFA 4C4RA 3WRYC 3HEBA 4N6NA 4LXTA 2H9AA 2JGEA 1FVHA 1XMVA 3H9UA 3OTOB 3EPJA 1N5LA 3I9KA 1AA9A 2PUGA 5T7BA 3Q7IA 4PAWA 1NHWA 4RA9A 2PMBA 9LDBA 5KJCA 1GPMA 4KMMA 2JYLA 4RENA 1ZW6A 2BF4A 4JQCA 5KJ1A 1NASA 1UKVY 1RE1A 1DEAA 5IH3A 4F8YA 2PS1A 3W4JA 2D2IA 2CXOA 1CQWA 3KQTA 1VRVA 4WE3A 5IWCA 1Y63A 5F1KA 3DDZX 4M0IA 2G9ZA 4BGDA 4E03A 1LF0A 4OG2A 2NVUB 4IUBS 3E3MA 4G67A 1NFFA 3BAZA 4IM7A 4KO2S 1QYVA 2C07A 4RVHA 1E2IA 5EJMA 1EFTA 4D44A 2C5FA 3K32A 5EFOA 3BS4A 1HEYA 3NI2A 3P0EA 4EHJA 4IIJF 3N2ZB 4M87A 1QU2A 1FK8A 4KIJA 1ZOLA 4YT5A 4YV7A 1O2DA 3X1JA 1V5GA 4XFKA 2NP6A 1NW9B 3AFGA 3U5ZB 1TF2A 2GK3A 2ACVA 4DMFA 1ECJA 2PKQP 2D2FA 1G0NA 2NM0A 2V7TA 2PGAA 2C96A 1TADA 2ZRGA 1VIMA 3OPMA 2XB2A 1IIBA 3QFCA 1N2IA 3I2YX 4B4VA 3EVAA 4HDSA 2K0DX 1OH7A 2W6MA 5AFSA 2X0DA 4X93A 2O7RA 3VH1A 5K8TA 1ZNQO 2AKYA 3R3JA 5LL6P 1AU9A 1FFBA 2BE9A 1C4OA 1FTWA 1RWNA 2AR9A 4HB2A 4EABA 2RHMA 4CLOB 2J4CA 4M46A 1NLMA 3KOMA 5F64A 2B3TA 4PF1A 4WFQA 5JRDS 1HC7A 1W2GA 3OQBA 4G8DA 1OXXK 4YWJA 4BIMA 1W4AA 3MBOA 4ALLA 2FN3A 1ZL0A 2XMGA 2JL1A 1L7PA 5ISMA 4JQOA 2I3GA 3ZLVA 3I55P 3OY7A 2YHUA 5IPFA 2A5FA 5JJLA 1OYOA 2WTMA 3AJAA 1D1PA 3AR2A 1J8DA 2ECPA 3DVSX 4YJ2A 3PDHA 2GEBA 1AX9A 1GPAA 1UR5A 2XMZA 4LCBA 3MRXA 1Q6YA 3KOUA 4RSHA 4RMHA 2CLKB 3L06A 1TM3E 4CF4A 4LDRA 3PC4A 2XUOA 1GGMA 1RWQA 2ZP1A 3QKIA 4Q7EA 3U1TA 1V37A 2EBUA 5AIAA 4AS3A 2O4CA 2QUJA 2VZ8A 3L82B 2ZM6B 4KACA 2X4DA 4HQ0A 5B1IA 3UK7A 3PHHA 2DULA 5JCXA 1DXHA 5FWNA 1M2NA 2IS1A 1ZNXA 2J30A 1RM4A 1RXSA 1XXHA 2WYVA 3SE7A 1FYWA 2VOJA 4GRDA 1X3OA 1DWQA 4UHPB 4BCDA 3ESBA 3IE0A 5J2UA 3FNGA 3PWSA 4I5EA 2HDWA 4ZYVA 4O08A 4AS2A 4D9HA 3FFTA 4TS1A 4XDZA 2MSLA 3BCSA 3G13A 2Q6LA 3D3WB 4Q9KA 4EGSA 1OFIA 3H4EA 1NBIA 2V9CA 2LD4A 3MM4A 4JX8A 5EMJA 3OPVA 3VZPA 1U0RA 5LDGA 5LMCA 2YZ2A 3C5CA 5EIBD 5TNXA 2RGCA 1QIJA 4YH1A 2Q3FA 3FDJA 1Z5NA 5EMMA 1W19A 2CHGA 1M7GA 4ZPJA 3J80A 2GWHA 1HE8B 1WQ3A 2KG8A 2V7UA 3HABA 3UB2A 3L6RA 2F64A 3WBJA 2BMWA 5AM4A 1US8B 3B5JA 1MABB 2OTCA 4TYPA 1YKGA 3L8EA 5C7LO 4HR7A 2ST1A 3D0QA 4I1SA 2FY8A 1AA6A 4PRLA 2J5RA 1T15A 4ENVA 5CAEA 1ZX1A 3DXYA 1YQGA 4OF4A 2C4NA 4MRMA 1SU7A 2XTZA 3HBNA 2SHKA 4KQJA 4Y9UA 4RK7A 1WV0A 3UJNA 3F6CA 2C42A 1BMQA 3B48A 1FTNA 3HCFA 4OJNA 5AKHA 3WWPA 4YJ3B 4RWEA 4CM9D 1HQDA 2OUIA 4WUTA 3I9V6 3LCRA 5IZCC 3VR5A 2HBQA 4M60A 4IX1A 4DLVA 4JD5A 3DE2X 2H9IA 1E64A 1TTHA 3R1IA 4TWJA 3PUIA 5JAPA 2FMTA 2YRFA 2O59A 2FWAA 5F5XA 1PZEA 3CCEP 1Z9BA 1NT2A 1XVUA 3HKCA 1ZGGA 3NHFA 5BWLA 1R0XA 1E2MA 1U7HA 3FZNA 3M6MD 3QG1A 4BN4A 1NJ5A 2NADA 3ET4A 5KDDA 5KNBA 4YGXB 2HPZA 1R00A 3B1KA 4LPSA 1ZAKA 2WI8A 3F8SA 4I55F 2H4FA 3B9BA 2E1MA 5TQ0A 3HBLA 4KIUA 4QL3A 3W6OA 8ATCA 3QTTA 1WUHS 2IDZA 1G5FA 1YRQA 4I6JA 2E89A 2GPAA 1L3IA 3W6ZA 2WABA 1NYLA 4QXMA 4B8WA 1PT8A 3NM4A 4KC0A 5IU6A 2D5AA 3VO1A 4JI3B 2PSDA 5JQGB 4DCSA 3EVNA 2G9QA 4UATA 1F06A 4JBWA 4F71A 4LVNA 1YWGO 1NQ5A 1C0KA 4MRSA 4DLKA 3RKSA 1P6UA 2NN3C 5E38A 3VKFA 4ZN6A 2FCRA 4MWSA 4D8UA 5AVTA 2YV3A 2BC9A 3II6X 1TMGE 2E6UX 2ZK7A 2ZWPA 4BC1A 4MRAA 3WRVA 4IXDA 4QGAA 2WPNA 4O2BF 4E1BA 1VXRA 3GFFA 1L8LA 3LUDA 4OQNA 2W43A 3Q7EA 3VISA 4O1IA 4EX6A 1SXHA 1E79D 2ZYRA 3LKZA 3N8HA 1OSNA 2R5WA 4NE7A 5HFJA 4B3TB 1D2EA 4LDQA 1HLPA 3EA0A 3KTDA 1YVPA 4M3NA 1G18A 2C92A 4BAZA 2Y2VA 1I4DD 4KN6A 4LMPA 5ICSA 3VTFA 2G0TA 4B3DA 3R2JA 1IQ0A 3BIFA 4XX1A 5PGMA 3IO3A 4QNMA 2JRCA 3BRQA 4RV4A 1ZRMA 3WQQA 5BN5B 4FYIA 1Z7GA 3I2KA 5AQ1A 2ZITA 2AF4C 1YQTA 3R5FA 1GGNA 1C0IA 1T36A 1E8MA 4F7DA 1S9HA 5BVHB 3QXSA 3RAEC 1RR6A 1EHYA 2ZIUB 3T1HB 2H4ZA 1V1MA 1V11B 2JLBA 4D3SA 3U19A 1DUSA 4R0VA 1U8UA 1QOZA 4PYRA 5HM6A 3ZOKA 4UVGA 4BFWA 3CW2A 1C1DA 1GGJA 4L8WB 4XUDA 1U90A 3MFYA 1AUPA 3L8ZA 5B1SA 4M0PA 1EXNA 3TKYA 1A9ZA 5BSEA 5ITVA 4BNTA 5A71A 4CM4B 2LTAA 2KGDA 1D4OA 2X13A 4NZOA 5LMNB 2BGJA 3G8DA 3W2IA 1QGUA 4XCXA 3HM9A 1Q74A 3BD8A 2DB3A 2E4XA 2ZUEA 4O5AA 1QPZA 1SHKA 1ZC4A 3PD0A 2NPFA 4BGIA 2VJQA 1CV2A 1XZCA 1ZK1A 3PWTA 4WJKB 5BMVB 5JXWA 1OPRA 2WJ4A 1JR3A 1MO6A 4FFBA 3LXUX 1JJ7A 3GDOA 2BJHA 2V7GA 4W63A 3CSSA 5AR1A 4J4BA 1XTUA 1EE9A 2P6NA 4LHYA 3TQOA 3FFBA 2HT1A 3TSZA 1JQ5A 4QOFA 3PR2B 3MTDA 2IPOA 2WE8A 3WBHA 2FETA 4DBLE 2PUEA 1PZFA 3DVAB 2O8VA 4E4YA 4NX2A 2HBZA 2NTNA 2FPPA 2JD2A 2VG8A 4UUOA 3HFJA 3M9LA 2IU4A 1QKKA 3CPHA 3M82A 1P4HA 3IHLA 5CDSA 4M8NE 5CBKA 3LL4A 2VDLB 1NJ1A 2BHRA 2JFXA 4DCVA 1XPOA 1VPDA 2N3ZA 4HAWA 4YRZA 3GT7A 4HWRA 2PY8A 4Y9RA 2NP7A 2OVBA 5E1MA 4A8JC 1VYHA 4N0DA 4C6TA 5BOVA 3SC3A 3B1WA 3EXHA 5AM0A 1BMTA 1B43A 2PEMA 1JDZA 5JXIA 1SZDA 4DGQA 1D2GA 5JNSA 5B3JC 3H83A 4URYR 3OQOA 3E22A 4BUZA 3LX8A 4MDFA 1C9DB 1QLWA 1L4BA 4TV8B 2FVAA 1P17A 2WQZA 4RC9A 2YTZA 2PX2A 3CVOA 4TRNA 5BW6B 2P6MA 4B84A 4LF4B 5EJDA 1F3LA 1KI6A 4ZCLA 4BLRA 5KSYA 1GAQA 3KSZO 1WW3A 2QX9A 4BJ6A 3USZA 4JLVA 4KVGA 1XO1A 1DIOB 1CUVA 1H9AA 3HA3A 2VDQB 1YXMA 3L8YA 4IL5A 3V8VA 4BFZA 1IU9A 2NPOA 3KAKA 3LRPA 4MYHA 3HFSA 3WK5A 4DABA 1ZH8A 5JZOA 4YWHA 1XCJA 2ZR7A 4IJ5A 1JHXA 4OB6A 1XHFA 3FVVA 4FZRA 3ROPA 2VNJA 4AT1A 1RDFA 2EARA 721PA 4UPDA 2GO1A 2Q8QA 3OIWA 4LKOA 1GL9B 1RI2A 1EHCA 1SK8A 1VL5A 2DFPA 3S2GA 2YJ4A 3TCKA 4UUBA 1I8TA 1XZLA 4OOEA 2D59A 4MINA 1B6GA 2W8ZA 1T5HX 1JDVA 1TJ4A 3TD6A 4QVIA 3LO8A 1QORA 4K7JA 1Z5VA 5FF9A 2CBZA 3TOCA 3VZQA 1QIFA 1AJEA 5K1ZA 4MHOA 5IBCA 2QLMA 1PN3A 2VHQA 2PWBA 3H13A 2KB0A 1Q44A 1C7IA 1KR5A 4MCJA 4N01A 5BV0A 1JEYB 3BPSA 1CBUA 2UUBB 5LUAA 3PE4A 2Q2WA 1U1GA 4L8VA 3R9IA 1XCPA 2OTLP 4E5NA 1HSOA 1RLOA 2D1RA 3A14A 3AKEA 2JHPA 2YS6A 3GWGA 5ALPA 4B6QA 3PXDA 2WIGA 3KEGA 3RRMA 5DGXA 4XM0A 1PGNA 2VPZA 3WI7A 5GOZA 3GGCA 1EWRA 1L5WA 3PP8A 1U63A 1JVSA 2FDXA 3R5HA 4LC9A 1AC5A 4F85A 1P62B 5H8WA 1KIFA 5KX5B 1U0BB 2PUBA 2Z5LA 2J5KA 1H2WA 1MGPA 2Q45A 2DHDA 2NOAA 2E49A 2KGEA 1DO0A 2WJHA 4I4IA 2AN9A 3KTAB 3JQFA 4B3HA 4CQLA 1Y3CE 3NM5A 4ZO4A 5JMWA 2C4UA 1GAJA 3OSUA 1BDJA 4Q34A 1EGMB 2FEOA 2HJ9A 3KVYA 2WEKA 1E2DA 2QVCA 3FWNA 5DIZA 3RYCB 4AY2A 2L82A 1SCAA 2V5AA 4FIDA 1JFFB 1ABBA 1ANKA 3K9CA 4HQKA 4HZGA 3VTZA 4DQ0A 2W58A 3W5AA 1YJCA 1S9DA 3OCVA 3O9ZA 2BEWA 1RZRA 2FEKA 1MV8A 1LLFA 1UZLA 1T1RA 3NALA 3HMKA 3Q8WA 1ESMA 2QP4A 3JQAA 4PINA 4ODIA 4QGFA 4XQ9A 3TKAA 3INYA 3DJFA 2JIZA 4OFWA 3SI7A 4D5EA 2EJUA 4MW7A 4I7EA 2W2NA 1M2KA 2JJ2D 4RK4A 3VPFA 4YB8A 1PZHA 3V8MA 1IOLA 1PS8A 2D2EA 1LLDA 2YYAA 3AF6A 2HJWA 3CC2P 1P0IA 2ALJA 2Q62A 4ISCA 4K88A 2FQQA 1U7PA 2FPIA 3RTGA 4NEGA 3CRVA 2OLKA 3Q15C 4J0FA 4CU5A 3C5VA 1IB6A 3FDZA 2IDJA 3LQFA 4IQFA 1DL5A 3GA5A 3GK3A 4MYDA 3FPAA 4EMBA 4G4GA 2K0XA 4E33A 4H0NA 3L0YA 4EPTA 2HBRA 3F1KA 1Z75A 1E1QD 4GMDA 3KSMA 2QN9A 1UFVA 2CVZA 4ZI7F 3VJKA 5FOSA 4IOKA 1ADGA 3L1JA 4REMA 1Q1QA 4XSVA 4B79A 5KZMB 4CEHB 5EWMA 4IOLA 1ZI8A 1VCHA 1ZD8A 1NJ2A 3QELB 5LZ5A 3RDPA 3DOCA 4FWBA 5CB6A 1IMOA 2DE0X 5EJ4A 4EZEA 3EPPA 1MJGM 2R7MA 4DLAA 1S8FA 1XQVA 4BATA 1EIAA 2VXYA 1QVGO 3V8RA 3QVJA 3ICOA 2GK6A 2XB4A 3L0DA 4QE3A 4D0NA 3KQQA 3ZBUA 4EG3A 5BSWA 3H5LA 1LY1A 5FUMA 3W8FA 4DCPA 2P7IA 3QSGA 3LFHA 3WLOA 3ZJVA 2ACEA 4F2PA 4WA8A 1GCUA 3Q6NA 1Z0ZA 1VHNA 3BXOA 4LZLA 4ACBA 3LI2A 1ZJ6A 1D4ZA 4PLHA 1XA0A 2PSEA 5IJWA 1MFZA 2RHJA 5KKAA 1R3DA 4W1PA 2KWIA 2VSNA 4N03A 1QH0A 3F90A 3CEJA 4MIYA 5CXQA 5BS2A 2R2AA 2Y4NA 2WG2A 4X8LA 3FTFA 3LT5A 3U1VA 3FRHA 3IALA 3BD6A 3ECAA 3OHSX 3PNOA 3TK1A 4K8OA 1RXVA 1Q7CA 5FWXB 1TD9A 1APBA 1X1QA 3HVIA 4PCLA 4Y2YA 3TZKA 2GD6A 2ZQZA 4Z3OA 2WPDD 1HTBA 1WTAA 3RK0A 3O9MA 1LPSA 1MGOA 1B0AA 2PUFA 4MWZA 3DMFA 1LNQA 3VHRA 4EKNB 3DZIA 1ICIA 2Z8YM 3H3XA 4Q3BA 3GQBB 5KP8B 1KZ7B 2DT8A 3LZDA 4X90A 1P1BA 1PWXA 1R18A 2WFLA 3DFZA 3VA7A 3E9QA 5IDWA 1V2GA 1MG5A 1TKBA 1GGHA 2V7QA 4M6WB 3BGSA 5EZYF 3EDRA 2FF5A 4L5IA 3SYTA 3T7AA 2B83A 1HSZA 1LFDB 3GGGA 4LGVA 1HBJA 4MS3B 3WQSB 4CQNA 3W3AA 3N0TA 2IUTA 1U5BA 1QK4A 3A4YA 4O2RA 3NXKA 4ND4A 4YO8A 1URPA 4HBZA 4UASA 4OD0A 5DXFA 3N6VA 3GLGB 1I0ZA 3UPDA 4BY9E 3M5DA 4MV9A 3CKKA 1GG9A 3H86A 1R2QA 3O8BA 4PZ9A 2J6BA 1KK3A 4LJ5A 4OUDA 1IONA 4EG7A 2ZRIA 4IIYA 3ND7A 5AYVA 3TD9A 4C4AA 1G8KA 1U2PA 2DWCA 4G0PA 2HRCA 4OLAA 5F3DA 1SUCA 4PO3X 5HS6A 4OTZA 4KOAA 4JNCA 5IARA 3TEFA 1U3WA 4BJ3A 4BO9A 3IMKA 1Y3AA 3IHTA 2MSCB 4RGQA 4PQRA 5JCJA 2OCDA 2WZQA 5C37A 1YCHA 2HQSA 3QKTA 1IEXA 2ANBA 5IKEA 1XF1A 1E6UA 4N7RA 4TUYF 3GXBA 4QODA 2VJYA 4MVCA 4DSUA 2PE5A 2GAJA 3MTAA 3FD8A 3PX3A 1GO2A 2GBLC 4I08A 2O8DB 1VQ1A 3RRBA 3IE1A 1DXOA 2PKEA 3IEPA 1NF2A 3QEOA 2Y1WA 4WCFA 1T8YA 5G0VA 1XCMA 3OQ1A 1EVQA 2PSFA 2Q3LA 1YDEA 4L72A 2J3EA 2OBYA 3MTQA 4PSAA 5BSUA 3TI9A 2QTMA 3VDRA 2P27A 3GLFB 2B35A 3H8VA 4OIMA 2NZXA 4O3FA 2Z8YA 1K97A 4EFLA 1B14A 2VLBA 1XN4A 2G07A 1OFTA 5BMVF 4RKQA 2GJ8A 5CT8A 4L8LA 2O2SA 2B3DA 3C85A 5I9LA 3DEIA 3PICA 5HBGA 1YVRA 2WMOB 4AZ0B 2BKAA 4CU2A 1U0LA 2CNKA 2RD2A 1ZM7A 2XQFA 4PZCA 2W2LA 4UZSA 5GPBA 1TA4A 1E1RD 2GI4A 1Z4JA 3PI6A 4IJWA 5AVOA 4GOLD 3NTRA 1A76A 2V6GA 2P9EA 3RYFA 1FNNA 4ZTBA 1E92A 4PPYA 4ZYLA 4RD4A 1RVDA 2A59A 4OYHA 1OV4A 2F67A 1DFHA 4H59A 4NYJQ 5D8DA 3WWOA 1NMZA 2V8OA 2ZBRA 3WBFA 5EHNA 4Q12A 4TSRA 1W2HA 4MQMA 1JFLA 5KQSA 4RHYA 2JLVA 4RDCA 4JJ6A 1G4AE 1OWNA 4D3XA 2FPXA 1K68A 1KMMA 3NWOA 3P2EA 4D0GA 4IIDA 3I42A 1EAYA 3GI1A 1HORA 2NUBA 4MHSA 5TJHA 4BNJA 1FLDA 4DR2B 1V71A 2Q07A 4ME6A 4CF7A 2FMFA 3OI7A 1X7XA 4J9VA 3STXA 1KBZA 4GX1A 2IXEA 4WXEA 4IRUB 3V8PA 1YULA 2VP2A 4DXDA 1CJKC 2SNIE 3EH1A 3I2JA 1EDZA 1HKHA 1YJ8A 4OXRA 4E3WA 3DS3A 5TVGA 4EO9A 1WPXA 1TX4B 5JWOA 1DRUA 4GM4A 7ABPA 1EFHA 4CM8B 1P3JA 4FX2A 2XZPA 5KX5A 2V1UA 4PEVA 2OARA 1QRDA 2DFVA 3R3SA 2EFJA 4O4IA 3BGOS 2G83A 4RELA 5CXSA 3I9MA 3DL2A 2WVGA 1E6KA 5AO9A 1NOIA 1QLHA 1F2UB 2C2OA 4CNBA 1R8XA 1UP4A 2FN7A 4NP6A 1LRKA 1EJ6A 1ST3A 1U1EA 4C5AA 4NJMB 4TXJA 3D7LA 2WSSD 3K1AA 2GUGA 4DZZA 1VIDA 4QUDA 1RHJA 5DNCA 3TNJA 1RQLA 4LG1A 1EDDA 2C9YA 4FYKA 4JH0A 4MRPA 4M49A 4QFDA 4YECA 4QGSA 2UU9B 3VQTA 1VM6A 3HJUA 4FFWA 5AM1A 1GGFA 5A7FA 3OQVA 2VJCA 4GRIA 1GVNB 3DTNA 2IV7A 3P52A 2RH5A 1F3OA 2G40A 4D96A 3V1NA 4EG4A 2X5NA 3QBEA 2P1DA 3I6BA 1N34B 3ZJYA 4DB4A 5LP6F 2C95A 2AN4A 5KNDD 1PRYA 4YN3A 3NIWA 1MNQA 3GGJA 1XB2A 3DE0X 3WAKA 3QPAA 1C9MA 1H23A 3EHDA 3SVLA 1W7AA 4KRFA 1NBHA 3UK2A 5EZYA 3REOA 3WK8A 5LQAA 3VI4B 2ZRCA 4F92B 3AHHA 1XJCA 3BWDD 2QGNA 5JAZA 5HZKA 2YOGA 1NV9A 3SGLA 4C7OA 3JTEA 4D25A 4DR5B 3OF5A 4NECA 4NQRA 3ZGOA 4Z54A 1P0FA 1JMVA 2BM8A 4KNVA 3VYTB 4Q1BA 1DDGA 1TJNA 2RGXA 3B89A 4HRXA 5BWNA 4O0LA 2Z3WA 4WNAA 4W4TA 4BLTA 2MT9A 2HHHB 1CHDA 3PXAA 4J0HA 5HZGA 4MI1A 2CMDA 2AYXA 2OGZA 1J7JA 1MHPA 2JBHA 3AOGA 2XH8A 3O8DA 4Q18A 1YDWA 3BUSA 5EKTA 1SPBS 1KD1Q 1JP7A 1NVAA 5H59A 1VL1A 4BFVA 4EO4A 1OAAA 4NZ9A 1KVSA 5KJEA 3VHLB 3WLHA 4RKRA 3A6ZA 3C6ZA 2JASA 3W78A 1PNRA 4YRFA 3ZU2A 2R1TB 1VQ7P 4M0FA 4URFA 1T9GS 1JXAA 2X8BA 3C5HA 4K28A 1U1CA 1X87A 3RV4A 2VDRB 2QYTA 3PNPA 4F1JA 3TZEA 3JWGA 2I22A 3LXRA 2H07A 2X40A 2W83A 4G26A 3B2NA 2QZ4A 1YQ9A 1M1XB 4WINA 3WGYA 5HYVA 4O3MA 2BEUA 3RRYA 3T5BA 1Z8NA 4IS2A 3RJZA 1V8BA 4X7PA 1HE4A 4RMJA 4LRUA 4UMDA 4KCGA 5FUBA 5H7XA 3SK0A 3TZCA 3SZGA 3QJYA 4KHPB 1FXUA 2NQTA 1U7ZA 5I9TA 2FEMA 5REQA 2MMCA 3GY0A 1HY3A 4Y2VA 2AFHE 2FVEA 1NURA 1BN6A 1V8OA 2AMFA 2BTOA 2GLTA 2GYKA 2CXNA 2X7JA 2ZBPA 3I09A 2OXIA 2R65A 3VKUA 1HNWB 1IXRC 3JQFC 3RHTA 3TZBA 5J2TB 3V3TA 5KQPA 4F4FA 4PHGA 2FE1A 2N5HA 4QU9A 2G9VA 3JQ8A 2B5WA 3Q85A 4UHEA 3X44A 5FUQA 1MT3A 3DF9A 5DF1A 2CGQA 4YHBA 5J2UB 3BULA 2XD9A 1R6UA 1SQFA 3O38A 4TVOA 4UUNA 2XMCA 3ZXYA 1XQYA 4ZT4A 3WC4A 4MAMA 3QUBA 5KPDA 1I01A 5JMOA 4V0MA 3OCCA 5FBVB 1WOYA 3ECSA 4ERXA 4PXHB 5HUQA 1WVMA 4D8XA 5IASA 2MVVA 2I6FA 4CV2A 1SHJA 1OLOA 2ZS8A 2W2LD 3RS5A 4PNHA 4QIHA 4DCNA 2VI5A 3OX4A 4Y0VA 5AK0A 4JL5A 1P72A 2FG6C 3A1VA 1Y4SA 4P9NA 2BEVA 2RJOA 1QDUA 2RGDA 1M0SA 1QHGA 3CC8A 3GARA 2C1ZA 1LBTA 2JI4A 3PJFA 4GPD1 1NGSA 4QYIA 1NI5A 5KDLA 4BB5A 5KHLB 1A2KC 3I92A 2O06A 1Q77A 1UT5A 5CITA 5C5EA 1YKSA 5BVGB 3A70A 1DXQA 1FDWA 4KOEC 3U9TA 1G6Q1 1N7JA 1QQBA 3O8OA 2BEJA 1DQRA 3JAKB 5EIBC 2EX0A 3RWBA 1XA3A 2KMLA 3HYLA 4R2JA 1ZOPA 2BPOA 2G76A 5G1PA 3NWBA 5AUPB 5HDBB 3N2NA 1ZJ4A 3CEMA 5CNJA 5HF8A 2HDNB 1FJGB 1ECFA 3IFSA 3OFJA 4GYJA 4LVOA 4L02A 4GR5A 1CUBA 1AKYA 2LNDA 2GN0A 4CPDA 2P91A 5LXTF 1Z07A 4RHTA 1JF8A 2KE5A 1JHRA 3DL4A 2GJKA 4G4SO 4C4SA 1HLGA 3WLTA 5ICGA 3PUKA 3G0BA 4RD1A 2IJGX 2D2VA 2O0JA 3L77A 3KB6A 1BO6A 1SVLA 1EQAA 1LSSA 2JYGA 1JBKA 4GNKA 1MC5A 1G2QA 3DWIA 4CA3A 3N2GB 3W8DA 2VQFB 2JF0A 3AU9A 2HA6A 2WVAA 4I1IA 1XRSB 4A9AA 2WWHA 2Y66A 5TR9A 4L76A 4Z49A 4AO6A 1FSSA 1YZNA 3IGFA 3JALB 4YMTA 5IHXA 3GUUA 4DCJA 1H6BA 1NR5A 1EX1A 3X2EA 2PH7A 1DKRA 2F4NA 3VKWA 5AW2A 2C7OA 5KTTA 1VC2A 4NPHA 1XEXA 4GF5A 3IKJA 1USGA 1WZNA 2Q2OA 1RT9A 2VXCA 3DZFA 1OH6A 1J21A 5JYCA 4KP7A 5CCBA 3Q3JB 3KPUA 3CMCO 4L8YA 3SBXA 5JZVA 4FYJA 1CUHA 1NUSA 2RGBA 4QREA 4RCVA 1L5GB 2ZLBA 3SF8A 1UPTA 1EVYA 3SMQA 1G7RA 3QWBA 5DM60 1SHTX 4LVCA 4NABA 1RIFA 2Q0QA 4JY7A 1OH8A 3JAWA 3CUUA 1VLZA 4IGKA 1KP9A 1VB5A 3QMPA 4PO1A 4ZT7A 4LJSA 1PL8A 1W9MA 2BY4A 2P1ZA 4YX9A 5B4TA 3FOAA 1KO1A 3U4HA 5HTOA 4TUYB 3JQ8B 2IBMA 3M4YA 4BFYA 4TS4A 5BQFA 4D2IA 4FMCF 3QLUA 4PVCA 3KJHA 1VI5A 4DY6A 2VPXA 1PO7A 1W5SA 2HNBA 1RHMA 4LZJA 4NV3A 4RIEA 4AYTA 4DRXB 1GTRA 4NCKA 2B92A 1PU2A 1NVTA 4PWYA 4R9RA 2BVNA 3AIIA 2OT3B 5FDFA 3QVMA 1CDOA 1CIJA 4C3ZA 4EA6A 1TNDA 1X8JA 5HF6A 3FWKA 3UAWA 1OXMA 2EBHX 3TR5A 5AH0A 3CCVP 3Q3GE 3W4IA 4M89A 4ND3A 1KA9H 3U4QB 2PCLA 1TT5A 4EF5A 5J5CA 2WM9B 1OYYA 3BOSA 3CUSA 3EA4A 3L7NA 4DAOA 2RSLA 3MMSA 1EB9A 2GJAA 3QTLA 4UNQA 1KKUA 4CDGA 1RPZA 2Q3MA 3BDVA 4A26A 3ZVRA 1YR1A 4KWEA 3ZWCA 4N8SA 5C46F 4MUIA 2AF8A 3V1MA 3Q9LA 5LCXA 3IT2A 4C0BA 4O2AF 3OEED 4D9JA 5JXJA 4AN0A 3D6JA 5HUHA 3W5BA 2R85A 1ZHOA 1P8JA 1JW9B 2ZBEA 2JKZA 1IUPA 4BNGA 3ELYA 5A05A 3G71P 4MMZB 4KE8A 1DCTA 2HDOA 1CZLA 3CF6R 1L9KA 4MR8B 4OK6A 4UCXA 5FWAA 3UW3A 3COSA 3WTBA 3DLBA 1ZA1A 2ZYGA 1HF3A 1TGYA 2RDMA 2ZJBA 3MCVA 4F86A 3EUFA 1BHQ1 3OC0A 5ALMA 2YWCA 2I7XA 2FEXA 2FVXA 1DC6A 2X1VA 5JZMA 3GELA 5FKJA 4RDHA 1JRLA 2BFFA 1IULA 5FBZA 1QG0A 3LYLA 4B3JA 5DHUA 3HB1A 5TMEA 3W1VA 1Z0IA 4NTZA 2NQ8A 3DR3A 3OO1A 4A15A 4J16A 3O3NB 3MAAC 5ELXA 2YQ5A 3KDAA 1WWKA 1GFZA 1H8HD 5AI5A 4WCFC 5EJGA 2D13A 3V7YA 2H0RA 2NG1A 4OU4A 1WB4A 2CCGA 5BRAA 3IP3A 4M9QA 2HSJA 2Z3VA 1CS0A 1PJLA 4JOBA 1M2VA 1J0BA 3B2QA 3SQDA 2M98A 4ZEMA 3F7OA 4E4RA 3KKQA 2JLXA 3GBVA 2HLPA 5G1NA 3T5CA 1CQJA 4RPIA 4LRXA 4Q3OA 5EJAA 2XUQA 1L4UA 2E1RA 5FLKA 5IJ9A 3HVKA 3LK7A 2PGIA 4XQ0A 5G2OA 1QDLB 2YKGA 1Z6YA 3ZQUA 1G17A 1TOAA 2OV8A 2V4UA 5CVEA 5JNLA 4ZMRA 3GT0A 1UFOA 2IY7A 5KQLA 1YZLA 3PJDA 3BB1A 3FW1A 3A9VA 2ZCJA 3FUTA 2EKDA 1M1NB 3UFBA 3ZPXA 2IWHA 5BUQA 3OUZA 3BL6A 4NBWA 1NP7A 1H5UA 1F4PA 1CEYA 4OUKX 4AY4A 1EIWA 4O2BA 3BBPA 1YV9A 3LCJA 4M1QA 3S70A 2BFBB 3DDOA 2CD9A 1S2OA 2P4SA 4X24A 4KE9A 5FWYB 5EJ5A 1XTBA 5KYNA 4ED9A 5E1OA 2O7NA 4RVSA 5AMXA 2YDYA 5KYVA 2BGLA 4W8OA 4BQOA 2ZYUX 2XYQA 1C1XB 1TUEA 4EPWA 3BRWA 2FPGA 5HTKA 2ZVQX 2BJVA 3VOSA 1X1TA 2VQSA 3QQ5A 2HK6A 4B31A 1M1KQ 1II9A 4HN9A 1QIEA 5SY6A 3URMA 3IV6A 2CV1A 4RFVA 1LZLA 1ACMA 2DVMA 4HYTA 3FLAA 3I6YA 3PYMA 1NQTA 1U8TA 4M1OA 4ZRMA 1JLLB 2Y3IA 3AEXA 1OFUA 5JV5A 1VJTA 3OIDA 2R751 2HZ7A 3KCNA 2G04A 1CY6A 2XDAA 4JEIA 2JAWA 1II8A 4W8GA 3RVMA 4LY0A 3H0EA 4HAXA 4LF6B 2IYAA 3K8ZA 4IIFA 5TXGA 5KI6A 1JR6A 3CHYA 5I7RA 1JSZA 1NA5A 2G06A 3I73A 5DBFA 2XT0A 3OWXA 3OPQA 1KRHA 3PXXA 4NNOA 5JPDA 2HCFA 3Q5DA 1ZGHA 4KV7A 3DPHA 1D0IA 4FWIB 4OQDA 2GCOA 2FQXA 2IZZA 3BJRA 3R7FA 3L7YA 2D3WA 2EBWA 3BSFA 4MJXA 1NZJA 1N78A 4L4XA 4D5GA 2NUAB 3K35A 1WHSB 4DEXA 2R8RA 4ZQHA 3DV0A 1FEZA 2O19A 3W8NA 2PVCA 3RFCA 3T95A 4M1SA 5CH8A 1Z4KA 1ZY2A 2FKAA 1E1LA 3E53A 2HKIA 1ORTA 5L95A 5IS2A 3KBBA 3MILA 5EXXA 5EPOA 4JJZA 1R0WA 1SC3A 4KK4A 2ZT8A 1NI4B 2OD7A 5ERGB 1CZOA 2GO7A 1L5YA 1LSJA 4DA0A 4KQXA 3SIWA 3PSAA 3FR7A 4PGFA 1XAIA 3U17A 5IAOA 5IEJA 3EBPA 4KRGA 4MQBA 4G97A 4NYMQ 2EU8A 4BVHA 3W5HA 1WP9A 3GJ3A 3RJ5A 5KC8A 1BXKA 4E6EA 3KXIA 3NKVA 4FT2A 5DWDA 2CK3D 2OWEA 3HXOA 4R69A 5F2EA 2IITA 3M2PA 2JBWA 5KSWB 4GBGA 2PL3A 1YZUA 4M86A 2CQ8A 2XXAA 5AW5A 1AF8A 3EZGA 4GW3A 3CJRA 3DFFA 2J9ZB 4K86A 4TLBA 1OZFA 5IJXA 4DIKA 3FB1A 1EJ0A 1EKXA 1MO4A 3LBAA 3T9BA 4B35A 4GGPA 4PGAA 3T1YB 3NBKA 2PMFA 4RMGA 3ZDBA 2PNJA 5TF0A 3RGGA 3KYCA 5GONA 2NO6A 2HC9A 2IHKA 4FP9A 4TS9A 1CP2A 3GJSA 4RABA 4I1RA 3IERA 2FPKA 4P32A 2ZT7A 4TYQA 4E31A 2NYAA 4YS6A 2VQ3A 5CX1A 3I9JA 1MU0A 2XZTA 3RLIA 3SZRA 3KQNA 3AOEA 1PI3A 4C2UA 1HFJA 1VE3A 1E99A 4LX8A 1UXGA 1JH8A 4CRWB 1NSFA 2PO5A 5TT1A 2W2TA 4MPJA 4V03A 1Y3BE 1CUJA 4GFDA 1I6WA 3WOVA 5BN3A 1F7UA 1Z08A 2BFEA 4HDNA 4AJ1A 2DBZA 4WK4B 5FTWA 2H52A 4JK3A 4CHGA 3ZZNA 2Q2VA 1QCZA 3GV0A 1P3DA 3RABA 3MUFA 1SNYA 4DLRA 1M5TA 2K2QB 1KDVA 1XKQA 3OLQA 1Y1LA 1RU3A 2BSAA 1AKTA 3MB8A 3UPTA 3IVMA 1R4AA 4IIHA 4Z0HO 4CG3A