1ZMBA

Crystal structure of the putative acetylxylan esterase from clostridium acetobutylicum, northeast structural genomics target car6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Acetylxylan esterase related enzyme
publication title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb
source organism Clostridium acetobutylicum
total genus 94
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.110 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1zmbA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1zmbA01
3C1UA 4JJ4A 4JGGA 4M8KA 1FXWF 5CD9A 4K9SA 1ESEA 1DEXA 1VYHA 4PPYA 1V2GA 2WABA 2WAOA 4JHLA 1J00A 1VJGA 4TX1A 2W9XA 4NRDA 1ESCA 3U37A 2Q0QA 4K7JA 5BN1A 4RW0A 3PT5A 3SKVA 4RSHA 5HOEA 1FXWA 1BWPA 2WAAA 3DT6A 2APJA 4Q9AA 3DCIA 4K3UA 4XVHA 2O14A 4I8IA 4K40A 4JJ6A 4S1PA 5JD3A 3MILA 5A4AA 1DEOA 4HF7A 3DT9A 3P94A 2Q0SA 4IYJA 3SLRA 1JRLA 1BWRA 2HSJA 4LHSA 3BZWA 4DEVA 4HYQA 3DC7A 3KVNA 1U8UA 1BWQA 1ZMBA 4H08A 4OAOA 1ESDA 5B5SA 1IVNA 3RJTA 3HP4A 1K7CA 1WABA 1YZFA 1Z8HA 3DT8A 3W7VA 4OAPA 2VPTA 1PP4A 4JKOA 1ES9A 4Q7QA
chains in the Genus database with same CATH superfamily
3GP8A 2VLBA 4K26A 1S9DA 4JU9A 4XPIB 1JT2A 4UVIA 3C1AA 4QOFA 4CEIA 5IBRA 4BXOB 5FKJA 1BOOA 1QRDA 4GP7A 4V38A 4R3UC 2YJGA 2R65A 1ZL0A 3ENVA 2VYND 1EZ4A 1NKTA 4FYYA 5THQA 1QIFA 4EMBA 4GXRA 4DR7B 3SM9A 2WTAA 2BTOA 3OT5A 1GZ7A 1PL0A 5FPSA 1P6UA 3H99A 1NBEA 1XVAA 4Y8VA 1QU2A 1OI2A 2QPOA 4DARA 3TUJC 5DSXA 2AEJA 4PW0A 3KT0A 3UB3A 3BQ9A 1WKBA 4RD1A 4DA9A 3EOZA 5KOYA 5KHAA 1D7OA 1TLTA 2D4AA 4YIHA 3A3KA 4Q03A 2Z6AA 4O3FA 1CUEA 5E9JA 2B7LA 4QPCA 3VO2A 3HADA 4KN8A 3UENA 1IB6A 2JGKA 4XFKA 2VK4A 3KIPA 2VP4A 4ALLA 5K01A 4TYNA 1QBGA 2NSHA 2V45A 5EJ2A 2UVPA 3T3DA 2GHRA 4US1R 4F56A 5AW4A 4XYLA 1J39A 1NAHA 4R84A 3B51X 1Q5PA 1EUZA 2HUNA 3RBZA 4BJ3A 4BMSA 2PEOA 4KQ2A 2IT1A 5AHOA 2YVKA 2YIJA 1G9SA 2YMQA 1KSJA 4WLEA 1Z37A 3SSOA 1JLSA 4D9EA 5ITSA 4HB4A 3CC7P 2CC2A 2J30A 1CS4C 4BV9A 1A8OA 1RWVA 3BRWD 3AH8A 5F9HA 1ZJ5A 4KSYA 2Y1XA 3SC2A 4JC4A 4BQSA 2D6FA 4UU8A 4G1FA 2J9FA 2OY0A 3A05A 3MT8A 1WUYA 5HDBB 3V4VB 5AW9A 2PLRA 3ZDEA 4AQDA 1CR1A 3JQDA 4DA4A 1TZJA 3KQTA 2HMVA 2MU1A 2VDQB 3I9FA 4Y1FA 5HJ7A 4BBZA 2L22A 1I1OA 4XFXA 1Z0FA 4H0FA 3W2HA 4C5AA 2V5UA 2YYZA 2HLHA 3A1TA 3LVQE 1YA6A 1GUYA 3PHJA 1V8ZA 4RV4A 2XBUA 1IEWA 2G88A 1PT7A 3ZZ1A 2NUTB 3IQHX 1DJQA 1UK6A 3N2NA 3SEFA 4RVOA 2J3DA 2QORA 2XHZA 3NEAA 2ZSEA 1GWNA 2IS1A 1OLUA 5B3LA 3TXAA 4GI7A 2FAXA 3NTRA 4FMCB 1MVOA 1PW7A 1I3CA 2KOPA 4FMBB 2YH2A 3HNRA 4PQRA 4MUMA 3L8FA 5JD6A 3WMXA 3HGTA 1Q21A 4M1TA 5HUJA 4CTJA 4F6RB 2X2OA 3WGUA 3PWKA 4UHCA 3PD1A 1HY8A 3DLTA 3H75A 3JARA 3FRIA 4L3WA 4PWVB 2O59A 1Y9AA 2P40A 1XK6A 3EASA 4A26A 1CQIA 3EXAA 1E58A 1GCOA 2C7GA 1RP1A 2AF8A 3VSAA 4BO3A 3B1VA 1SC9A 1OYOA 4K8OA 4D9JA 3VR3D 1YZFA 5I8ZA 2C7BA 1HUQA 3KKLA 4PQGA 5KVQA 3IUQA 4O1IA 3RROA 1SD5A 5HRUA 3WKBA 2FVAA 1OWMA 4BBPA 3TR6A 3KKOA 1YITP 1CUIA 2ACEA 2EVWX 5DMHA 3CKLA 1O95A 4LXGA 4AO8A 3VMFA 1GGMA 4LYEA 3JS5A 2G5CA 1SVWA 1BX0A 4PG4A 1Y8CA 2HPZA 2WP8J 1FQKA 3IR6A 5E1DA 3ZE6A 4Q4AB 4E4RA 3RHZA 1IRIA 2XEDA 3CLUC 3MZ0A 1M2JA 4XIGS 1RXIA 4CMHA 4M2LA 4Q05A 4MWOA 1AKYA 2LNDA 3E15A 1Q17A 1M1YA 1SCNE 3O82A 1JLMA 1GR0A 3OESA 4WCFA 5TPZA 1P2TA 4DB2A 4QX6A 1ZGCA 4A15A 1ZAKA 2WJ4A 1CY8A 3PNYA 2RGAA 1MV8A 1BKSB 2I7VA 3HP1A 1WNTA 3GLIA 2GYWA 3AO0B 2VDWB 3SM3A 5KYXB 1U3TA 3NWOA 4MUEA 4PRLA 3ZLBA 3V3TA 1HNNA 2WUGA 1XDZA 1HG1A 4R1UA 5DRTA 1ZVJA 1JLHA 2Q6LA 1A5AB 3PKIA 5EKTA 4M9QA 1J0CA 2F2TA 3D0OA 4EX7A 2CXXA 1UCFA 2NZWA 4GH5A 4MCJA 1ZCZA 2EARA 2H7YA 4J4BA 1A27A 4QODA 1B93A 5EYPA 1RI4A 3W05A 3AIKA 1EVZA 3OBIA 1FUKA 1Q0LA 2WTNA 1FPMA 1EFPA 1X15A 3FCYA 3LZ6A 3ZDZB 3TLBA 1CZKA 9MHTA 1A76A 2KW5A 4YROA 2KWIA 5DNYB 1GKYA 1NBHA 2QUKA 3G89A 4IX1A 4OQMA 4PBTA 1YI1A 2B25A 1Y9DA 3PDUA 2DLDA 2JHFA 3AY7A 5DI3A 2AXPA 2WNSA 3MGEA 3I5AA 5UKDA 3AOGA 2FUCA 4MB2A 1SOVA 2I4TA 4HQOA 1MZ8A 2C9DA 3UHOA 1YQWA 4N03A 1F38A 2Z58A 3EVCA 1VIYA 2C3YA 4CGYA 4CLXA 4FJ0A 1YRBA 1P9LA 2RGGA 5IVPA 4NV3A 1PRYA 1V26A 1V9SA 3GRYA 3RJ5A 4H0CA 2GARA 3RPEA 4A0HA 3W5UA 3PVSA 4D4KA 4K2AA 2JCGA 2ZYSA 4CKYA 3PHLA 4FFWA 3KJQA 4H7DA 1JQDA 3BH6A 4O1MA 3L7NA 4UE6A 5AOAA 4F1WA 5JAPA 2ID7A 1ZUNB 3A7EA 3UCXA 4QGSA 2VNKA 1II8A 2P4HX 4PSKA 4QFMA 3GXBA 3S2GA 2WT9A 2BEWB 2ZIAA 4TWIA 4B8WA 4CV3A 4G4JA 5TGZA 4ZGGA 4HN9A 1EG7A 4N3AA 3N0WA 2C42A 3QRWA 4MROA 4PNHA 4U3JA 3BILA 4F4HA 3KQSA 2RE8A 3QUAA 4BNYA 3CPEA 5IBCA 3JYLA 4F92B 2AFHA 4H59A 1IXZA 3FLAA 5K3FB 4FZJA 4J4HA 1AV6A 4O8ZA 2WHXA 5HIIA 2Q3JA 3S2IA 3QIAA 1MVNA 2WJWA 1TYDE 3P7MA 4JP3A 3CX7A 3WLRA 5MGBA 1LF5A 1ECGA 2A9RA 1YQGA 3FTDA 5I9MA 3HP4A 4YMTA 1W49A 2VP3A 2HQ1A 2XTJA 4UAUA 1X13A 1ZIXA 2DQKA 4KJZA 5JALA 4ZQCB 1TQ2A 2IE0A 1QYXA 2JIQA 3NBAA 3RWMB 4PC6A 2Q4BA 1J8FA 3F5MA 4FFSA 4Y0NA 4Q3LA 5C37A 4MRAA 3U7GA 5HTOA 1GKLA 2DQ4A 3IT0A 4XUCA 1Z73A 3GEGA 2CHUA 5AJWA 3RVBA 1XA0A 1KP2A 4C89A 5TMPA 1LS1A 2BUBA 1TO2E 1NF3A 1SKYE 2BFFA 4JNKA 3ZY4A 3E3OA 4EUFA 3K5PA 2VP0A 2W0SA 2A2ZA 4R2MA 5IK2D 2VP5A 3PQCA 1FSZA 3T99A 4ZVUA 4FNGA 4P0PB 1PV1A 2GBLA 2YWGA 3LY8A 1D4OA 4L28A 5CUQA 3W8EA 3QUQA 2FZEA 4XPZA 2JKZA 2R8YA 5KYNA 1NDQA 3ZXXA 4EKYA 1YKGA 4BMNA 3M5DA 5JSUA 2JI6A 4YDRA 3BPSA 3O4IA 4TZ0A 1VLJA 3WKAA 1L7NA 2C2WA 4N8DA 2AH5A 3OLQA 4JU8A 1MO6A 2PEQA 1NFQA 1UK8A 1BFDA 2REQA 5BW6B 5KO2A 4FIZA 1A9TA 1L5WA 1Y6FA 4D3XA 3MCTA 4OHZA 4MWSA 4C0BA 4FIDA 4QYIB 1P81A 2P7HA 4CL8A 5CVTA 1HLFA 2EP5A 4MKXA 3PEEA 3COYA 4BVJA 5BW8A 5CFLA 1SKMA 4XB1A 5AM2A 1E61A 3R6GA 2A7XA 1UBCA 4JA2A 4A9AA 4HEA6 1YDMA 3AY3A 4ZAZA 3EFOA 4JJIA 3DAHA 3ISTA 1EDEA 4U5XA 2BELA 3OIWA 5F78A 3N3BC 3H6KA 5ARCA 3L04A 1SEVA 1U11A 3O6VA 3DDCA 4U5QA 2OVFA 2Q3MA 1W0JD 3NWBA 5FBZA 3V1NA 3LQFA 4HWRA 2CV1A 3G9UA 4WBXC 4NIMA 2IP4A 1YQTA 4TRNA 3I4CA 1JBQA 2DR2A 3CVVA 4NNOA 1KMMA 1L5ZA 4RTMA 3MJ4A 2PEMA 4W5RA 4S0XA 5KYWA 5CT4A 1KK1A 2FN4A 4R1PA 4EABA 1QVZA 3DTTA 1SCAA 3EWIA 4ZEOA 3R74A 5J5AA 4CKEA 2KHZA 3ZHUA 2R7AA 2QAIA 3H3XA 2LCQA 1WRBA 2G1KA 2GT1A 4LF7B 1KZHA 5IVHA 2W2PA 4JSYA 4IHJB 1E9AA 2ZRLA 1F4VA 3JYOA 4DCSA 2DFKB 1X38A 4HH4A 2NOAA 4BVKA 1ZK3A 4M0EA 2Z6QA 4OK5A 1SOAA 3DVQX 3DD1A 4WN3A 4YRZA 3ID6C 1XAHA 3A25A 3DZIA 3G8BA 3GRCA 1C41A 3JQRA 3NANA 4OK6A 2YYAA 3DWEX 3O5AA 1MO4A 1SUAA 3FCAA 3K8QA 2GKOA 3FRHA 1WQ4A 1HLDA 3NH9A 4YAJA 5CA0B 4UPEA 2YHIA 4PHFA 3K1AB 4QBFA 4P83A 2GX6A 4EY6A 3EFEA 4FX5A 2CVHA 2B8WA 1E66A 2ICAA 4LYJA 4A8TA 1LK0A 2CZQA 3HB9A 2VAPA 3Q9NA 3CVUA 3JQGA 2OE2A 3RT1A 5FO1A 1RO2A 2Q5QA 1N2SA 2J5BA 3D5EA 1KQNA 3TDNA 2O5EA 2PWAA 1LBEA 1POXA 3OX3A 5IC6A 1TJ4A 4CODB 1JH9A 5BSMA 2VQFB 4TLAA 2NP6A 2PGXA 3FF1A 1ZY2A 4U7DA 3FX2A 4K46A 4IJQA 1H2XA 3EQ8A 2WUVA 4JC5A 4QDKA 4CQMB 2OBMA 3ROQA 2DBRA 4IJVA 3ZXUB 4BXOA 1NXTA 3G2HA 4W5JA 4Y7DA 2Y27A 4J29A 4ZA2A 2XT0A 2K87A 1S2MA 2XRYA 4M1EA 4GEKA 3OOWA 1QDUA 1JG4A 2L6EA 4UNPA 2ZRAA 4RDIA 5HQTA 1XZGA 1N32B 1T4GA 1NVEA 5REQA 2WM9B 1OZFA 3EPLA 3LHDA 1Z15A 1JDUA 1IM2A 3MYRA 4F9FA 4KE8A 3V00A 1F2UB 3OF3A 1KY5A 4MR9A 4XSGA 3LFTA 5CXUA 1IXKA 1Q1BA 3LCRA 2FFJA 4FONA 3G9XA 1G19A 4G4SP 1I24A 3LBAA 3HDJA 1T25A 4HKTA 4KG7A 1DEHA 1TMKA 1UC8A 2SICE 3Q12A 1PEDA 4R2HA 3VM6A 2PUFA 4RVHA 2CXOA 1EGMB 1N1GA 3CLVA 5AXAA 1DG1G 3IIMA 3UBMA 2AG6A 2YCLA 3DZJA 4DC0A 4JZKA 4TV9F 2YWXA 3TKLA 1VQ1A 5JO9A 5JY1A 3A6PC 3UAXA 2Z09A 4DLSA 1BEEA 3HFSA 1KZ1A 3OSZA 4AF7A 1CF2O 1MO5A 3FVVA 3GVIA 2WU8A 1GD1O 2VWGA 4PO3X 2QSYA 3EN0A 4HDSB 1KBZA 4NRDA 5IAJA 1KOJA 1SHZA 5KI6A 4FBLA 3TQCA 1QAMA 1R5NA 3TQTA 3GJXC 4NESA 4TM7A 1Z75A 1OBHA 1YQUA 2AK2A 3W5SA 4HNGA 4TQ9A 5FI3A 5BOVA 2YWBA 2ZCUA 4CLOB 5HR5A 4RTQA 5L8VA 4TTRA 2PE5A 2FFQA 4UEWA 3PJGA 3OUUA 4PEVA 4BNKA 3X44A 1COWA 5L3RA 3H11B 2I2BA 3LCVB 5G1PA 2ZCVA 4V3BA 5ENVA 4DTIA 2WJYA 1LPBB 3P5SA 3OI7A 4CR7A 2WQ6A 1X7XB 3OEEA 4FS8A 5K0GA 2YIDA 5K0FA 2VPPA 4G1VA 3O90A 1AA9A 1P7PA 5F64A 5JG7A 2AW3A 3VSCA 2GAJA 4GOLD 4HWOA 5DWDA 5JXHA 3AY6A 3BXZA 3BMCA 1AF4A 3GUZA 3WQHA 5IDYA 3K4QA 3URKA 2NADA 1SVNA 3V8BA 3ZNPA 2DB3A 1WCIB 5JADA 5JWHA 1I2BA 2W83A 5K3OA 4OGFA 3T35A 1P31A 2YBEA 3B5IA 2OL4A 2QROA 2Q6VA 2XQJA 3NHPA 3WKDA 5LQUA 1J8QA 5THXA 2GEKA 4NG4A 2VSQA 1I0LA 2BEUA 1BDHA 4YP5A 3T9CA 3U4AA 1QXSA 2XZDA 2YJNA 3G9TA 1M5RA 2N75A 3NAZA 1EE9A 1FDWA 1U0FA 3HCEA 2V6FA 4FE7A 4RSGA 2AMLA 2WIKA 3BCUA 5DNAA 3X1XA 1NM5A 3ONEA 3OE5A 3Q9SA 5J59A 1TC1A 3OM9A 3Q3GE 4WK0B 3BE8A 3BDAA 1OPXA 4QQFA 3UAOA 2ODPA 2TMDA 3MWGA 1NRWA 1P9NA 3ZK8A 3CNQS 3OEHA 2ZYVX 5D6OA 2RKBA 3ZNOA 4EFLA 2H51A 5EMKA 3UEOA 1UJ5A 3M7IA 3UT5A 5BVGB 3MRVA 3MPUA 2C2GA 2ON6A 5LXTB 1WTAA 2V7UA 1D09A 3ANXA 3BTOA 1D2CA 1J99A 1PEKE 2PY6A 3QPDA 2HU7A 1I01A 1YCDA 1TK2A 3BD6A 2PVSA 4YH1A 1XD8A 1R8QA 4HT3B 4ROSA 1J6UA 4ZT6A 1PE0A 1BAPA 2CFCA 2AD5A 3NDJA 1KTIA 2WHEA 1DRVA 3VBEA 2A84A 4ZMRA 5KX5B 1A8UA 4I1YA 1GNQA 1N6PA 4AXBA 2Y4OA 5I8PA 3C6ZA 2J85A 3ZE9A 2ZJ1A 4O2AA 2XGSA 3C3BA 2HA6A 3KDAA 4MI9A 1NQVA 3MM4A 1NSYA 5K5EA 1S2GA 3DJFA 4BGVA 1FNCA 2DPYA 3U80A 1BW9B 3PHIA 2REBA 1GGHA 1HEYA 1ZD9A 2MTBA 1R5OA 3D0RA 1B2LA 4MGYR 4ZODA 1EMDA 4DUPA 1G8AA 3CE9A 5B37A 4DRZA 3LDAA 1UDXA 1N25A 4OXRA 2PUBA 5TQ0A 1EFHA 1JKFA 1H2YA 2C29D 4LN1A 2QRZA 1RHJA 2BJWA 2JCSA 2Q62A 4ZMSA 3ROPA 1P7ZA 5DMXA 2DECA 3U4DA 2P1RA 4AYTA 1OLXA 1K73Q 2PANA 1YZYA 4XQ9A 1E3SA 4HKGA 1GAQA 1N2EA 1O94C 3T7EA 5K99A 2EGUA 3TBKA 1IHUA 1UZNA 2Z1DA 3QUSA 1IYZA 2ECKA 4GM0A 2P3OA 2PKRA 3E3MA 2H3HA 3Q5EA 1WMSA 2I8CA 3AEQB 2BKVA 2JC3A 3OZ7A 2JZNA 4LGVA 5F7OA 4DZRA 1V3TA 5BSHA 1QGUA 2M1ZA 2VBGA 1UDBA 4RDCA 1TJYA 1R0SA 4H3KB 2OKCA 4W8HA 1DV1A 5DHTA 1CJUC 1Z7GA 3AR9A 4J1TA 2OQVA 1KR2A 1LV8A 4TXLA 5JS1A 3HA3A 4UHEA 1IPEA 1H2RS 1PZEA 3TXXA 1GEGA 1HSZA 1PFQA 2BF7A 2GA8A 2I2CA 2QUBA 3CZ4A 3IB3A 4HTFA 3HJUA 1XSEA 3FB1A 1EX1A 5HF9A 1IQUA 2BEWA 5FWXB 2A8YA 2I1WA 3IKMB 3UO8B 1G66A 1F20A 2YBDA 1YR7A 3AW8A 3BXFA 3RUDA 5AWFC 4QWWA 2BFEB 2PTGA 4LEIA 3QQ5A 1O9HA 3JRWA 3M6AA 3G1TA 3VGJA 2GGSA 4YRTA 5C31A 3ROTA 1IUPA 4BY9E 3CMAP 3CG4A 3IBYA 4JLMA 1X1SA 3HVUA 1G3IA 3P5BA 2LIVA 1XZBA 3P2YA 4MVJA 1FUEA 4Y2PA 5CT6A 3UJAA 4WIAA 2POQX 4KPEC 2BEVA 1DC3A 1GOTA 2VP2A 4LRSB 5EIFA 1JDVA 4DQXA 1I2ZA 5JSFA 2X3UA 2WJGA 4OBXA 4L4UA 3VRLC 4Z9YA 1DG3A 5JZSA 1E3MA 3HNPA 1DCMA 5JAOA 1D07A 2IA5A 3PX2A 1W85B 1ZRMA 3I01M 3B9RA 1MAWA 4GMGA 1SHUX 3EEQA 3F5DA 3I0ZA 2JZCA 3NWJA 1TKCA 1R37A 4HEJA 2FWJA 4ZV7A 2XX3A 4JWKA 4PRYA 3AT1A 3JQEA 1G42A 1DKOA 1KI6A 2YNMA 1NI5A 2PMWB 2Z2IA 3HJBA 3KZVA 3RK0A 1W2BO 3VMMA 4RJ2A 1D0VA 1VZ2A 4PZCA 4XRRA 1OB5A 2QUZA 2GSWA 4MARA 3UJNA 3TDKA 2CMDA 1QIIA 1EGAA 1SKYB 1Z82A 2JPDA 4RHUA 9ATCA 2B9EA 2E4XA 1ORRA 3UH1A 3S1SA 3AFOA 2C2ZA 1WBDA 3S4YA 1HDYA 3HKEB 2VNAA 3DBLA 2MSLA 2QD3A 3STYA 3JQ7B 5LZ4A 1CQJA 4WDQA 5WRFA 1EFVA 2B82A 4ZDJA 2IXFA 2YC2C 5JLAA 2IP2A 3PXCX 4K9LA 2C97A 3B3AA 1QZTA 3KUDA 1NXQA 4WW0A 1DXHA 2BKLA 4IR7A 1Y4DE 4KTTE 4MWZA 5EXEA 1YNSA 3RKSA 4U8HA 5K45A 4KB5A 3GR6A 2RJOA 1GNSA 1YS2X 3U9LA 1ZP6A 3V1LA 1XCJA 2XD9A 1Z34A 1V48A 4EI9A 1R5BA 3C16C 3RUHA 1W94A 5LBIA 3OJFA 1N36B 1MT3A 2PUAA 1Z4QA 1JV2B 2VHVA 4XCXA 3FE2A 3EJWA 2QT9A 1C8BA 4QXPA 2QN7A 1NVUQ 1RWQA 1E6KA 4N8EA 2VNJA 3ANSA 2P9QA 3GGSA 1PR6A 4DKXA 4B4UA 5EJMA 3KZKA 4LG1A 4W5QA 3G1UA 4PYMA 3SJUA 4EKGA 1LBHA 2AXQA 2W9XA 3KUCA 2DH6A 1IQRA 1US8B 3TUZC 1KP9A 2BFMA 3PXUA 3Q6MA 4DMRA 2P11A 2GK7A 2E3JA 5EWMB 1XXHB 3M82A 4MEAA 4QEZA 2YWEA 5JSZA 5DU2A 1UKEA 2WYVA 2YYYA 4KOEC 3LA6A 4BLTA 4XJTA 2SNIE 1IE3A 1A43A 2GCOA 1ZK2A 3NBZC 4IWXA 3RB8A 4DCNA 4CMEA 1VSBA 2JJMA 3D3WB 3DEHA 4K9MA 2H07A 5JCJA 2P79A 3OFSA 4LDJA 4B2YA 4DMHA 4U00A 1W4LA 2R47A 1UT6A 3QEAZ 2UUCB 1B3RA 1VLZA 2A94A 3LQQA 3U31A 4MUXA 3F6PA 3LSYA 1W9HA 2EKBA 4X8MA 5ADWA 4EBFA 5CA0A 1VE6A 1TPYA 3DEKA 5BUSA 5BXQC 1QHHB 2XXJA 3FHCB 5J40A 1OF1A 1V9CA 4IIBA 2O54A 4MQ6A 1NUSA 3DP7A 4H9GA 1FNMA 2YQZA 1K88A 3O84A 2QEXP 2P35A 3L8MA 1K5HA 1W59A 2AJBA 2J6BA 1E1CA 3DZDA 1KR5A 4OSEA 5FTJA 2PRYA 3AOEA 3WRXC 3D6MA 4AP6A 1MO2A 2NXJA 3CM0A 3DLBA 4TVOA 4KI7A 1RPAA 5EJ5A 2L19A 3G02A 1N7GA 3ILXA 4WOJA 1QPZA 3AF5A 1DTEA 3PDIB 3B1FA 1I2DA 2AOTB 2GK6A 3UTCA 2FMIA 2I7CA 2E87A 2FV8A 3WGQA 1JXQA 4HJXA 1C8VB 4IMIB 4KACA 3VNBA 1EBFA 1ZGJA 1XRMA 1TCBA 4XQ0A 1CEIA 2GBPA 4MDFA 2IBTA 4URFA 3AY0A 4GPAA 1RCTE 3HBLA 4CVNA 3Q10A 4RF2A 4N0EA 3LW8A 3O92A 1VKNA 3MMZA 4NDZA 5B64A 3AHEA 4X7PA 5JFOA 1AQYA 4LY6A 3SLKA 4C7MA 4JSRA 3KAPA 1VA4A 3ZGYA 1LBTA 1UXOA 3AM4A 2W0MA 1LBQA 3IAS1 1BS9A 4ZVNA 4MAMA 4F84A 2WJ6A 3FFWA 5B1EA 1VSUA 1FSFA 2BTQB 3A11A 2OXRA 2C4WA 3HWWA 4B31A 3IOEA 4KPGA 4KFRA 3QSYA 2ZJ5A 3QG5A 4DDKA 2ZTHA 1GQ2A 2QJFA 3MGGA 2QIPA 4FKMA 4D3YA 5KWSA 3TFOA 2R6JA 5BS2A 3NIGB 1SA0B 4F7DA 4BO6A 5IT0A 3TSCA 3TI9A 1QS0A 1JAZA 4IIXA 2Z8XA 4YCMA 1CXZA 3MTAA 3L7DA 4CGZA 3NEJA 4RZQA 5B4TA 5HF6A 4YR9A 1VHJA 1PSDA 5FBKA 2ST1A 2YOGA 5FWAA 1KU0A 2V6BA 4CUZA 1MFPA 2B61A 4LYYA 2YYSA 4JOBA 1EDBA 1VBFA 2W43A 2P2YA 4EFMA 3OWOA 1L5LA 4V1CB 1PYOA 4ZCRA 1YQQA 2PU5A 4TLEA 1M6NA 5DLDA 5IAAA 1O0CA 3K70B 2Z4TA 4LHEA 2J48A 1CUAA 2FPIB 2XITA 2ZAIA 4KLZA 3ZV5A 3U7QA 4KR6A 3Q1LA 4U0CA 2CVPA 4DCOA 4KIFA 2ABWA 1IN7A 4TL6A 3WL5A 4L8YA 1XNJA 4UPDA 1J4AA 1RZUA 5KQGA 4GUDA 4JX9A 3OE7D 2NO9A 1V37A 1KYTA 2H11A 2A1UA 4EEZA 3TG2A 2IW1A 3FYUB 1HMPA 1W93A 1IM5A 4N7JA 1M6YA 4EGAA 1HSOA 2FEPA 2JK0A 2RIRA 1NX6A 4UHPB 1ZJ6A 3G17A 2QTNA 1EE2A 4N5DA 3AONB 4AG6A 2QA4P 1Z3IX 4BVEA 3V1MA 4C4PA 4D99A 1P1RA 2PFGA 3MJEA 1CK4A 2UDPA 4RQBA 3SKVA 4B3JA 1B8OA 5ERGB 3EC2A 2XNCA 4QOHA 3R0QA 5FD8A 3UMYA 4UUMA 2MMGA 2WWHA 5H1YA 5D3KA 3EDQA 3JYNA 1OI7A 2R9VA 1C9EA 3ELYA 3RYHB 3WGJA 2QE6A 1OMOA 4B83A 2HMAA 2ZXFA 3DMYA 5D6NA 1JEYB 3HB5X 1V4BA 3ZYCA 1J0XO 1BE8A 2BDUA 2FSIA 2E5LB 1FMTA 1QWOA 4XVHA 5DX8A 1SQ6A 3JXEA 3V34A 3R7DA 1C0KA 1L4KA 2HMUA 4XQCA 3UK1A 1SIBE 2AKEA 2WJVA 1GAEO 3QA3E 2AUTA 4UUNA 4M0IA 2XOKD 5BNTA 5KWJA 5HIKA 3RIXA 3TH5A 1XPUA 2C2MA 1UR5A 4YT5A 2GZFA 1ZOLA 1VJTA 3NM4A 4IFBA 5FUBA 4X7RA 1CUBA 3BYZA 4A0RA 1BCRB 1B2RA 4M7WA 3SQWA 2FPPB 2AN9A 2DQSA 4KDFA 3WA6A 4W63A 1EHCA 1SBZA 3MEQA 5KTKA 1WNFA 5JZ9A 2WWYA 3GPCA 3SQXA 1E3TA 3VC1A 3TECE 2DEUA 5BVGA 1OW3B 2UUAB 4IDOA 4DUGD 2QGZA 1KXZA 2GBIA 3IKLA 5BPFA 2IEAA 5KOJA 1NZJA 3ORQA 1ECFA 3PVCA 3QE0A 2K0YA 3HUUA 4X9XA 4XGKA 3SQDA 4BNJA 3INNA 5CFZA 3OIUA 3ZWXA 2WBLC 3BSFA 1F9AA 1U98A 5ALLA 1BXGA 3GLKA 2DUNA 3Q7TA 3WRWA 3A26A 5A1JA 3QE3A 1KIFA 1PBNA 4TTAA 1VL6A 2LCIA 2X4IA 2W6NA 2YZ7A 1YAJA 3BXOA 4X5OA 3ZE7A 2JYLA 3SYNA 5IDWA 4KQ1A 5ALPA 1FFHA 5DYTA 4DQDA 4BQPA 4UDNA 4JLNA 4ZQHA 2E48A 3EULA 4ETNA 5AKEA 2VDLB 1A5BB 2B69A 1XVLA 4FGUA 3EX7C 1C0IA 4X1OA 2H1RA 3BH7A 4RIIA 3TMYA 2AR7A 4CT5A 4C20A 3SX4A 2OGUA 5C1PA 2NTEA 4K6FA 3DC2A 3IAXA 3HBFA 3UJHA 5CB0A 1AYIA 2H1SA 4OAPA 2QRVA 4HQRA 3RFCA 1CNFA 3IELA 4PO9A 1MAHA 3LLCA 5AKXA 3OZUA 3UN1A 1KEEB 5LP6B 1RHKA 4I99A 1SQSA 5CK4A 1Y4UA 3JW8A 3OECA 3GZLA 2R7KA 3DTVB 1WBJB 3LIPA 3CZRA 4ND1A 4ND5A 2HQSA 1HE4A 3DO6A 3SJAA 1EEHA 1SY7A 2EX0A 4IIYA 1ZW1A 3KOXA 1PR1A 1POWA 1TA4A 2W2XA 1EFUA 1C29B 2WILA 4BNNA 3QNWA 3NP9A 4DYHA 4XIJA 4F4IA 4E5DA 2GCGA 3ME5A 3IMKA 2HADA 3VO1A 5ED4A 3FMFA 3OIDA 5T4FA 2FQYA 4DIFA 1AOXA 3OHPA 5EE3A 3RIGA 3CTMA 1AKEA 3OX1A 3U7HB 2ETVA 3ZZ0A 4MGEA 4XA8A 4QQ8A 4ZOLA 3UWDA 1I4EB 3EF0A 1QFSA 3LPCA 4LPKA 4ENPA 1V5EA 3PHHA 3WNBA 4OSOA 5G02A 1XAIA 2AI3A 3KOUA 2HSGA 1LKZA 1T5LA 4BASA 1U81A 5M3BA 1G98A 1N6NA 4H4DA 3DBRA 1GVNB 1WDTA 4F3NA 5MDHA 1UC9A 5H9VA 2ZAMA 1KE2A 3K9GA 1Z17A 1Y5IA 4G07A 2XKKA 4K7JA 3GT4A 1MF7A 4L4XA 5I7HA 3IP3A 4HWSA 2WWRA 5CIQA 2G5TA 3FXAA 4ZKEA 3UAWA 4ID9A 2JBWA 4MP3A 2RG1A 4XQEA 1XOIA 2YFHA 3VTFA 5CB6A 4DVJA 4NYJQ 4QLAA 3K94A 1N8RQ 3AI7A 2Q46A 4LE1A 4HAVA 2G06A 1ENOA 3PQ4A 3SJZA 1KEWA 3B5JA 3IURA 4E4YA 1JMYA 1E18A 4Q1BA 3MMNA 4ZKDA 3N8NA 4D4GA 5CB4F 3V3KA 1KDVA 3BMNB 2XAUA 3B3GA 5DX0A 3LDGA 1UBTS 1VMKA 3OU7A 5HRAA 2OWEA 4MJLA 3S2YA 1F4LA 2NU7B 1H4VB 5C7OO 3AUTA 3SHQA 2XUFA 1G8PA 5JE8A 3F98A 5HFNA 1N3YA 5I9IA 3CX4A 1Y5LA 1T0PA 3A32A 2X40A 3N2KA 1W85A 4LZJA 3NR2A 4MUJA 2O8EA 3JVDA 4CKXA 1Y8QA 2VKQA 3WBKA 1Y34E 3K9NA 4IKPA 4ISCA 3LPNA 4OGGA 2G1JA 4Q93A 3FPHA 3SN6A 4HDCA 2HO5A 5EHQA 1GTVA 1DQNA 2ZYHA 4HNTA 1EUCB 1KEZA 2B4QA 1W19A 4R7TA 1DEAA 3E22B 2BH9A 2DWPA 3RSLA 3P9RA 1P1KA 4GKAA 4B2PA 3DVAB 4EMTA 2HRDA 1D9ZA 2X3YA 2AZXA 5AIAA 1L2TA 2RGYA 2FMUA 2IHJA 4P53A 2O7SA 3HKEA 3OPXA 1I14A 4QDOA 3ORRA 4BB5A 1P1CA 2FG7C 2A6PA 3ITDA 3Q2KA 4P3XA 4I81A 2GXAA 1UPFA 3W0LB 1VI2A 4YCLA 4E1BA 3I53A 1R6BX 1C3XA 4BMZA 4MR8B 2VLPA 3WJ7A 5C8DA 1B0AA 4HD8A 4E4TA 4DSUA 1PKXA 4CHGA 5KU1A 2O8FA 3ZDFA 4RPLA 4ZAWA 1ZCBA 1P1FA 3VISA 5EA2A 2EJWA 1RBMA 4FOLA 4TMFA 1CR6A 3FW1A 1QTRA 4AL4A 1S2OA 4R2XA 2A9JA 2ZQYA 4IOLA 4BFLA 4CG3A 5EOVA 3DTJA 1TJNA 1NQTA 4JXKA 1ZSNA 4OSPA 4KSCA 2XE6A 2O05A 3ZC3A 1NX9A 2BE7A 3GVHA 5DSTA 1J8YF 3IQXA 2XQGA 3TCKA 1CP2A 1CW2B 2P5YA 3VX3A 3ZCUA 4QPPA 3IR7A 2QY9A 1KFEB 5BQPA 4MQBA 2JAZA 3WMEA 1FVXA 4QZVA 4YAWA 2K92A 3E18A 2R4UA 3OOSA 1MX9A 2PIDA 1XTBA 3IJ5A 1TD1A 3PFNA 4H7EA 1TTQB 2FSVC 4HAIA 2FKNA 1J8MF 1XXHA 2Z0MA 5AXDA 1N5JA 2C2BA 2HKIA 2J4FA 2BBTA 3IVGA 3TPZA 5K6AC 3BE5A 1L4UA 3UPTA 2VP9A 4ATNA 3EIFA 2RH8A 4JUAA 3SVZA 621PA 3ITKA 3D3WA 2P6RA 2FZKA 1PLJA 1Z5VA 2PM8A 4A2CA 2RK6A 4CI9A 3AB7A 4EW6A 5ALUA 3PXGA 1GUBA 2OPBA 4OQFA 5HFAA 1E4OA 3VXKA 1XX6A 5DBGA 4F71A 2Q5OA 3KZOA 2E37A 1F80D 1YRAA 2R87A 2LL8A 2P5SA 4B3SB 4M9RA 4H60A 4NMXB 1G16A 3CE7A 1Z2PX 1ZGAA 2MSNA 2XTZA 4RU1A 3TRDA 3ZD9A 1QK5A 5L6LB 1PT8A 1P2VA 2H3EA 3NI2A 2J9RA 2WU4A 2F48A 1DCKA 2VNHA 4H6VA 4BLPA 1RADA 2I29A 2YZMA 3O74A 1WDWB 4CU2A 1GIAA 4I3GA 3ZTYA 1N1EA 4IS3A 1E5VA 1OC2A 1ZO8A 1GAWA 2H4XA 4YB8A 5EJIA 3J81A 1U8YA 3DMTA 2RHHA 3W9UA 1KFBB 2WW8A 3KKZA 3I76A 1V2HE 1C1HA 4BP3A 5JDIA 1AA6A 1JQEA 3B12A 3ZLJA 3RAJA 4ZHSA 5BSRA 3I45A 3IQDB 3FPBA 3O2JA 3H13A 1ZNWA 2AOTA 3P9SA 2D3TA 2DR0A 3QKRB 3JYHA 4P7FA 4C7JA 5AICA 2J3LA 2Q8NA 2OXCA 2CNRA 3KT6A 3F2VA 2ZVJA 1X0XA 5CH5A 2NZXA 4DUYB 1RI2A 3NIFB 1KJNA 1H1DA 3TMAA 3K0AA 3L7OA 3R3WA 3GJ3A 1VJCA 2IZ0A 3AF3A 3MMXA 2PCLA 2IL1A 1GTMA 2QXYA 3IPYA 4JOQA 1EK5A 4XWTA 3RS5A 1XRQA 5ALXA 4R6XA 4FFRA 2XZOA 4L02A 2W42A 4M55A 1P75A 4WH0A 4ZT5A 5IW8A 1WXQA 3JYPA 2Y6UA 4RTOA 3SLRA 3T3PB 3ICOA 2JFZA 1M2FA 2QW0X 3FBWA 3SS7X 1KARA 1RC0A 4TUYF 3F49S 1RQ2A 4J0CA 4KJXA 2O1WA 2HYDA 2OILA 4DNQA 3PXEA 5AJVB 2WVGA 3ZQJA 4Y18A 3K5IA 1ISIA 3H18A 1NURA 3RRFA 4BIMA 1QU3A 3FPAA 2C2XA 3K0BA 4JLPA 2VUHB 3QVMA 3CCRP 1JTEA 1SA0A 3NU1A 1CVIA 4FUQA 5EKDA 4G24A 3OJCA 3ZX5A 4LNUB 5FLKA 3VR6H 1CF9A 1LNSA 2VCHA 2VZEA 5IDQA 5EJGA 2ZM5A 2A9PA 2PVCA 1PUJA 2J0VA 2QRNA 1JEEA 5BR8B 3SFTA 4W5NA 3IVRA 3B82A 1NTOA 3G7UA 4WUVA 2FAEA 5DHQA 1YGYA 1Z12A 3OCWA 3OT4A 3P4UA 1RWOA 1Z74A 3UA3A 3ZU4A 2P2LA 1JNXX 3S2UA 2Y77A 4HEHA 2QMHA 4MUBA 5CCDA 1HPLA 1KY4A 2B2CA 2FQ0A 2FPIA 1YJBA 3C7DB 4NMLA 1A2BA 1F6WA 1DELA 1JHXA 1LV7A 3EMVA 2ANCA 4JS0A 2RD2A 2BY4A 5L7YA 4LUCA 2ZRHA 4Z7NB 1J2TA 2X1VA 3NATA 3O94A 1CZLA 2GXUA 3KWFA 3QH4A 4HGQA 5CTAA 1YDGA 2FVXA 1DLIA 2H1CA 2XUQA 3EXIB 1P73A 4ND7A 3PF9A 2IKSA 1AKRA 3DEAA 1SUFA 1RVDA 1CB0A 2FWBA 2N50A 1AGXA 2WHYA 1O0SA 3FYUA 4YWHA 3AFGA 3KOZA 5FRDA 3IPCA 1EINA 5CRIA 1PW5A 2A67A 2IDMA 4GXNA 5FT9A 3TLCA 1UZUA 4J1QA 5CG1A 3GVPA 3CLRD 3B8HA 1JJ7A 4RQTA 4MB6A 3FUXA 5TS3A 4DBZA 3CGWA 1W47A 4JJ8A 5TQJA 1KJWA 2ZBRA 3ABSB 3HYTA 3WK9A 4RWEA 1OYWA 2CFSA 3M81A 3LWNA 4GBMA 1EKXA 1XEFA 4KPYA 2VO1A 2ZUEA 4JSTA 3ZYZA 3AHCA 3PGVA 4RZIA 3GD7A 1LPOA 5GZ1A 1C8KA 1DXYA 4G1EB 3CXCO 2R6HA 2IK8A 2V7QD 4J6EA 2O8DB 3IHKA 3VZBA 5FOQA 1H5NA 1E96A 3OEYA 2BR4A 4UASA 4NBUA 3B1JA 3NT4A 4B7UA 1I0ZA 1G5QA 2P9FA 4I8XA 3HMKA 3ONFA 3F7NA 3V4RA 5JBIA 2ZDGA 3D54D 1DKMA 4RF5A 2BGRA 1YJWP 3I32A 4KIWA 1QZXA 4XIYA 3PCXA 3Q6NA 2BD0A 1P80A 2APJA 4RM2A 4I3HA 4WYMA 3KB6A 2GJ9A 1WXDA 2XWJI 1XLUA 3VA7A 4GR6A 5K20A 3I9OA 1YAHA 2HXGA 1PQ4A 3DLPX 5L9AA 2C9CA 2DFNA 3ZQKA 1XQ9A 4D0RA 2QWXA 4G26A 1EM8A 1ZUD1 4ZO8A 5J2UA 1BMDA 1F1JA 1CRPA 1U5AA 3UGJA 3QSGA 2NM0A 2A1IA 4QVIA 4DGSA 2GDXA 1QNLA 1NI3A 2W8BA 2XF2A 2XMGA 1F12A 3COZA 5NULA 5J2TA 3MTGA 1JG2A 1IY8A 4OLBA 2K4MA 1ESNA 1GA6A 1QYVA 3IRUA 4CT0A 5L3QA 3U6KA 3IDFA 4Q15A 4RDHA 1D3AA 2AFDA 4MVJM 3RI3A 1PO7A 4QJ3A 5A9SB 5HKKD 4YCNA 1Z8DA 3QELA 4LV5B 2JVIA 2F1OA 2DBZA 2PL1A 3ZCQA 4YRGA 3GPIA 3VSDA 3WLEA 4Q9LA 5CX1A 3S6JA 5IFKA 3PPWA 3LY5A 3WK7A 2OOKA 2FMXA 3RWOA 1GAJA 2XH8A 3NAQA 4G0PA 1TUGA 3CISA 3KSUA 1ZUWA 2Q8PA 3KG2A 1KEEA 2JH3A 5LP6A 4AQ7A 2F1JA 2GZ2A 3FR7A 3KX2A 4GZMA 4PRZA 3EOBI 1AKVA 4RVFA 5I9SA 5IJ0A 4ZI7F 2TS1A 3IP1A 4JP1A 5E1BA 4MVYA 5CLHA 3REGA 3T4XA 4YMHA 4E08A 1JLRA 6PFKA 3PX7A 1NUAA 4DQKA 4XVUA 3OFNA 4HC4A 4U7HA 1WJGA 4Y2YA 2YV4A 2Z83A 4FB5A 5TGDA 2J0EA 4GBED 3KLBA 4WLVA 3K32A 1P0MA 3BJEA 4XASA 1JIXA 4GM1A 2RC5A 3F4KA 5GIPE 1U3CA 3FLBA 1T3TA 3PSAA 4KWIA 2H18A 4MS4A 1KERA 4QGGA 4WLUA 3U1VA 4D97A 1GL7A 1DBVO 2IYUA 3MS4A 4GPZA 3C74A 4JL8A 2BHVA 3PXDA 3RLIA 3OC0A 4PYQA 4PYRA 4DSZA 1VPWA 1KIMA 4OMFG 2X1MA 2ZRIA 3TLKA 1RJEA 2A5LA 5F1KA 3E9ZA 4JI0B 4XYMA 4CWAA 3BMQA 1EVKA 4YJDA 2Y66A 2VYNA 3THSA 1JYSA 3LYAA 5MFPA 1B1AA 4NECA 4L6CA 3K92A 2GBFA 3OZXA 4BNIA 1TJPB 3DOHA 1WXIA 2EX4A 3IBSA 1C7JA 3NJ8A 4OFZA 4NJOA 4X60A 3ZHVA 4DTCA 3IAEA 3H0DA 4MS3B 2QZPA 4CEHA 1CIJA 1IN4A 2VPYA 3NRJA 1X7YA 2UZ1A 1X70A 5BSWA 2Z46A 1B23P 3L9WA 4DLVA 6ABPA 2ZWOA 3LPAA 3PDJA 4EBBA 5AFSA 3M1IA 2BAGA 3MOGA 1WSAA 1X1CA 1XDWA 3BMNA 1XELA 5JRZA 2DKNA 2JFYA 3LLUA 3AL0C 4LZAA 4TKMA 2LIUA 3OUTA 1ONSA 1PZXA 2BGJA 1A8HA 3ENKA 5LQSA 3ZQUA 2G4LA 1UQUA 2GKSA 3QXGA 4IL5A 4XCVA 4KGDA 1X2BA 2WAYA 5FI0B 4F3RA 1X7WA 1XL1A 3E2MA 5BR7A 3FG9A 1KI8A 1T8TA 3BXPA 3LY7A 5HGLA 3SFVA 1RR6A 3TEJA 3GT7A 3TRKA 2IITA 4L7VA 5BSKA 4UHKA 2QG9A 2F59A 4TV9B 2R86A 3QOWA 1AQIA 3IV7A 4RPIA 4Y2JA 5FHRA 5EXTA 2WJ3A 3MRXA 3Q11A 5LQAA 3I6IA 3TTSA 2VUUA 4HAZA 2IOHA 3C3DA 3IQWA 4UZFA 1N7IA 3G0CA 4WY2A 1N6IA 2H6EA 2PZGA 2R7MA 3K0KA 3TGWA 3UMGA 4AF8A 3HDVA 1E2QA 2WNHA 3D4LA 3ZGVA 1MIOB 3A04A 3FKSD 5BN4B 2NU8A 1CS0B 5T3YA 3HRIA 2P75A 2VYFA 4HF7A 5DM60 4WJZA 3PNVA 3MWEB 4L85A 3WIEA 4BMVA 2WPTA 1EX9A 1JGTA 1OLSB 2CD9A 2EDCA 2I2AA 3FUTA 2VAVA 3JASA 5ALGA 5FTMA 3LQRA 4UFPA 2EEPA 4H1HA 3TLMA 2HGSA 4DCCA 3C3EA 5B3AA 4CL0A 1SU7A 4KXMA 4AZ0B 3PGMA 5SYMA 2IUYA 1JEQB 1SVUA 2K5UA 4MR8A 1BRTA 2X2PA 2NTJA 2CF6A 3S1AB 3VH1A 1DV5A 2PH5A 5SZJA 3QKIA 3P9ZA 4FC7A 1F7VA 2G17A 2G08A 1KI7A 5KP7B 3DEZA 2BGWA 1NC3A 3KJXA 1QK3A 3LK7A 1YU6A 2DRIA 4AZ3A 2GEJA 5BQ5A 3LX6A 4JUCA 4KI0A 4AW9A 2Q5FA 1BTOA 4MW6A 4CTKA 2FVEA 1GCGA 3N2GB 1M6EX 4YAUA 3B3FA 4P5PA 3QXSA 2IELA 1E5QA 3RVPA 3GARA 3A4MA 5TE9A 3DUFA 1D5CA 1E7QA 1QJCA 4GI5A 1XVIA 4DLKA 5U4XA 4LWPA 1HQKA 1MABB 2CBGA 3SIWA 1JR4A 3LT1A 2X19A 4P3OA 5H9WA 4NXMB 2I33A 5F2OA 3NHRA 3RU7A 1WSDA 4PAQA 3T3GA 3CCJP 2W2VA 5JJBA 2KX7A 5TF4A 2FR0A 2R8XA 2WAXA 2XZTA 1N8KA 4P3KA 3G0GA 1YB6A 2B8TA 2GPWA 2DF8A 2VTDA 1BE6A 1XD2A 2AN1A 3QJ5A 4G0YA 5AHXA 4DIDA 4YV0A 4RDXA 1XZMA 4WKNA 1EXVA 4NEQA 3VKGA 1JKIA 4GZ5A 3R7WB 1HLPA 1NDHA 4BC1A 1I3KA 5GGXA 4GT1A 3GEIA 1Y80A 3RS2A 3AGQA 1NVTA 3D6NB 4GIBA 2FRDC 4YAOA 1U3FA 3PC8C 1L5NA 3I2FA 5JAMA 3WTCA 5TGTA 3NB0A 1IZ7A 2FW9A 1LTKA 1SULA 3CT6A 2NV6A 2FI1A 4GSLA 3RAPR 2JLQA 3DFMA 1K08A 4LSMA 5AW5A 1CTQA 2NTNA 1TCCA 1U2TA 4U7PB 3JZIA 1DNPA 5KYVA 3QU5A 1UBHS 2A9FA 1V4VA 1ISRA 3KSDO 1E6MA 4IXTA 4QL3A 1KSGA 2NU6A 2YQ5A 5L4NA 2VT7A 1I7QB 4MAAA 5E38A 5I7FA 1AE1A 2VPIA 3O1JC 3UV6A 2WD7A 3GK3A 3SF8B 3QKRA 2ZUWA 1RHRA 4U39A 5CDFA 3ZW7A 4AWAA 4A1FA 3R6LA 2JD0A 1IZ0A 4K6CA 3GJTA 4NBRA 2JJ1D 1UKYA 2GF0A 8AT1A 3TZBA 1QCZA 3SC3A 4ETMA 4DXDA 2JRLA 3LHKA 4LF5B 5CAEB 1K5PA 1U9ZA 3VZRA 1W88A 5LUAA 3QKWA 1RABA 4TL9A 3WSVA 1W8IA 5CCEA 1JAHA 4AKIA 1HDCA 1DAHA 1IJBA 2ZJ7A 4DLBA 3TJRA 4BDTA 2EW2A 2P9GA 2DFPA 3H2SA 4Q3AA 3KWJA 1EU1A 1WV1A 1A2QA 3CCEP 4MRRA 5CT5A 5HNKA 2H65A 1VP3A 3A4NA 5T4BA 4B33A 4LJYA 4CLRA 3P52A 4RD6A 3DT9A 1ECPA 4EZIA 3ZJ5A 3JAMA 4DIKA 4X3OA 2FGKA 3WGYA 1XC7A 1T36B 1TM2A 1SH7A 4Q3KA 1S96A 2ZRNA 4EJMA 3NHZA 2XYGA 1XMOB 5T4HA 4WAUA 1F14A 3ORSA 4WZAE 3TTXA 4NJEB 4F97A 5C5EA 1SC1A 3DHVA 1R9MA 4XRGA 5JHGB 3GJ6A 4YRCA 2QVCA 1E8DA 2DPMA 1AS0A 1YASA 3BVPA 4BX9A 2FETA 3ETGA 3KLNA 4TYPA 1ZIOA 1NYQA 3DP9A 5BYBA 3X1ZA 3RYFA 2Y76A 1F5SA 4GPTA 3A9CA 3K6KA 4YS6A 3DZGA 3NY7B 1RNLA 1CG6A 4Y2HA 4MVCA 3DQPA 1Z0AA 3SIRA 4PX9A 1JKJA 1YZ3A 1GQRA 1XL0A 5CBPB 1WXHA 1W581 2YZKA 3IAUA 2HOQA 2H0QA 4I5DA 3E7DA 1ZXLA 4LOAA 4M1KA 4PLPA 4Q3BA 2LKIA 2C9BA 5FL7D 3HMQA 3BQMB 1GRNA 3H84A 1PJ2A 4W82A 4KPFC 5KAMA 3WIOA 2WIGA 3EZ9A 4BRZA 5FAXA 3U4IA 3ZY6A 4N49A 2FHPA 4KDRA 1NVVQ 4KAJA 4L6AA 3E8MA 5GY7A 5H83A 1QH1A 4EG8A 1TGYA 2J5KA 5G0TA 2CCGA 4MWCA 4BAGA 2JFGA 3EIXA 3TOVA 4AJHA 4BZQA 1VXRA 5IABA 1SCJA 3CPJB 4FR2A 3AP2A 4LE0A 4LXYA 2KYRA 4HDAA 4E2YA 4F2DA 2LDXA 1Z8NA 1MHTA 3VUFA 3RT9A 1M1UA 2X2BA 3OFVA 4HOYA 5IK2A 4C0AC 4CBVA 4EY8A 4YNBA 5K7SA 3PIIA 1A71A 2G3YA 5T8KC 3SHFA 4QEDA 5B12A 1IJFA 1K3FA 4I9HA 4Q3EA 1H1LB 3T5GA 4QXRA 1NVAA 3Q98A 3GLGE 2R0QC 2H2HA 1UDRA 5JPCA 1VYHA 1DAGA 1JMVA 1YFKA 2W4QA 4YT2A 3H2JA 3MTBA 2JBHA 3HZZA 2X8AA 4Z54A 4ZAVA 3UHJA 4ZTZB 1Q7RA 3GWZA 4O0MA 4EM6A 3LD9A 2QPTA 3ND9A 4QXQA 1D7AA 3H5OA 3AVWA 3T7AA 4QFCA 2JKVA 3OMXA 3V80A 3THXA 2HIGA 5LWHA 2C00A 2KGAA 1SB9A 3QY0A 1BFUA 1Q0SA 1QH0A 2CLFB 2PXCA 1R9GA 2B98A 2BRUA 4U63A 1GLVA 1YWGO 2EWVA 2JJ8A 3B1XA 3DF9A 4HH3C 3ESAA 1PDWA 2HQBA 4LRTB 2VTKA 1JDTA 3NHYA 2JLRA 3CY6A 4GE3A 3HCWA 3RC2A 3VR4H 4BV8A 3ONVA 4CQJA 4MJ3A 4RTLA 2GYVA 3H04A 3TLYA 1NYLA 2V59A 3C4JA 1OX5A 3DVLA 2GN2A 3KVYA 4MULA 5ALFA 4Z2YA 2NU9B 4EHLA 4DDTA 2AZ4A 1TKRA 3E9RA 4L15A 4Q6BA 1DEKA 2ZYTX 1WXGA 1QFYA 1HFEL 5C3UA 3O0TA 2VJOA 3OD5A 3VI3B 4PYJA 3EGWA 3O31A 1A96A 1W0JA 2WICA 3KQLA 3S55A 1KIAA 2Q3LA 4OEHA 4CG2A 1ESZA 3KKKA 2QW1A 4BNUA 4BYMA 2GZJA 1R4MB 1S2NA 2WWWA 4F12A 3LTNC 2GBGA 4L0CA 4UEKA 3NHLA 4BNTA 4NXNB 4GEGA 4DM3A 3I2GA 2PMKA 2A14A 1YGPA 5EL0A 2HLNA 4EHHA 2ZIXB 1EZZA 2X6RA 221PA 2ONKA 2X0IA 3QLJA 4FCVA 4NP6A 2C5HA 2B92A 2CFRA 2WWTA 3NS7A 3WGHA 4NEOA 1OFIA 3KPUA 2R48A 4HPWA 4NHOA 2BOVA 5JMWA 1RZRD 4BAZA 1ZGHA 1XCMA 2FACA 1P77A 3ICQB 3TPCA 3N28A 3HCBA 2WFLB 4OYRA 5FJIA 3JR3A 1BDIA 4MXDA 1SXIA 4PO8A 4C0SA 1GDHA 3I92A 6ADHA 4TLMB 5KCZA 2XT1A 1G8KA 3EZFA 2XCSB 2JG3A 4ARCA 1D4FA 1JYEA 2AOUA 4NFLA 4F2WA 5L6MB 4JJEA 3WP1B 4FT4A 3MBOA 4IJUA 3V7WA 2Z2JA 3M4JA 4LI3X 3QVJA 4RA6B 3UATA 2UYOA 2GTPA 2IDZA 5SZHB 2F1RA 4RL6A 2DP4E 1D1SA 3KQWA 1W75A 3BDVA 5IJ9B 2OFWA 1R88A 4PZYA 3BQNB 1KU6A 3AETB 3EA4A 2DERA 1JHUA 3G79A 4RE6A 5CVEA 4ODIA 3BHMA 3SQMA 3KKMA 1FP6A 5JISA 2R1VA 2BV3A 1AMNA 4RKQA 1WZNA 1YR3A 4H7PA 4HH0A 1G3QA 3VVLA 3PJRA 1W5EA 1QIJA 4AD8A 2PGJA 4C4ZA 1EWKA 2FK7A 4M3NA 1JIKA 3RUAA 4LMPA 1TAUA 1ZXXA 1C1DB 3FDIA 3CNNA 4OTZA 5TLSA 1MHPA 3KFXA 2OD2A 1EQ2A 1O0BA 3AR8A 3VO9A 2R8RA 3V8MA 3WDSA 2VYVD 1UJNA 4JLVA 5HCUA 1ZC3A 1EHYA 2OD7A 3AIMA 2AQKA 2R44A 3QPBA 4Q7QA 5M29A 4BO5A 4C0JA 4AJ4A 1UWLA 1G3RA 2UUBB 1QCDA 2ZYWX 2NT4A 3RODA 3LPMA 1M2EA 3H0CA 3FMPB 2I71A 4NZMA 4B09A 4HVLA 9LDBA 1U2DC 3KVOA 3UAVA 2XQFA 3D6JA 4N3CA 3TBHA 1NQXA 3BH0A 2SKEA 2P9ZA 3OIVA 2XGJA 1UXHA 4WKBA 1IY2A 2AJTA 4PLZA 1M10A 4XFYA 2P69A 2W93A 1OA1A 3GI1A 4O59O 3SXPA 2G1AA 4XQGA 3ONDA 5LOVF 4WN9B 1G21B 1E2LA 4I9UA 3DR5A 4QLOA 2WMOB 2G9RA 2VJLA 1N8TA 3BE6A 3CZPA 4X8LA 1CJMA 3KSRA 1T2CA 5C1IA 1SUWA 1T1SA 5C35A 5E1MA 3HDGA 1SXJD 4C2UA 2IX9A 3AI1A 1R0BA 2JKYA 3RH0A 1U4SA 2WK1A 2XYRA 4NR0A 3NVKI 1FPQA 1PHPA 2PZFA 3MJRA 1ABBA 3D64A 3H5IA 3LRPA 4RMHA 4ZHQF 3IERA 2BC9A 2QM7A 2H4JA 1L1RA 1QO0A 4F3YA 1XJWA 3A0RB 1HFWA 5TMBA 1MIOA 2PYIA 1R3DA 3OY7A 5BN4A 1CS0A 1EXMA 2WKRA 3I9V1 3PDHA 4YRBA 1CUXA 2N47A 3C3AA 1N0VC 4JI6B 4Q02A 3X1MA 4AJ1A 3OU6A 4EJSC 4C0XA 3CC8A 4HQNA 1JSLA 3EGEA 4ZVTA 2Q5IA 4BAUA 2BI7A 3DT6A 5K2OA 1X1BA 1BS2A 4DY4A 5IULC 3CE6A 2B1RA 4LJAA 1EGHA 3E35A 1DLJA 5BWCA 1S4MA 2ZG6A 3DEYX 3PRYA 4G4GA 4YRLA 3GJ4A 2OHOA 3RS3A 5KMGA 1EP3B 4M9UA 1ZH6A 2Q6TA 2ZFUA 4HLUA 4RUKA 4GSKA 1TI7A 3IMFA 4TXNA 4BB6A 4NOLA 1JDBB 2PGIA 2H7VA 5J63A 4MYRA 1Z83A 4H35A 3EISA 5E7MA 4JQZA 3VDQA 2YINC 4D3FA 3HS3A 5KB3A 3PR1A 3E7XA 3OQJA 4IDEA 4ARVA 2EC5A 3L92A 3T7IA 5HGOA 1C7RA 4Y6RA 1L5HB 1YQ9A 3NV7A 1RRGA 1ZYUA 3HUFA 5I6DA 1FU7A 3EBOA 4UXHA 1EK6A 1VLLA 2VJAA 3IKTA 1P1HA 4FB4A 4V1CI 2J5RA 1EYZA 1ZN8A 4PZLA 5D8DA 1U7XA 4YN3A 3IHTA 4MPRA 3SOPA 5LNK6 1U1EA 1WU8A 5IZCC 2QSJA 4FCTA 3L18A 5F1YA 4EPTA 4EPWA 5FPKA 3PTAA 2O8CB 4XX0B 3PC7A 3LKVA 3HJTA 5CLLA 1GNPA 2NUAA 1VPLA 2YVAA 3HJNA 4O02B 2WF9A 4OYHA 5CM9C 4DR3B 1EZ1A 3PL5A 3QXCA 4REOA 4WL0A 3T5CA 1U31A 1ZKMA 3O9ZA 2YR0A 3LX4A 5C34B 3GDWA 4AY2A 2VCEA 3N0XA 1IOLA 2OCGA 1P33A 3BL6A 1ISFA 2FU5C 3DAGA 4FYMA 1KDZA 1O6GA 3K1TA 4MEJA 2PU7A 4C03A 2GHQA 1I5RA 1DNYA 1NVKA 4U2FA 4A8JC 3I55P 3VVMA 5KSWB 1HA3A 2XSZD 3WHLA 4S04A 1RYNA 3D81A 3R7WA 3Q9UA 1W87A 4XSVA 2A0UA 2R00A 2VJQA 1LC0A 3I56P 1UADA 3ENWA 1QNFA 1QMGA 1GCUA 3AR7A 3C1OA 3IEUA 5DM1A 3RG2A 3UANA 4E1AA 2WYWA 2KS6A 1X14A 3L0YA 1NP7A 3GMSA 4WA8A 5MN4A 4TTQA 5IAOA 4INOA 3HYSA 4RCYA 3WLQA 3KFLA 4L1KA 3SXJA 3NVMB 4X3CA 4C3VA 2D0DA 1MEOA 1GSIA 4ZPJA 3PFCA 3E9NA 1D1DA 1FTSA 3MAJA 1LSOA 2C8LA 2CDRA 4KK3A 3IUBA 3SF8A 4JYMA 1E2MA 2VH5R 4B84A 2HT1A 4W6ZA 4V2UA 5E6SA 3FZGA 5G0WA 3E1KA 3WMFA 2IH2A 2HWUA 2AWNA 2ZUUA 3FCUB 4KWTA 4OCZA 4PSCA 2XV6A 4CKBA 1M1NB 2JLZA 1AHIA 2BVNA 1L6RA 1NF8A 2PPLA 1N9KA 5ADUS 5CAEA 1KZ9A 3M1LA 2QF7A 1DXOA 4EK9A 2D7CA 2Q1SA 4B6GA 4B3GA 2LW7A 3DYBA 1MB2A 1V7PC 3IIJA 4L50A 2GVZC 1IEQA 4AMVA 3R6WA 2HNKA 3AB3A 3W2EA 1U0RA 2V1UA 4HK4A 3U7IA 2ERXA 5KINB 1O8CA 1MX1A 1XDSA 3PJEA 4KO8A 1M6WA 1IVSA 2IIVA 1P7CA 1JDJA 2QG6A 2ZJZA 1KKMA 2D5LA 3JCZA 3NRCA 3M0EA 4S0ZA 4P7JA 2AC4A 5LLTA 1ZCAA 3B52X 3L0IB 4DA6A 1T36A 2BUOA 1J33A 1EJ0A 3PXAA 3BJMA 2BEKA 5FPHA 3VC2A 1NW9B 5FBLB 1R10A 3A8TA 3R9WA 3BJZA 4DC9A 2QYSA 4NJEA 4V0KA 1ST3A 4OY3A 1IUKA 3SEAA 4C0WA 3NLLA 1E2IA 4PYOA 1GKKA 3W3ZB 2QMEA 3OZBA 3GRPA 3HLTA 4FYKA 2X0JA 5HQ3A 3EAFA 3TLXA 4Z4FA 3H7IA 1GO2A 1P5FA 2LR0A 1I2MA 4AFNA 3F8SA 3ZCSA 1O4WA 1AVTA 1GN8A 1W36D 1YFLA 3UGQA 3FGZA 4ZTBA 1OI4A 1USUA 1E2NA 1A4UA 1V16A 2WT8A 3CH7A 1NW5A 4ITVA 3PC4A 1ICEA 4QHYA 4QICA 1WM1A 1T3ZA 3PFFA 3MRSA 1RZVA 1KQSO 1XMXA 5E0KB 5IAGA 3NHMA 3ZHRA 2IYRA 1ZCFA 3A0UA 3W2GA 4WKGA 1G5TA 1EE1A 1Q0HA 3O8OB 3R8FA 5CB4B 4UBJA 5IMBA 1G4AE 2BGUA 5DCUA 1XA3A 2NO5A 4BMDA 5HP4A 2JD2A 1XTVA 1A50B 2D1QA 3U2QA 4OO3A 3EUFA 4U2EA 3OMLA 4FGZA 1EX7A 2FQ2A 3PHCA 1JPVA 3Q9LA 1NW8A 3IPLA 1CZRA 5KKNB 2JASA 1IZZA 2PN1A 4XVCA 3WICA 3M33A 3ZCTA 2FADA 4O5OA 4TRRA 2BGLA 2ZAYA 3H9QA 4ND3A 2OXEA 3AF0A 1VG0B 2O06A 3A1CA 3FOCA 4MYSA 3SFZA 4WZBE 4OX9Y 1FZTA 1AK2A 1H8EA 3O03A 1K6JA 5AOBA 1UT5A 2XIQA 1TUEA 4NCJA 5EIBC 1JDNA 2RHGB 1LX7A 4RVSA 5CYGA 3O4JA 1A95A 4JVLA 4E6PA 4F5WA 4Z4QA 3QHQA 4P80A 1K0FA 1U9IA 2CUTA 3V32A 3QBVA 1QYIA 4L22A 3SK0A 1XVVA 2XYPA 4DWWA 4NYJR 1DU4A 1O1YA 4P4NA 2HJ9A 2R5WA 1O6BA 1L4GA 4QWMA 2FW8A 1QO9A 1YI2P 4TRMA 4ZEWA 5K0LA 4ILKA 4QTYA 1I0IA 1EVJA 1R2QA 1VI6A 1JQJC 2FKAA 3R2JA 4DJAA 1T0HB 5AJXA 4L8LA 1C3VA 1DWUA 1SB8A 5EI5A 4DLXA 5JPDA 5KDDA 1OIXA 2NU9A 3JWJA 2JCBA 2MVUA 3IXMA 4GZLA 4RY2A 3I5XA 4CM7A 1RQLA 1XHLA 2X8JB 1Z6YA 3V7FA 3ZIUA 4NCNA 1QC5B 4NU6A 1SPBS 4W9RA 1J2YA 3UWMA 1VJGA 2PSDA 3M9LA 5TX7A 5B7NA 4X6YA 1M6VB 4PGHA 4KGXA 3SZOA 4CCSA 3FSRA 2WFZA 5KOIA 4LIPD 1C9DB 1QKKA 4KX5A 3TB4A 3U60B 1K75A 1R4MA 5E1OA 4F45A 3RSSA 4G8CA 4R1TA 3HXPA 1CYEA 4TQGA 4WT7A 3TQQA 4IUDS 2FWAA 2PBRA 1NVGA 3K9LA 1L7OA 2XWPA 3GH1A 3MLAA 3DPHA 4XIIA 1QR2A 2ZWPA 4TRJA 1QO7A 4ZQBA 3E58A 1ZD4A 2QPAA 2Z4SA 4DIEA 4FE3A 2OYRA 4C4TA 4K9PA 1KTVA 4N6GA 2R6CA 2PV0A 4P93A 5I7AA 1GGNA 2WFLA 4S1NA 2GNPA 5FL7A 5T3UA 4RA9B 2XQVA 4B76A 4EATA 5B3JC 2C96A 3HHEA 4P0TA 3SJCA 4US2R 3L7BA 1Z4JA 5CDGA 2EQAA 4Q7MB 4WKPA 1P0IA 4HB3A 3H9GA 3ZV4A 4A0FA 5A6VA 2EQ5A 2BW0A 4U0AA 3AF4A 2X3FA 2Z04A 1C3OB 2YXPX 4LOKA 3ZZTA 2QZJA 3QFCA 1HQYE 4DV2B 1DEOA 1I6KA 2IVZA 2Q28A 3OF2A 3TEMA 3MF4A 2RHTA 4H77A 4EEXA 2OC4A 4LHVA 1A1SA 4OXKA 4RIHA 4U0BA 5IJ9A 4YP9A 5AK3A 2JJYA 3ZWQA 4LDAA 2NTVA 4YMVA 4M0FA 5JQGF 2XCLA 3AETA 3QLUA 4L7QA 4DNOA 2HJRA 3LKDA 4B82A 3GGGA 3GT3A 2NGRA 1L3IA 5BN5B 3RABA 4C6RA 1DB3A 3GKLC 5HK9A 2PT9A 1N75A 3PUWA 3RIEA 4X92A 5BN3A 5HOQA 4EA7A 1HK7A 2OBFA 3O4FA 5F33A 4TKLA 2JNWA 2QAGC 5FF9A 1OH7A 4KWHA 3I64A 2FVFA 2JLCA 5JTTA 4LYGA 1AG9A 4CEJB 2ZDQA 1C1DA 3E7WA 4E5VA 3MN1A 1E9VA 1JQKA 4I50F 2WSMA 3AEXA 2IEGA 2Z43A 3J80A 1YUMA 1ULUA 3ABIA 5KJEA 3I8OA 1B16A 3R9XB 4EW1A 2R8BA 1JN0A 4PG6A 3NGXA 2RB5A 1D0SA 4WOPA 3RJMA 2AMJA 4OP1A 2PT6A 1RJGA 2UVDA 3G5UA 2D5AA 2DU8A 1SHLA 1RQ7A 3FPSA 1BDMA 1YO6A 3KV3O 5BYJA 3W7AA 2ZQZA 1BMFD 5JZOA 3G4SP 2EF1A 3HKBA 2YKGA 5K3SA 4D0NA 1FYDA 4HGNA 5KTMA 2BDTA 4IHKA 3A6EA 4EAAA 5F98A 1E3EA 1LNQA 4KXYA 4TUYB 1W2HA 3UAGA 3MWFA 4CKCA 4PG5A 1Z13A 3JWHA 1NT2A 1JDPA 1NI4A 2UZAA 1Q57A 2P6UA 4ITUA 2YMPA 2ZIFA 4IIHA 4WASA 5GQSA 5DEOA 1XLTA 2E9SA 2PNJA 1ZJ4A 3ZQ6A 1GCIA 3C6KA 2ZS8A 4QECA 1JFFB 4YAIA 4J43A 1Q74A 2IZZA 4RPHA 5ADHA 2H1IA 4WECA 2PX3A 1IN8A 2E1MA 2PZJA 1CR4A 1XZAA 2EGHA 2QQ5A 4W1SA 4EJ6A 4JLDA 5LU8A 4GUAA 2Q4TA 3GFOA 5D85A 4OLAA 1XRNA 2CMGA 5IKEA 1NNLA 1IWPB 1YZTA 4I1VA 5K51A 3ER8A 1JBEA 1LFDB 3FWYA 3OJWA 1QZUA 3H87A 1YOBA 2K0DX 4DLYA 5JC1A 2JDID 4HLQB 3DDWA 4L5CA 4IFTA 2HRCA 1T5HX 3OE7A 2PQMA 4EP1A 2EYQA 2ZTSA 4K05A 4B3RB 1J42A 1F2DA 3KAQA 1KH3A 2XQKA 5KREA 3TEFA 1VE7A 2YUIA 5EIOA 4US0R 3TR0A 5AVKA 1EESA 4F8EA 2DJ5A 4B6RA 5L40A 2XB4A 2EZTA 3FR8A 4PSDA 3RS7A 1MPXA 1TQ6A 3ZWBA 3SNKA 4CLDA 1HL7A 2XB2A 2MINA 3QMMA 3PT5A 4IWNA 2ID9A 2ETXA 2PD3A 2QOEA 5C8YF 3OHSX 1JPJA 1K7XB 1MG0A 2P41A 2Y0PA 1ETHA 1PDVA 2B20A 1QV6A 3EGDA 3K09C 4IRUB 2ZWVA 5T4EA 3WLPA 4Z4HA 2PWYA 4X63A 1II9A 3I2JA 5TJ9A 5LB4A 4A2WA 4KYVA 3G5LA 1GTZA 2YFYA 4EKEA 4YV1A 3JQFA 2GO7A 2J9ZB 3GEPA 3QXJA 3H5AA 1KOGA 4ICIA 3ICEA 2ACWA 1DTWA 3HVRA 3NWEA 3W5AA 4ERXA 1N8SA 1LQUA 2Z8ZA 4P08A 2WZCA 1AQUA 2VK2A 1T26A 1O96B 2XOKA 2OENG 3LV8A 2AJLI 4EMUA 4GLFA 1DTSA 4E7OA 3PRJA 2W6ID 3ZN2A 2RGBA 1K4KA 4FYIA 4PR3A 2WD9A 1XZCA 1VB5A 2VIIA 3DVRX 4KYTA 3TXYA 3I5UA 4BTEA 3HVJA 2RARA 4IVPA 2DQZA 2JANA 5KP6B 2QAJA 1HZZC 2FCAA 3JZDA 1V0JA 3N0VA 3ASZA 3NKVA 4IYRA 4FWTA 3BERA 3CLKA 3RS9A 2ZAGA 3GLHB 1DADA 2IPXA 4OHUA 4NAVA 2PL5A 2Z2XA 2KPOA 3UTDA 2JAHA 4BC0A 1RCUA 4YJGA 4MX8A 1JEDA 4IH9A 3ZKAA 3WYEA 1O03A 5TY0A 4IIGA 1FUIA 2RAVA 5JNUA 1KZ6A 1NBAA 4OBWA 1JFTA 2BE9A 1ATZA 4PQFA 1E99A 4EVRA 4OH7A 2XB8A 4IGEA 4RLFA 1XALA 4BE4A 4BQEA 5BQ3A 4V3CA 3PVZA 4Q1DA 2WV7A 2R1TA 1ZJYA 5DULA 4JB2A 5BUQA 2IBMA 1YB1A 1N9GB 1GPDG 4ZQIA 1XDDA 3G0OA 3KR9A 4G1UC 2IV7A 5LM3A 5HHTA 4JAVC 1XF9A 2E4YA 1F6DA 2GF2A 2WVAA 2FF5A 3CW2A 3M34A 5IF9A 1P72A 3OUZA 3LQ1A 2PUVA 1HORA 1Z6ZA 2GTIA 2Y1KA 4IS2A 5DLPA 4B6PA 1H42A 2H85A 3AHHA 3I9NA 4RZXA 2Y3IA 5GPBA 1XTKA 4TKVB 3OQOA 4M9CA 1QV7A 1M1NA 3LWZA 2YJTD 2AVDA 4ER3A 3AHDA 3K9FC 5BWLA 3EG9B 3ZDAA 8LDHA 4B6SA 5KNDH 2B1QA 1EUQA 1RTKA 4KRYA 5DGIA 1EWTA 3IBFA 3IQZA 4G1BA 3K3PA 3B38A 3G3EA 3DZKA 3OT1B 4FLFA 1OH5A 2OM6A 3I04M 3MD9A 2PY8A 2JFXA 4ZI7B 1EFAA 3P2JA 2HSWA 1R4AA 2YWFA 4B71A 3PUZA 4Y6GB 1NHGA 1HT2E 4OREX 3RVDA 4RHCA 5J4YA 4IUCS 4JUIA 5FUXA 2LVBA 3LT0A 1XEXA 3C14C 4EG4A 4P4LA 1OGIA 1T2NA 3EZYA 5ESDA 5DHUA 4ER6A 3FWKA 1PFUA 1G3MA 4G86A 4QGAA 4NU0A 1EWQA 1DE0A 3CIFA 1U6KA 1WEHA 4PXHB 3PQ8A 2PBFA 5TDHA 5JSKA 1GA4A 2HDWA 1MR3F 3HL4A 5LN1A 4AY5A 1RLUA 4N1AA 1M34E 2ATVA 2EW8A 3TQSA 4ZOQI 2FXVA 1UJ6A 1S02A 3UQYS 5EP1A 1E9CA 1LK5A 1C2TA 5A0TA 1OAOC 4A5OA 2ZPUA 4HPXB 1OASA 2FG6C 1GRVA 2JATA 2FSPA 3C3CA 3HJCA 2FNAA 3LPDA 4IUBS 4J7AA 1THTA 2ZRQA 4G5SA 2HGZA 4A7PA 5BUZA 3EZNA 1UXJA 4KLNA 2CF5A 3I1FA 4FJ2A 4LZNA 4PCAA 3I61A 2GM4A 3AR2A 2IC5A 5BT8A 3WFIA 2O8NA 2PKYX 4HEA1 3RAEC 5K0SA 1OXMA 4ZEXA 5C52B 1OU4A 2KJQA 4GI3A 1DC5A 4ZDWA 1T8KA 1L7QA 3H0EA 3RKRA 3AG6A 2P4SA 4ZIRB 4DR4B 2E4WA 1GFIA 2BGNA 2NVWA 1XP8A 1ZL2A 2W37A 3KZ1E 4OQDA 3WJAA 5AVQA 3WOHA 2B6NA 2O20A 1WETA 1E1QA 3T41A 3QHAA 4I14A 4PC3A 3L7YA 4PCUA 3C24A 3W90A 3ZY3A 4E03A 3DO5A 3D1LA 5KWVA 2F64A 2G6TA 3M6IA 1JALA 1LU9A 3FVRA 4G0MA 3UMBA 4B47A 1HQDA 5CT9A 5KTPA 5DCKA 3IULA 3WWEA 4I19A 5CBKA 5EWJA 5J5CA 3EGOA 1HE1C 3OX2A 3K2BA 1NWCA 2WA2A 4DADA 2YIMA 5DXFA 3HDTA 4BEBA 5E8JA 1LLDA 2G0AA 1U7UA 3EGXA 4CDGA 3K6RA 4QBGB 1GYPA 1ZI6A 5DYYA 1ZJWA 3H9EO 4X45A 1N77A 1QUFA 1I9GA 3K9WA 5EESA 1L5VA 4BX8A 1GGVA 3FTNA 4LDRA 1KO7A 2D0IA 3C48A 3USES 3QPUA 4HNHA 1UM8A 4XAQA 2QV0A 1IATA 1TIKA 3GLFB 1YI0A 1DC7A 1XAJA 4QUIA 5FA5A 1ZRSA 4JGIA 4X1YA 1FE8A 1YHZA 4ZVKA 1GL3A 3QLVA 4XKJA 2JVJA 2FWNA 3CW9A 3GYGA 4R81A 2AZDA 5A5VA 1XZHA 3AYXB 3L7MA 4CTMA 4XYBA 2DKFA 1WABA 5JR3A 3QOFA 1H0KA 5B4UA 5TQ2A 3USCS 4INJA 2D8MA 4I1SA 4UE2A 5BWOA 4WMLA 4LRUA 3HBJA 2VPTA 1YS6A 1PJSA 2BFNA 1UM9B 4GOMD 4HZIA 1IY0A 3V2UA 3H5NA 1AC5A 5E0OA 4ZYUA 1T8YA 4P33A 3HV2A 4U6NA 1RKBA 3Q88A 1KY3A 1MW8X 1PJQA 1PSZA 3CLTC 1H3EA 1LY1A 1M6VA 4PH1A 1T8WA 1NC1A 3FNGA 1TRKA 3WLNA 3ZHOA 1H9AA 3VC7A 2DG2A 2DPXA 1WZ2A 1P19A 3ABQB 5HV8A 3RFFA 3PQ3A 3OIGA 1CE8A 2CKMA 2WR8A 5ICCA 3JQ9C 3U7EB 4E30A 4HMOA 5B53A 1Y8RB 3TAUA 1Y1RA 2YVQA 5F5NA 3GA5A 2JEOA 1QZZA 5IN5A 1W35A 4AQYB 4RJJA 1VG1A 3HC7A 3W6NA 1Z0JA 1WE2A 3VYUB 4B45A 4E51A 1UBUS 3DE7X 1G17A 2Z8YA 4K1XA 4CIAA 1X1AA 5FWYB 1RHMA 2X0FA 4IJMA 5HZHA 1JHQA 1XPJA 4JGBA 2XRZA 3GJRA 2JIDA 3LOQA 1Z4KA 4DAEA 1Y3CE 1MLDA 2M6LA 4E14A 3M4ZA 4N54A 1IHYA 4W5OA 1D4AA 1U99A 2GCIA 2WFAA 6YASA 3UMRA 1NXVA 1T10A 2SECE 2Y1FA 1QIDA 4AMZA 1YJXA 2Z98A 1F2TB 3N39C 3PXBA 4MYUA 4YJ3A 3VOSA 4BP1A 4C87A 3GMIA 2EG5A 2YDYA 1UFQA 2NUPB 3U9TA 4WEOA 3SE7A 4KREA 2GOYA 3R1IA 2MR6A 3BSYA 5E9QA 2ADMA 1JI0A 2GYUA 4H2DA 4HWPA 4FR5A 1A69A 3A6HA 4RKRA 4Y9RA 3P71T 3NYWA 2XLCA 1HT3A 5FA8A 2JD1A 1CP3A 5AO9A 4FDMA 1WPGA 3CQ9A 1T5SA 1HYEA 2JIOA 2O4CA 2RC6A 1E3JA 3A3YA 4DWVA 5A1TA 5BV7A 5GTDA 5K3EA 2MIIA 1NJFA 3ETLA 4NS4A 2F8MA 4FHDA 1FRZA 1ODSA 1MX3A 5F2EA 5IP5A 2IIPA 2WIBA 4IYJA 1XLWA 5C9ZA 4YLEA 3DF7A 1SQ5A 5CT8A 2RIPA 3R9XA 3ABOB 3PNMA 3RADC 1L8XA 4JASB 3WK8A 2DBQA 5FEUA 4LISA 1K3TA 1B8VA 4CKWB 5ES4B 2C83A 2QTLA 1YK0A 2YCBA 3MWKA 3R9IA 4PYLA 1E0AA 2G67A 3WYCA 3VR6D 3KQNA 4GYWA 5A3RA 1L5GB 2XE7A 3LA8A 4B6JA 1B7GO 1IDOA 3S0JA 2FE1A 3WYGA 4U0FA 1VJ0A 1P18A 2FG5A 3KVRA 3OQ6A 4FSHA 1Z2EA 5ALMA 1QOPB 3OLCX 5JUWA 2AW5A 3SBXA 1VA5A 1XMQB 3UK0A 5ENZA 3IYLW 1A7JA 3EXHB 2IPLA 4MJXA 3UHFA 3TQHA 3AUAA 4H08A 3U4GA 3AVQA 2HD4A 1BKDR 3EHEA 5LDDC 5EHGA 4J3NA 2YW9A 3CF6R 1XF1A 3DDUA 4X84A 4A4DA 4E46A 4R8VA 4TKUA 1H85A 3W1WA 1WTCA 2J7PA 1ZH8A 3BEOA 4ZPXA 1Y37A 2RDMA 1W2WB 5HCIA 5DNUA 2JAQA 3L6OO 4UM8B 1ZXBA 4RSMA 1WQ1R 3JVEA 1Z4LA 2AZMA 5BW4A 2CB9A 2J0SA 3MGCA 4G65A 1PWEA 1YS9A 2PS0A 4P4SB 1DMSA 1Q7CA 2II6A 2R8OA 1JMKC 2JI4A 3E84A 3K0CA 4LSWA 1J5PA 3TKAA 3GDOA 3LO5A 4ZCSA 1J25A 2COKA 4OF4A 1Z6AA 3VU9A 5ISMA 1UIRA 4R41A 2FSGA 4BJHB 2Q2QA 4ZRNA 3TTWA 3EFHA 4HDRB 2PA3A 1NBME 1XVTA 4C1NA 1DEXA 1GSOA 3CKYA 5JY6A 4GI2A 1W4ZA 2B5WA 3ESRA 4MB0A 1DVRA 2BN4A 3PIDA 1O95C 3WV5A 4JEUA 2WAOA 1CEEA 4TMWA 3C5VA 1IG0A 2QI9F 5JNWA 4KC0A 2BBOA 2G09A 3NHWA 2R751 2J9GA 2ZRGA 3DR3A 4UU0A 3U3KA 4LQLA 4UUOA 4D6YA 1FU8A 2V7QA 2ZJBA 5IVIA 4MK4A 1VGVA 3AUJB 3QNUA 1FU4A 4ROTA 4EL5A 1ESCA 1NMXA 2VNSA 4OUDB 1SKAA 2HEIA 3AM3A 4BWFB 4JLBA 3U1TA 3PUIA 4Y1RA 1UKAA 3PIRA 1LLCA 4D4HA 2ECOA 2CJYA 3PGJA 3VU1A 1V47A 3WLTA 5ERXA 4CG0A 1DOZA 1KO8A 3V33A 4QG3A 1VMIA 1DFHA 3HB1A 1SXGA 4IICA 1FTNA 1WBBA 1ZNVA 1JQ5A 1BXIA 2MVVA 2I4IA 4I4IA 2WAAA 4L27A 4B79A 1DWPA 1KJ9A 3PFHA 3UK7A 3EY4A 3GIWA 2V5VA 4PWZA 2W2QA 4A8PA 4AWBA 2I6UA 3D02A 1MFZA 4LOJA 1ITZA 1RLIA 1ZH4A 4H17A 3COSA 3GLHA 5F3DA 3G28A 5TV2A 4JJ7A 5H82A 5INTA 3BWYA 3GFFA 2VHJA 3KL4A 4JI2B 5AHRA 4DXHA 1NVVR 3H1TA 4UHBA 1X7GA 3NIBA 1GPNA 3CRRA 3GLRA 5LQMA 4O4HB 2K6GA 2OZLA 3WL6A 1CJSA 4IIFA 2WY2D 4AN0A 5EHZA 5K03A 3Q1KA 2E5FA 2JIMA 3WLAA 2VT3A 3KPJA 2K93A 3HY4A 3DEIA 4KYUA 5AIBA 1G0NA 1K5GA 1ZRNA 2G76A 4P2GA 1N9GA 2OLKA 2KG9A 3DULA 1AUVA 2OUIA 4L2IB 2P90A 4XWGA 4B3BA 1OT5A 4J07A 5BYAA 4Q82A 3HYCA 4ZT4A 4BO9A 5JARA 5LLDA 2ATIA 2XW6A 4LZOA 1G63A 2GLTA 3BRSA 3T3EA 2X5KO 1E79D 1N2CB 4D8XA 3NFYA 4CETA 3ZIAA 1WO8A 4AZTA 2CHEA 4EKNB 3RFVA 2BLNA 3IDQA 2R25B 1IG3A 2Y1LA 4OAOA 3EG9A 1VJDA 2FB9A 4Y1GA 4JNCA 1TT5B 4ASUD 4ARZB 4B4WA 2CL0X 1ORTA 1O6ZA 1SBYA 2O07A 2VJDA 3KTAB 4EGSA 3WGIA 4UM5A 2BMAA 3FOFC 3ZY2A 4HMPA 1A7KA 2HK9A 3LQ4A 4I2NA 4PYIA 2J0QA 2XDQB 4Z4EA 2AD1A 4W1PA 5CNIA 3VPCA 1I94B 4B3IA 1HYGA 4N5NA 3D6AA 4DT1A 3K9QO 2Y0DA 4R0MA 4N8SA 2Q7XA 3SY8A 3A37A 4F38A 3L8EA 3HLKA 1T5BA 2VK1A 2DKOA 1M2OA 1JQBA 3ELDA 1PT6A 3OTWA 3REOA 2VDOB 2ZDHA 1IXYA 1LW7A 3OZEA 2EP8A 1AS3A 1ZISA 4HGZA 4YQEA 5KNBH 4P7GA 2VWHA 3VJKA 4KHZA 3LDFA 4WFKA 4AB1A 2XMSA 5TF0A 5BVHA 3STWA 4RD2A 3Q6IA 1T8RA 3EW9A 1G20E 2GPBA 1E94E 2PLWA 1ZOSA 2X2EA 4TXJA 1IBMB 3ZHQA 2QNRA 2BFBA 5F2KA 3D6HA 1KHTA 2VCYA 2XUAA 3EUEA 3MJTA 1BX3A 3N07A 4GKBA 1S1CA 1OX4A 1SIUA 4AG3A 3EQ9A 4M1MA 3ZVMA 2D62A 2OD9A 1G8MA 2QGFA 3RSCA 1I9CA 2R4TA 3PYMA 1BA2A 3MB8A 4YI5A 4WNAA 5AYVA 5A2GA 3OLXA 4C05A 1TVKA 2NXWA 3JQBC 3DMRA 3U61B 3HLYA 2TECE 2GBLC 4BPGA 5DN9A 3ZH9B 4BJ6A 1Y6JA 4PQYA 3L6CA 1E7MA 3U49A 2J4DA 5JNLA 1PDOA 2MR8A 1VMEA 1ZOIA 2ZUTA 1P91A 1H05A 1VB3A 1WS6A 2C3UA 3RG6C 4ZVRA 1F9EA 3FYCA 2IYLD 2M6RA 3AFNA 1G0OA 3LFUA 3T7CA 4ENUA 1SXJB 1T15A 2KORA 2XPCA 3IOBA 4WZZA 4RMGA 4EL0A 5LOVB