1ZMBA

Crystal structure of the putative acetylxylan esterase from clostridium acetobutylicum, northeast structural genomics target car6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Acetylxylan esterase related enzyme
total genus 94
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.110 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1zmbA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1zmbA01
4H08A 1YZFA 3DT8A 1J00A 4JGGA 4TX1A 4I8IA 1BWRA 3SKVA 4JJ6A 4K7JA 4K40A 1VJGA 4NRDA 3W7VA 2Q0QA 4OAOA 4HYQA 4Q7QA 4LHSA 3DC7A 3BZWA 4JKOA 2WAOA 4JJ4A 4K3UA 4S1PA 1Z8HA 4RSHA 1K7CA 1BWPA 2HSJA 4OAPA 1ES9A 5BN1A 3KVNA 1U8UA 3PT5A 2WAAA 4JHLA 3U37A 1ESDA 1PP4A 3SLRA 1FXWA 2Q0SA 1WABA 1V2GA 3RJTA 4DEVA 1JRLA 1ESEA 1DEXA 1VYHA 3P94A 1DEOA 5B5SA 5CD9A 4K9SA 4XVHA 3C1UA 3DCIA 4PPYA 5HOEA 5JD3A 3MILA 1FXWF 4RW0A 5A4AA 2WABA 1BWQA 2W9XA 1IVNA 3HP4A 1ZMBA 3DT9A 3DT6A 2APJA 4Q9AA 4HF7A 2VPTA 4M8KA 2O14A 4IYJA 1ESCA
chains in the Genus database with same CATH superfamily
5AJVB 1O7JA 1JZTA 2VA9A 3Q6IA 3ZG6A 4QXMA 2ZRIA 4K1XA 5JAOA 4A6XA 1DBIA 2CXRA 2FPLA 1G291 4LYAA 2A30A 3Q1KA 3SQNA 5IUNC 1N6PA 1TI7A 5FRDA 4HQFA 3MMNA 2XODA 1MAVA 4S3MA 4D4MA 5BVGB 1PNRA 2B0JA 3JR7A 5FPSA 1QGOA 3WLJA 4HWOA 4ZVUA 4K03A 2GN0A 1QHHB 4D9JA 2H1CA 1Z13A 2YMMA 4HN4B 4OSEA 5K0FA 4ESVA 3U5ZB 2VYFA 3SEFA 2QMHA 4QASA 3ADCA 1POXA 1EFPA 1ZYUA 4XLTA 1BJRE 3UFXB 4Z2AA 1VP3A 1KEVA 4LK2A 3ZLVA 1I7SB 3G5TA 5IS2A 2P2GA 2A9KA 4KAAA 4Q9IA 1KY4A 1E7RA 1WETA 2Y92A 2AVAA 1Q3KA 4MYUA 4XQGA 4EH1A 2Z04A 3D3EA 3D8HA 4KK3A 5BS2A 2OTJP 1AS2A 1AB5A 2Z58A 4LDAA 5EHQA 4BKQA 4I4TF 2LTEA 2O20A 4S1NA 4KQ6A 4Z53A 2HJHA 2Z5LA 3B8HA 5JQGB 3RV3A 1T5TA 2C98A 1YIOA 4G0OA 4YACA 3SX4A 4BEBA 4M76B 1Z4QA 2WUVA 1E3SA 3WMRA 5AJHA 1QF9A 3CXUA 3O75A 2O1EA 3DNFA 3NTQA 4KSBA 3CZ5A 3MBKA 3NOXA 1IATA 3S2GA 3E15A 3VZRA 3ZGZA 4QOHA 1NF8A 4D3SA 4EKDA 1ZWKA 2J3KA 2LKCA 3EPJA 5JCOC 3OMWA 1GRCA 2WSSD 3ZK9A 4S35A 5DM2A 4IJWA 3HLKA 4CV1A 5FUYA 3AU8A 3DFFA 2Z1MA 1Q5PA 3SQLA 1HURA 1QO9A 3L3BA 2J5KA 4R9RA 2WAAA 5DZSA 2FUCA 5CDFA 4OB6A 5BYKA 3CH5A 5ALUA 3VGPA 4TN1A 3IHWA 4WCVA 3IQZA 1ZWLA 2E5LB 4F2HA 4B3BA 4L1KA 1PNOA 3QE4A 1CIPA 5BNIA 4EB3A 4ETNA 5KTRA 5CCXA 1A9YA 1WHSB 2XX3A 2H59A 3LQ4A 2NZXA 4P81A 4AZ3A 4KI0A 3B3QA 1W75A 1PUIA 2PMDA 3CG4A 1I1HA 1RMTA 4HG2A 1QP4A 1E1CB 1YUMA 4LA4A 4KLCA 1G38A 3NXSA 1Z56C 1Z7YA 3GCWA 1L4UA 1HEUA 1KH1A 2HWYA 5KX5A 4EDFA 3TEFA 5A4JA 4EHBA 1XK6A 4OA8A 5ELLA 4G4SO 4UNPA 2G9UA 4N47A 3RCBA 3T5CA 1WF6A 2O19A 1YHQP 1AE1A 4BZPA 2G0NA 2D7CA 4PLCA 4F7DA 2XNKA 3NGMA 4GQBA 3OIGA 4GZ6A 1FRNA 4MRMA 3HA3A 5TC4A 4AURA 4CW7A 1PJQA 2CT8A 4MYSA 4NI5A 3TWOA 1YQXA 1WLYA 1N3IA 2O0KA 3PNKA 5LL6P 3QUSA 2RHLA 3QWIA 5G4LA 5IEBA 3SC6A 1B6GA 3OPQA 2P7HA 3HY4A 5HHTA 4QAQA 1KO5A 2PU5A 3ZV4A 4RZ2A 3SZUA 4LJKA 1RXYA 3ZDFA 4R1PA 3CWQA 1ESCA 4HC4A 3O82A 3NOOA 4EVIA 1UJNA 2AXEA 4A0GA 4RJLA 5A04A 2WT9A 3CPWO 1VG1A 5I7UA 1Z33A 3VSBA 5GM2A 5EI5A 1NZJA 2W4IA 2VJNA 2ZJ2A 3TBKA 4JI0B 2HQOA 4HO1X 5BNTA 1HKUA 1Y5IA 2GN1A 2OGUA 3HSKA 4J0JA 4M0MA 5H9WA 1FLVA 1S01A 2HPHA 4PWVB 3PXXA 5CR9A 4Y2PA 4ARVA 5BV8A 1Y5MA 3OM1A 1V5IA 2LW7A 1JI3A 2DWQA 4ZCSA 1DQSA 1C50A 4RQAA 2RHMA 3W2FA 5HCNA 5KSWB 1UL1X 4EGSA 5HF8A 4QUDA 5J23A 1X9GA 4PNZA 4D9NA 1ZK2A 3RUIA 2O0JA 5DM4A 3FKQA 1ZXBA 4A0RA 1E2QA 4Z9XA 3KJXA 2WJ6A 2CZGA 1GDDA 2P2LA 1OYWA 3EWSA 4GO1A 5D3QA 1JHYA 3DVRX 3BDVA 5AVZA 1X8JA 3GROA 3QQPA 1EWRA 3EN0A 3FFBA 1M2VA 4AQ7A 1XEXA 1LY1A 4LHSA 4BTVA 2QUZA 1B0PA 4C4SA 1ORIA 3BXHA 4DDMA 4OKSA 1DKQA 2IODA 4PAOA 4M0IA 3UEOA 3U19A 3ZZ0A 3PPWA 1LX7A 5KSYA 5ADUS 1VMIA 2GK6A 2R8XA 1VIDA 3AR7A 3E1SA 2ZROA 3PEYA 3NDPA 1V16A 1EQAA 2RJNA 4B83A 2YHBA 3G2NA 2AXQA 1UBRS 2QDXA 1QGYA 3PRYA 4S2EA 1JT9A 3CLRC 4AKTA 3O92A 3WK4A 1GXGA 3NWOA 1KERA 4RJ2A 1E60A 1ZLYA 5ESXA 2ZUSA 1GILA 2EVWX 3N2LA 3OCJA 2MF4A 3Q6MA 4MVXA 4X6YA 4MH0R 4FGZA 3VZCA 2EZTA 1E9VA 1V7ZA 1XZPA 4RDHA 4BP9A 3QRWA 1MKYA 5A0VA 1PWHA 2HMYB 1PP4A 2CUNA 2EX1A 2X2EA 1GV0A 4OJKA 3GJNA 2QX6A 3MF4A 4J29A 1TF5A 4K5QA 2QM0A 1Y4DE 4P33A 3RBXA 3RU2A 4PAQA 3V4FA 1JDUA 2HLDA 3K96A 4Q3KA 4I3GA 4DUZB 1KI6B 1NRJB 2HWWA 5TGTA 3P4UA 3IP6A 3ETGA 3BXEA 4JEHA 1VG9B 3DVAA 2DC1A 3P52A 2PYIA 2XGGA 3CZAA 3QUTA 1P81A 1XPUA 2GZJA 5F35A 1B42A 3LX6A 4NF2A 5CLHA 2O8DA 2QGFA 1QCZA 2ZSHA 4RQBA 4RPIA 3LY8A 4UMVA 3ZGOA 3WGMA 3DKRA 2J9FA 1M8GA 1RM5A 5T8KC 3DQPA 4DADA 3NX4A 1XWWA 2DP4E 4IRUB 4WZAA 3H3FA 4O2BB 1COWD 1OYYA 1QCYA 2ZYTX 1GNLA 3QV2A 2Y3IA 1QAQA 3CRVA 4EFNA 2PY6A 3L49A 3R6GA 1QX3A 2FSUA 5CB8A 1P1HA 4R1TA 2HMWA 1DX6A 3GEIA 4PXHB 2GZAA 1ZH2A 3MJFA 2F55A 2QBYA 3TRJA 5CYGA 3A1TA 4PIMA 2IY8A 2WQ6A 1NQAO 4BO3A 3EY9A 1XZNA 3I23A 3GUHA 5HK9A 2Z2KA 3GK3A 2BMWA 4JBGA 5GIOE 1M6EX 1OCEA 1VLVA 3E18A 4WA8A 1OXTA 1R88A 5JY1A 3K32A 2CLCX 5DULA 1A9RA 4NG4A 4BB0A 3SHOA 2AC4A 4O02B 2C4WA 2C99A 4RPGA 2YS7A 3WP0A 2C3YA 1H94A 1WZCA 2G1AA 2H3HA 4WXMA 5GJVC 3BREA 1WZIA 1CIVA 4O63O 5D87A 3TFWA 3ZU2A 4X3PA 4DC9A 1NJ6A 4JVLA 2PA0A 5IJ9A 4B5KA 3I2JA 3WAKA 2NO4A 3QX9A 1SKBA 1JFSA 1S2LA 4M0UA 2RC5A 1Y4AE 2PM8A 5EXSA 3DB2A 4I4TA 1SUAA 3DZIA 3I6ZA 1EXWA 3IEVA 4MRAA 1BC5A 2O3SA 3ASYA 1CJBA 3UAVA 4GBGA 5ES4B 1XWIA 3GGJA 1DPGA 5CCBA 1E2KA 4QEDA 1O08A 3MMPA 2J1LA 3C3EA 3DWFA 3HVUA 1M34B 3DAGA 5EMJA 4CIWA 3KS9A 4JLUA 3ZGNA 5AVYA 2HDHA 3IP7A 4BGIA 4L74A 1KEKA 1B7GO 3PGLA 4XI9A 3MCVA 4G4IA 5I9BA 2MOKA 1BXGA 4N41A 3NIGB 3IS3A 3HTXA 4MB0A 2AC2A 4PE5B 2Q9UA 2H0QA 3O2SB 2IV3A 1UMKA 1UPCA 1SFRA 1AF8A 3U39A 4A36A 3NGXA 4TVOA 4X7MA 1FP4A 5DM60 4QOFA 5U9CA 5JS1A 2E5WA 1Z4JA 2YHSA 1Q0ZA 3OTGA 3GV0A 5KUTA 4DV2B 4YK7A 2ZS7A 1T9BA 4ZAYA 3ZR4B 4DCVA 4JT4A 1XLVA 3V46A 1FW8A 3O3MB 2CN1A 1GRNA 3IT0A 2Q6IA 4B6QA 4DR5B 3D64A 2NGRA 5D00A 2AX3A 3BGWA 2IIQA 5ARBA 2R68A 3ZXUB 3DEJA 4C7JA 3MYYA 4DLUA 1PYDA 2C2GA 3QP9A 3FB4A 4ECAA 4YV1A 3O8CA 1QH8A 2IVFA 2ZJ3A 1E5TA 3O4IA 1TUEA 1BU8A 2HMUA 2YN2A 2NXJA 1VE7A 3ITEA 2IF0A 1XQWA 4J0EA 2EIHA 1GUYA 3SX2A 1GUBA 2H4FA 6NULA 5FD8A 4O3MA 1NU6A 1HLFA 3GJ5A 4YAIA 1PJSA 4XARA 2O5EA 5HE9A 5L6MB 1MIOB 3W4IA 1HEYA 4C4ZA 2JB9A 4W9MC 5J2TB 2X2PA 2HZ7A 2VYQA 3RO7A 2EHDA 1ZX1A 1JDZA 1PTJA 3CKMA 4EYEA 6LDHA 4LE0A 6YASA 2H4XA 3LCRA 1UOPA 4KWIA 4OREX 4MS1A 1R64A 1PLJA 4IM7A 2XEDA 5T3YA 3GLIE 1V3UA 2PKQP 1WXGA 3R0QA 4OIFA 3ABSB 5HDQA 5KNBH 4FQ5A 3BCHA 4KIFA 1IM2A 1BCRB 2WKSA 4R71A 5IVPA 3B53X 1NP3A 4ILKA 2O2EA 4OO3A 3OZ7A 1G3IA 2ZWAA 3FWZA 3HS3A 2JFQA 3PS9A 4MAAA 1PS8A 4FMDF 4CUJA 1O0CA 3RR2A 4EHHA 1SG0A 3VNUA 4GVLA 1HG0A 1UBEA 1W6UA 1ZICA 2NUTB 2R751 1MENA 3CZMA 3F3MA 1M6WA 2HADA 4G67A 3IMCA 2WG2A 3DTVA 3GA7A 5DGHA 3WIOA 3ZHUA 2H2DA 4PBRA 4DJAA 4FYIA 5EQFA 4MWSA 5AW7A 3PNVA 3NWJA 3M5DA 4MICA 1R4MA 1CQPA 1WUTA 4BU1A 3E8MA 3E1GA 5TQ0B 1KK3A 2X0KA 3N8KA 5GZ3A 1UQTA 1IONA 1GG2A 2EZ8A 1J00A 1D1TA 2FE4A 2W58A 3B89A 2EKDA 3D7KA 2J8ZA 5EMLA 3ROPA 3RSZA 3TIXB 1C0IA 3VZPA 4YMUA 1U2GA 1N32B 2JBWA 2H63A 5DNWA 3CWCA 1PFGA 1YA4A 4RVHA 3QUCA 1RJ9A 3E53A 5L95A 4M0KA 3LQQA 5KDOA 4MULA 2BD0A 3HZQA 5CLJA 1N1GA 1Q77A 2A6PA 2A88A 3IUMA 3SGLA 3E3NA 2AR0A 3PB3A 2ZRMA 5ABPA 1ECGA 1IOLA 2GASA 1PV2A 5CPFA 4FCVA 1BXZA 2Q3BA 3MTIA 5IABA 3GLTA 9LDBA 2AG5A 4UULA 5ECDA 3W6ZA 1PZNA 1U0EA 5DLEA 1YZHA 1XT6A 3CQ9A 3VJMA 4E0BA 2OCIA 1EHYA 2DHEA 3KV3O 1JGTA 3H9BA 1CKEA 4GMGA 3NG1A 4O2RA 1NIPA 4ETMA 2ZDQA 3LP5A 3ZEAA 3CONA 3GEMA 4URFA 4BGVA 1D04A 5DXAA 5IJAA 3U80A 1OI2A 3LW7A 3VOAA 3W5CA 3TLAA 2Y71A 2A1IA 1TUBB 3PIRA 4XM1A 4D8YA 3OZGA 3NM5A 1I4OA 2XYVA 5ICCA 3AEYA 4NCAA 2KWLA 3NAGA 4G1FA 3OY2A 4GNRA 4V24A 3U1BA 3IESA 4EFMA 2RSLA 4UAGA 2VLNA 3LOPA 1RZUA 2D0PB 2QW8A 3R3XA 5AXDA 2PENA 5TS2A 2PX6A 5AVKA 1H2HA 4E07A 4YRBA 1Z2CA 3BXPA 4YJ2B 2OY0A 5FLYA 3SIWA 4A2QA 4JLMA 4B74A 1F8YA 4HVLA 1QOZA 2XKKA 4X7BA 1K68A 2IIVA 1J23A 1LLQA 3LM8A 3NVMB 4LMBA 2FI1A 3SOPA 4RPHA 3RVPA 1YZYA 1FVFA 5FDFA 4H15A 2IBSA 5FTJA 1Z0JA 1UNKA 3ULKA 2IYUA 4BAGA 1E4EA 1KGSA 1NKSA 3CCJP 1KS2A 2QTWB 4PTZA 4YCMA 1XP5A 5DWDA 1PR6A 2NXWA 2PL1A 3IDFA 4G26A 3UCFA 3LMKA 4TVSA 4W63A 2GRUA 4U2KA 3ZKAA 3G2HA 5F1OA 3H3JA 4TYMA 4ENTA 4WCFA 3O1LA 4JX8A 3QU7A 4H7FA 5LNK6 1F8FA 1G8FA 1Q0SA 4JI6B 1I32A 2R44A 4KB5A 3F6PA 1R9MA 4HX5A 4NBVA 3LDAA 4G09A 2FOIA 1I14A 1N9GB 2OCYC 3P9RA 1GZHB 3T0GA 1QZ3A 4NMWA 4TTVA 1IBKB 3HBAA 2GZ3A 3ZNNA 1XXLA 3VO9A 4MS3A 4EMUA 1YASA 1YUBA 1Q7GA 3UYKA 3MAGA 3V4VB 5B1SA 4N7MA 1JA9A 1S8AA 3E58A 1V6CA 1ZL2A 1ZJWA 1GZDA 4KGZA 3TM5A 2I0FA 4TYPA 4B7CA 3PFBA 4YCDA 2F17A 2FR8A 4YCSA 3K1JA 3LBHA 3T7TA 3WK7A 5HWSA 5BW5A 1L7QA 2YHIA 3ZLBA 4BO2A 2PBZA 1R50A 2MR7A 3GT3A 2Y99A 2M5RA 2PO5A 2VLQA 4R2KA 3E22B 4UTPA 2NXEA 3VTZA 2BWJA 4IDEA 3BMNA 3BD6A 1QO7A 2FB9A 1RLJA 2HCRA 3MM4A 3PI6A 1CQXA 1G2IA 5LZ7A 5AKXA 1YHYA 3HN7A 1LWOA 2IPOA 4FHEA 4QJBA 1Z4LA 5C0OE 1L4KA 4GG1A 3RS5A 3TQSA 4B2PA 3LQ1A 4XM0A 3RV4A 3AL3A 4FN5A 2GCGA 4G0ZA 5JIBA 1FTGA 4PZLA 4CEHB 1RNIA 1IAQA 1KK0A 1NN0A 1L5SA 3KSUA 4INZA 4J0DA 4LCEA 1MRZA 5CM9C 3TIGA 4DDKA 4FS3A 5J4KA 2ZZMA 5H3HA 2DQKA 2JFOA 4HJXA 4X1OA 2ZK7A 1M0SA 1U8AA 2GF2A 4LN1A 4OATA 4CVNA 1SOVA 3ND5A 4KQEA 1J7JA 2I7VA 2PANA 1Z4KA 4HZIA 3EEQA 3S2UA 3NJ4A 2H7VA 4DLRA 3U4CA 2IHTA 4DMGA 3VNVA 2QTAA 4GGPA 4HYEA 5D86A 3UAGA 4MIEA 2ADMA 4H16A 2FG5A 5EP2A 4DDWA 3PUHA 1I3KA 3H86A 3QLEA 3TPZA 1G21A 1V95A 2BOVA 2QK4A 5DYGA 5A3JA 4LY0A 5F5XA 2F43B 5LP6A 3CXRA 2L9FA 2VDLB 2CXTA 1PFYA 2B5OA 2VNHA 3N28A 1Y82A 5JFGA 3W2HA 4A03A 4MRNA 1GU7A 3KB8A 3ZJTA 1EK5A 1IWBB 2D7JA 2P1DA 3C6XA 3OIVA 3A3NA 1SB9A 1XG5A 3LA8A 3OZTA 3GCXA 4ISBA 4UARA 1ZQ9A 2ENUA 1NBEA 2OORC 4I50B 4KQMA 3WSTA 1PZEA 1WZNA 2GFQA 2R5WA 5EJGA 2R62A 3DZJA 2J4DA 4WDQA 3ZNPA 2W2KB 1EZ1A 2W37A 1O8BA 1U0OC 2E48A 2QLMA 4UE3S 2BKLA 4ZQCB 2RGGA 3E3AA 3VJKA 4DIMA 3H47A 2VZEA 4J8PA 1JIXA 1GRQA 4ND3A 3KOYA 1T10A 1BMQA 4PLYA 3HZRA 2E3JA 3SLRA 1F48A 5H4GA 3CUWA 1K6EA 2CBGA 4UUPA 3KYCB 3VQTA 5J5VA 4JP8A 4MA4A 4BVJA 1WJGA 3TNJA 4HXGA 3O47A 3ESQA 5C9ZA 3ANLA 1OAOC 1Y4UA 3E61A 2E7ZA 4LKRA 2HK7A 4HH4A 4YJ2F 5IM5A 2LD4A 1DTWA 5TE9A 3KQOA 1UBLS 2YY7A 4FGSA 4FSDA 3LPMA 5CHEA 2PV0A 3FSGA 1ATIA 1U7UA 1LDBA 4JJZA 4OGFA 2EFDB 2O4CA 3OEYA 2OO5C 3GDGA 1ZM7A 4WNIA 5EFOA 1E3WB 5TEWA 3UTCA 4F3RA 1PT9A 2YV1A 3IXQA 4Z86A 4G63A 4N03A 4DQ0A 3OQOA 2XYQA 4NE9A 1AUQA 2CVOA 4Q1CA 3T61A 4E5UA 4BNHA 4IS3A 2QTTA 4LQDA 1GPBA 3UGQA 1WU7A 4DMFA 3JX9A 3WDKA 3A4NA 3QF7A 4EY8A 2Z57A 3E0XA 1UDAA 1QQAA 3RYTC 2PJRA 3GN2A 3G5UA 4EBBA 1L5HB 4DZZA 2QW1A 3SR0A 5EYPB 1U9IA 4BB6A 3R3WA 1G6OA 5EXPA 3WYEA 2DY1A 4TQUS 4BO5A 1QIFA 3DE5X 3AOGA 1TJ4A 2CMFA 1YQQA 3HCOA 4Y1FA 3VPDA 4E1BA 1ZIOA 4X20B 1FC0A 3H1TA 2PZJA 1P2UA 4Q9KA 3KHTA 2V5VA 3VAZA 4MDFA 2JIMA 3ED5A 3QEJA 4L9AA 4HEA1 1IG0A 1T26A 5TV2A 2RARA 5G1NA 3W8DA 3HKBB 1KOJA 2VJYA 4EVRA 3QEKA 2GBLC 2P4QA 1XYVA 2I87A 1X3LA 4X93A 1NHWA 4IAOA 3W8EA 1RAGA 1RI4A 3BCSA 1E9DA 4OQ4A 4EPRA 1PR3A 2WIGA 4KRYA 5HMLA 2IU0A 3JCZA 2QY9A 2V9ZA 4MARA 1IFXA 3HRIA 3T5MA 2MYNA 3KLOA 5ADHA 4BRZA 4IBOA 3W1VA 1JEEA 4DQDA 3QNUA 5FYDA 2V7BA 1IJBA 1VLJA 4TKUB 4YDSA 4BKPA 4ZN6A 3CCQP 1P1CA 2YXPX 3H19A 1X1RA 1Z5PA 3IUYA 2BUAA 3JQGB 3LKDA 4U6SA 2GN2A 2YJ3A 3B2EA 1OI4A 1MG0A 4HXEB 5ED4A 2ZATA 3C16C 1QYDA 2CLHB 3KOMA 2HQBA 4REMA 4YP7A 4QD3A 3A4IA 4JJFA 3VDMA 1QIJA 1W8IA 1PFQA 5ALDA 1TM5E 3G2PA 4YP6A 3THXA 1WVIA 3H9QA 1W4ZA 2AZMA 3WLLA 3SZ3A 2PHZA 4IDQA 1FEZA 1Q0UA 4MQFA 4Q4CA 4HRXA 2VSYA 5JANA 1CUAA 1THMA 3UYLA 3H1EA 1COWA 1Z06A 4Q3DA 2FGJA 2VQEB 1P44A 3T5PA 1PEDA 2RHDA 4EEKA 2QSZA 2RI6A 1S1MA 2FETA 1LK0A 3D4PA 4YUXA 3AESA 3EXHC 4KSYA 5LLDA 5LQNA 2FRXA 1GA6A 2DBRA 3EC2A 2G7MC 3Q0IA 4HN2A 4CIAA 2TRSB 1T4CB 3DLAA 4JELA 5E3IA 3O73A 2VDWA 3AI2A 2V1XA 3OURA 3QUBA 1CK4A 1WOMA 3IT3A 3WKAA 4YIHA 4B3MB 1OWPA 2BHNA 1YFZA 3I1JA 3LWDA 5IAKA 3LFTA 2HBYA 1BO6A 5IARA 4CN9A 3EZFA 3SEQA 4AL4A 1E0AA 2CLKB 3KQMA 1O58A 1P3JA 4BDTA 1GGEA 2C77A 2PLRA 2AFIB 4XFDA 2JIPA 3HC7A 3AL0C 3EG9A 1RYFA 4QLAA 1E2PA 4GOLD 4DDVA 2ZUTA 3BDIA 4C76A 4OP3A 2BFPA 2O2XA 3MLEA 4M9CA 5E6SA 5E7MA 2P6RA 2LIWA 2GCPA 4IJUA 4EKEA 4X85A 1JQBA 1YIAA 4IV0A 4NATA 2GETA 2JKZA 2BTQB 3NBYC 1E2HA 3UWPA 1NR7A 1Z68A 2Q5IA 4C3VA 4FLEA 2BCJQ 1O6GA 3P2MA 4LYHA 1RAHA 4W9RA 4N5MA 4NFYA 3KWMA 3R7WA 2DJIA 3PWZA 3ZNOA 1QHHA 5BMOA 3K72B 3QYJA 1UKAA 1UEXC 4BO1A 3RLIA 3KEOA 1KZ4A 3EEFA 3H2BA 2VKTA 2J31A 1CS0B 1NRIA 1E32A 1AGXA 1MBZA 4NX2A 2WD9A 1ZD8A 1XDZA 2ZUBA 3JRWA 4MVJF 1JQ5A 2CJWA 2OGSA 3LT4A 4GU5A 4F4FA 3AU9A 5JYEA 1V11B 1OJ7A 3L1HA 3PQ7A 2QD3A 1FSPA 3CMAP 4KV9A 3B52X 4EABA 1C7EA 1SBHA 4DR4B 3DSRA 3GZMA 1JX6A 3GP5A 1G8GA 4ZALA 2H7XA 3OIYA 3ZCQA 2V3VA 4R1OA 4KQGA 5LQCA 2KPOA 3G9UA 3R9XB 1SVMA 3IAHA 4FZRA 3PC3A 3M1AA 1E2JA 2P9XA 1PBNA 3D7SA 3LUGA 4PANA 4RETA 3RVDA 3IT2A 4EJSA 1YR9A 4LYGA 4Q34A 1Y1SA 4FYYA 4Q7JB 4F4HA 5B1EA 3CC7P 2WIDA 1RRKA 2VPWA 5DGCA 3M1IA 2PBFA 5EUMA 1XRSB 3P26A 2IIBA 4NBKA 3UJ6A 1HXHA 1EVZA 3X1MA 1SOWA 3UVEA 4W5QA 1VBNA 3LSYA 1EUYA 4FKMA 4ARSA 2H3EA 2AUMA 4LZJA 4LSGA 4RHYA 2JLXA 4J2OA 4G0WA 3WXBA 3HJHA 4J4HA 1PJRA 2ZTHA 4QAJA 5FBLB 4LZZA 1OF1A 3KKNA 1ZVQA 2SBTA 2ZLBA 1PJCA 2FADA 1ISHA 3MEQA 1A50B 1WHTA 3ECAA 2OO5A 3PNPA 3W7BA 2FXIA 1SVLA 1WHSA 2VJPA 4UVHA 3IGFA 1TLLA 5HFJA 1B8VA 1B73A 4DG9A 2P3OA 3DHEA 2GVNA 2AZDA 4F1WA 4F60A 4YUAA 5K8CA 1R0LA 2ZRBA 3L41A 2GLXA 3S28A 5IUJC 2BH2A 1N8TA 1LBEA 4BLVA 1DAOA 2AN3A 3VU8A 1IBCA 2EDAA 5BXYA 1RMQA 5H3LA 4RD0A 3T8YA 5JSZB 1GZ7A 3EYAA 3UGJA 4AS1A 1RLUA 5EQJB 2Z2YA 1LVHA 3WMEA 2V59A 1LNZA 1SCUB 4YCBA 1T1IA 2WMOB 1P2GA 3TL6A 5BR4A 1OX6A 1JG3A 2XADA 4MRMB 4WJZA 1DDGA 4WJKB 4HI0E 3L8ZA 2CDNA 4HNGA 5LC1A 4ZO8A 1ODSA 4C4PA 1OFVA 4BNDB 3OG9A 1AF7A 1VPDA 2ZRJA 3R7AA 3SJ7A 3AC0A 1JPVA 1IJEA 1Q2UA 4N0PA 4Y2YA 2A9PA 3NJ8A 3AYXB 1OPXA 4LYEA 4N5DA 2QPTA 4QYMA 4GGMX 1A76A 3URMA 2AJTA 2WSBA 4ABTA 4MV9A 3LZ6A 4M8LA 1S2OA 1X2BA 4OYYA 1EFLA 5CH8A 2YQZA 3JYNA 3EZ7A 2QX7A 3UO8B 3A0RB 2HSEA 5AKYA 2NW6A 3HVIA 1TF2A 1G17A 1F9EA 3DAHA 3LO5A 1XVUA 3I01A 1Z7WA 2GLTA 3EGWA 4QTYA 4DCSA 5IAJA 1F2TA 2ACWA 4J1NA 4BC0A 5DN6A 2NX2A 2ZWMA 4P5EA 4UPEA 1WUJS 4EAQA 3I9NA 4KDRA 2PJZA 4C89A 4E5KA 1QHGA 2CNKA 1BE0A 4QBGB 4C0WA 5TF0A 4ENRA 5FNZA 5JISA 3TLGB 2F3SA 3ZE6A 2J3LA 3L8MA 2HF7A 4L95C 2B3TA 2H48A 4CM8B 5CX1B 2IT1A 3LDGA 4LZLA 5FCDA 2C2XA 4YIKA 1NI4A 4HGQA 3IKTA 1SHTX 1ZC3A 4I5DA 4H35A 3VV3A 1FTSA 1UMBB 4X63A 3Q5DA 4OQDA 3AF5A 4G23A 5AKLA 1JDBB 3KPYA 3OQIA 3AXTA 5EC8A 2VOEA 3EW7A 3A05A 2R6JA 4GLBA 2KGDA 1VFNA 3T7KA 5J47A 4D79A 2ET6A 2P62A 3SF8A 3TVYA 2GAFA 1Z2OX 4AKEA 4JT8A 2AKYA 1UC9A 2HIHA 4H08A 1OGJA 1VE1A 4KZKA 3UK7A 3IPCA 3K9GA 3UF0A 3UBTA 1VRVA 1FJGB 1P9NA 2R66A 4PPQA 1GLGA 3NTVA 1KTVA 3AV3A 5I4TG 5JAQA 1XKQA 2WWGA 4JOQA 4RD4A 3R74A 1F60A 1K5GA 2CC2A 4WIAA 3RROA 3W04A 5EEHA 1C4XA 4NS4A 5C5IA 1XTQA 3LC0A 4IIDA 3FBTA 5E4TA 4RTPA 1EESA 1Q21A 2FWAA 2WVJA 3I53A 3EZYA 3O21A 4GPIB 4Z99A 4AWAA 5JCXA 1V8DA 3RWOA 4HOYA 4RZXA 5CYOA 4O4HF 5C7IO 3GBPA 1GNQA 2R1ZA 4BVAA 1KMNA 1KJZA 3KB2A 1LGYA 2W83A 2DKOA 1U2GC 1YACA 2R7KA 4NTZA 2PH3A 3MRSA 5AM2A 3M70A 2WFLB 4UUOA 4F9EA 3H9EO 4OJNA 3QMPA 4JQZA 4LHYA 4CKYA 4KREA 2Z8YA 1CUDA 1JDNA 1C80A 2PRKA 1FZTA 1XK7A 1HQYE 3E84A 1SCDA 5A4IS 4Q18A 4F1KA 2JHFA 3PX3A 3JQ7A 4XJSA 4DJJA 1VKJA 2Y2VA 1QRSA 3L1JA 2D1FA 2O7SA 3E7WA 1P6UA 3HU1A 3T7DA 1OXBB 4C4XA 5IDXA 5G0UA 5CFNA 1SXJD 2ZYWX 3PGXA 4K6KA 2CGEA 3IAS6 1DRUA 4LDZA 2BGLA 1SCNE 1T8SA 2WK1A 4O2BA 1FCJA 3RC3A 3U49A 4C04A 3Q8LA 1H2BA 1VE5A 3D3WB 5LDHA 4BN0A 4D02A 2C8KA 4WASA 1B4DA 1ZA1A 4OL9A 4FFPA 3HPRA 4FWTA 1XLUA 5AK3A 2QJOA 1LDYA 3PHBE 4X1IA 1TKBA 1CJTC 3RS9A 1KPGA 1SA0B 4XX0B 4YCJA 4OK6A 3UB4A 2WM8A 2VHTA 2W0SA 3LCUA 3L9XA 3FYTA 3KLNA 3KTDA 4NAVA 4P4GA 2AZXA 3SC4A 4UEOA 2YJ5A 3CFYA 3TQIA 1I4DD 2DFTA 4MV1A 1USVA 5TPWA 4B7UA 3GDWA 4EB6B 3VDRA 1Y48E 1CEEA 1CY0A 2FQ1A 1E63A 1M72A 1T0UA 2B1IA 4IIVA 4Y2QA 4G5GA 2ZSJA 1ENYA 3HXQA 3LMOA 4F96A 4BTLA 4CKWB 2GZEA 5FUBA 1A9SA 1SHJA 2VP4A 1MNQA 2OK7A 3KJFA 3MTQA 4ZVNA 2XV6A 3TAUA 3D7RA 1WMEA 1X86B 4URHA 5F64A 2BFCB 3DBLB 3E7XA 2RGEA 4HAZA 1NJFA 2ZUWA 4EY3A 1I7DA 3N9IA 4G8CA 1VE3A 1YTUA 2IY9A 1E5LA 1U6KA 1GTSA 1FSGA 5A5EA 4NHEA 1R6TA 1TGVA 1YKFA 1FF9A 3L0OA 1CXZA 3OFSA 1XD9A 2HY7A 3RKUA 5GV7A 2AZTA 1MABA 2BEUA 3ZIDA 3BT7A 1IB0A 3CC8A 4L28A 3VM6A 3FH0A 3GVXA 2EDCA 4FDLA 1HEIA 2IYZA 5ICGA 3FD8A 3O3CA 1GGHA 3OOEA 3O38A 5CNMA 1OA1A 5BW8A 1W8DA 5EE9A 4HGRA 3SIRA 1ZMBA 3OUUA 4EYQA 2J48A 2CNWA 2P5UA 1TQ2A 4NONA 1C8BA 1BXGB 2F67A 2I2BA 5FFMA 2QVXX 3A10A 3WGZA 4AJKA 2Z6UA 2I71A 1JYEA 1E0SA 1RBMA 1U0JA 4YDQA 1HQBA 1P4RA 2E1RA 3KR0A 5FBQB 1VQPP 4GOXA 1P2SA 3J81A 5KNLA 3FTFA 1GADO 1RU3A 2EHSA 1YZFA 2ATXA 2FR8C 1M34E 3INYA 5J2UB 4DQXA 1ZJ6A 1WB9A 2Q1YA 4U0DA 4LBYA 1FP4B 3L7LA 2VQFB 1HOXA 2IHZA 4ZD6A 3WRVA 5A5FA 2FMFA 1GNSA 3B1FA 3H04A 5B3JC 3VPHA 3LDUA 4D81A 3LQRA 1Y37A 4MW6A 4D0RA 1C7FA 4MP8A 3HXPA 1YU9A 4ZCIA 4QFDA 3UGTA 2IRWA 2B0CA 3ONWA 3MCAA 4Q9HA 1PNTA 3SKVA 3L7MA 4F4CA 4IFBA 1Z2AA 2IZ5A 3DQZA 1GNRA 2JFPA 5B3JA 3FHOA 4LOIA 3P71T 2R47A 1VPTA 5AXCA 3VUEA 2XHEA 5EUQB 1ESZA 2B7CA 3NBUA 1W48A 1XNRB 3FW1A 4L3WA 1NIJA 1NBHA 4FFNA 3GJ0A 3IEKA 3OBBA 1GEEA 4F9FA 1RPJA 1M74A 4YHBA 5HBGA 3S70A 3GLHA 1SWVA 5IBCA 1IOVA 4CNBA 1V1MA 3Q85A 1YQTA 2FP4A 2X3FA 4Q1DA 2G88A 4Z3KA 2NTNA 5AXAA 4IILA 2O7VA 1EK0A 2YV3A 3VC2A 1YQDA 5K0LA 1HDRA 3G26A 1QHYA 2VJKA 3EPKA 1O4VA 2OV3A 1KO1A 2DPHA 3B2NA 4MS1B 3PLAE 2A14A 1A8SA 3VYUB 4JNCA 2RAUA 4BPGA 3GD7A 4EO4A 1QVFO 2AMLA 3WRXA 1O1YA 1EZ4A 1R2QA 4FLMA 3DDOA 3QEOA 1NDUA 3FYSA 3JYHA 3JWHA 1N3YA 4HAWA 3G6EP 2VJAA 4HDCA 4KNVA 5I48A 3QVWA 1LI5A 3U7GA 1NJGA 2V3CC 5DLQC 3LBAA 4L0DA 3I76A 1Z82A 3QF4B 1JJ2O 2XKJE 4FDMA 5K7SA 4KR2A 4OUKX 3KBOA 4YB8A 2WWYA 4O5OA 2HFJA 4C20A 2JGMA 5JS7A 5FI0B 1GZSA 1JHZA 3IUQA 3QKRB 4QE3A 4CU2A 1JEOA 1ONOA 1X1TA 2WNHA 3GMDA 4KOEC 2W2LA 3REFA 4MR8B 1U94A 3C7KA 4RK1A 2RGWA 4TTAA 4IV5A 8ADHA 3C3WA 3C5HA 3PDHA 4PAWA 5ER9A 3LECA 1FDRA 2I2FA 2JAHA 2PL5A 4QTXA 5EWMA 3W2TA 4B7ZA 5KYTA 2XZTA 1M6VB 3ESZA 1JDSA 3IERA 3WRYC 3DXZA 1KHTA 4NK5A 1T13A 2X8LA 3IDZA 5JPAA 821PA 3VPGA 1D5CA 1X92A 3COVA 3R75A 1UOQA 4KO8A 2XZ0D 1JNXX 3ESXA 3CLUD 4GUDA 3SDZA 4KIWA 3BE6A 3SKYA 5I6DA 3DG9A 1K7SN 1EQ2A 3H0KA 4TUYB 3V32A 2C31A 4IS2A 1D6MA 3RYFA 1IDOA 5F1KA 3OT5A 1VGRA 2Q7DA 4Q03A 4O4IA 3NWBA 4Q66C 2JGIA 1FOEB 3FFXA 5EWLA 4CT4B 1N8RQ 2BKEA 4PZDA 1F9AA 4WI1A 2VCEA 4A27A 2XUZA 4IVQA 4KXWA 4PXAA 4QGGA 1UT5A 2XJ9A 4G0YA 1JE1A 3K0FA 4OHWA 1E99A 2UU9B 1CUIA 1DOZA 3O2QB 2HZBA 3WMWA 3QXSA 2XMZA 1NLZA 2QVGA 2VJCA 1LC0A 3H5AA 2FLWA 4INAA 4M88A 5ALXA 2VK4A 5LMZA 3AVUA 2O8EA 4H7KA 4G4SP 2P0AA 3K70D 4GXQA 2RGBA 4G97A 4MQ6A 1K7FB 1ZNVA 3IALA 4URVR 3A70A 3CUEF 3I4CA 4WKOA 1GPUA 3WK6A 1C9YA 1HDOA 1TK3A 2XT9A 1P33A 3OZVA 1KDOA 2D0IA 2QL5A 4HDRB 1YRYE 4Z9BA 5IFKA 4LVOA 4UKDA 5TX7A 1YR6A 4KO3S 3Q7RA 4I8XA 4TRNA 3TOSA 1NBOA 2OHVA 4JB8A 4JDUA 3MGCA 4KTVE 1KMMA 3MPUA 4XVUA 5M5BA 1YOVA 3ELWA 3PF9A 2AXPA 3GPCA 3AHJA 2PXHA 3R3UA 4HBGA 5K45A 2XT0A 1YNSA 1FY2A 2JIDA 1ZONA 4MB6A 1UMCB 4Z8YA 5AW3A 4HH1A 4CKBA 5FTKA 4HTFB 1PDVA 1TCBA 4Y9RA 1RWWA 3PQ6A 4RHTA 3SEZA 3V8BA 1L7RA 2Z8XA 3DYIA 1GFSA 1L7PA 5J9FA 4CN8A 5K3OA 1I7NA 1UEIA 4NOMA 3WMXA 2EW2A 4J0KA 2I4OA 3I9KA 4S1PA 4WCFB 4V2UA 1DWUA 4TS1A 2COUA 2OESA 3BMCB 4JBXA 3N2YA 4PCLA 3JQRA 3K0EA 1ZH6A 3GIDA 4EPTA 5C8ZA 3WVNA 1Q7CA 4Y1GA 5B36A 4F85A 5JBIA 2IS4A 4U2BA 1SHLA 5CDYA 1L7OA 1YE3A 1YH3A 5CXSA 3VDXA 4AF6A 5KYXA 3CVWA 4JITA 2PMFA 1QP7A 1BE1A 3PUVA 1N6IA 3BCUA 4JS0A 2OGZA 1PI3A 5FEMA 1YRBA 3U3KA 5GVRA 4MRTC 1E66A 3LFHA 3SQMA 3U1TA 4MGYR 3WZMA 3OO1A 2YNMD 4IEFB 4F5DA 1LTHR 2WU4A 2HF9A 2CD9A 1G7SA 3RS8A 3SHWA 2QRVB 3GKLC 4JBYA 2KR5A 5HK8A 5FADA 2CD7A 2GBLA 4R5MA 4BBPA 3LWZA 4Y8VA 4WLVA 1EYZA 2C8LA 2HRDA 3PGA1 4PZZA 1EGAA 3F3KA 4M55A 2LNDA 4XDYA 4RQTA 2PWAA 2NZUG 1F0KA 3AW9A 4JQSA 1GP2A 2JH3A 2FCRA 5A7FA 3WX0A 4Z7JA 3U3ZA 3ZY4A 3I5MA 4D80A 1QKIA 1XTTA 1NDHA 1R5BA 1XAIA 2ZI7A 4O8ZA 1Y8QA 2R60A 2PL3A 2WF8A 1FDIA 2F1OA 1TEZA 2A5YB 4Q7EA 5D01A 3OZEA 3HCEA 4QJ5A 3WL3A 4A0FA 1YZLA 5B57C 1G20B 3CNQS 3I6BA 1FUYB 5CA1F 5IC4A 3ACDA 4FGJA 1ZR2A 2YWBA 5BMVF 1GV1A 3QU5A 3PWTA 3HXLA 2WFMA 3H1GA 1XP8A 2GVZC 3CBQA 3BMOA 3PQ3A 4JL5A 1BGVA 5DIZA 5TMEA 5JD3A 5B64A 2JRCA 4RKRA 1PFUA 3NI2A 4C30A 4DM4A 3ZH2A 3NORA 2BLNA 2F8LA 4FYXA 3G8AA 4JQCA 4B71A 5EIXA 3NDBB 8ATCA 2AR9A 4DM3A 4Y0NA 4F45A 2NAPA 4A2CA 3OW2O 3LXMA 3GLFA 1L5YA 4INOA 5IT9A 4OL0A 1UPTA 3MT7A 4WOJA 2II6A 2REBA 1AKYA 2NU6B 3G02A 3EOBI 4UDOA 3W5JA 1FA9A 4B9AA 1AY0A 2F43A 4O5AA 3FB1A 3TRIA 3ECCA 1KEZA 4DMHA 2WTUA 4M1WA 5K4GA 2ZVJA 3WIUA 2NUPB 1UC5B 5I7OA 3PNMA 3VSCA 1EJ2A 4B8WA 3CR7A 4JYCA 1GZ3A 1HBJA 4P1ZA 1UIRA 1LQ2A 5AJXA 3OTIA 1QVAA 4YFVA 2O3TA 1A8UA 1G6KA 3K9BA 2OWDA 3IP5A 4R3NA 2VZ9A 1I30A 4C6TB 5B6IA 3QFRA 4K26A 3ZNQA 1EWQA 1E2BA 1V8PA 1IQRA 3WNZA 3ZI0A 4EKIA 1WXDA 1KF0A 3C24A 1UBUS 1QK5A 2M2IA 3IVXA 4UEQA 4ZV4A 1NVVQ 1Q15A 2V9CA 3L1UA 3QUAA 3DGFC 3EQZA 3K0AA 4QA9A 4Z51A 2ZJAA 4OM8A 4RA6B 4ER0A 1RRCA 5L45A 3PYXA 1ZU5A 2EZUA 1SUPA 2IQIA 2A33A 4YECA 1CVIA 1YVUA 3OQHA 4EBFA 4EIWA 4UMEA 3WLPA 5JSQA 3AEQB 3UCXA 3T6KA 1R66A 1ORDA 3FPHA 3KWLA 1A98A 4JKOA 5IEJA 1G8HA 3P19A 2FY8A 4BYGA 1F2UB 1RAEA 5LOVF 1S4QA 3QKTA 1U4SA 3PNYA 4JJ8A 3CE7A 4RSHA 4XIYA 4LHWA 4Q3AA 4KO4S 5KIAA 2XYRA 2GKOA 3FSEA 1LPBB 1H9AA 2N3ZA 1O95C 5DXJA 1RC8A 4DCGA 2HA0A 2ECKA 5HGJA 4DSOA 2N1BA 3RIXA 5BN3A 1TJNA 5DN6D 3MB5A 3WGQA 2PMBA 5COAA 4EELA 3LNCA 4P2BA 4C7VA 1VMAA 4NV1A 2Q6KA 3TS1A 4J6FA 4CI0B 4D9HA 4ZZ1A 5AW6A 3C3BA 1PCXA 4FEYA 3H7IA 3V8VA 3ORRA 2FPXA 2OV2A 3Q10A 4N8DA 2VAMA 3QNMA 5LQRA 1YIJP 4Q1EA 2QVBA 3BMQB 2PRIA 3RF6A 3RIMA 2VBGA 4HUTA 1TB4A 1GKUB 4TWJA 4CF4A 4XOIA 4OLHA 5EYPA 2C92A 4O0MA 3S40A 3B4QA 5A03A 1Q1QA 1RYDA 5KMGA 2W6JD 5JRZA 2XCIA 2Z1NA 3FJ1A 4K0RA 3TG8A 1HUQA 3G85A 3P27A 3Q3GE 1PEKE 3F3YA 4QDTA 1WVMA 2B99A 3D8SA 4JP3A 4ZYTA 1JVNA 2JFYA 4DG8A 4GPD1 4G4JA 5AM3A 1DUVG 3D3QA 4U02A 3WO1A 3FPLA 2N1MA 1KRHA 3K9WA 3DZGA 4HGNA 1J97A 3N74A 2B8TA 4YAJA 3A1SA 1Y4ZA 2XA9A 4II3A 5SZJA 2PIAA 3ND9A 1X0XA 2ROQA 1RYZA 4XJVA 5JG7A 3I04A 3OIDA 3R6WA 2IWRA 3CKKA 3EXEB 4FFBB 3RG6C 3GLQA 3RT9A 4CYMA 3LQFA 4Q4AB 3KVVA 1A9XB 2YWGA 3OPYA 2LZ0A 4II2A 4OMDA 4F91B 1SXPA 2D5BA 3SNKA 4MQBA 3JD3A 2FKNA 2R1VA 3MJ4A 4MWCA 1JA1A 2QVLA 3ZJ5A 2OLJA 3B3FA 3HJAA 1QR6A 3D7MA 2XWPA 3IKLA 1NTRA 5B2EA 4V1CB 3LVRE 4BMZA 3GJQA 4F2GA 4EVQA 2DWCA 3L77A 4U39A 4RX1A 1YHNA 2GPTA 3C1OA 3W6OA 5C8VA 2CVQA 2Z6AA 3C3PA 2XQFA 3NWPA 4DLSA 3C4QA 3HKEA 1CQZA 3G21A 4MLZA 1GY8A 4HS9A 3U3RA 1C1DB 2HQRA 2DTXA 1YUNA 3DR5A 4MJ3A 4QOSA 4CUZA 3WNVA 1P91A 3X43A 3MWEB 4WGFA 2GBPA 3RSLA 4HLUC 2ONCA 2WNSA 2JLAA 1SC6A 4U1RA 1LPMA 1GTG1 2VHJA 4JBIA 4AD8A 4RV4A 2ZXUA 3LS2A 4JP2A 4J2TA 4MRSA 3ZJUA 4PZPA 3MOGA 1DQRA 2EQ5A 1K0FA 4EECA 2XCOA 1EKXA 1EHIA 3I9LA 5DGIA 5GINE 1HOTA 1YJBA 3WKCA 2VXCA 4HLCA 4LYJA 4BHTA 1UBMS 3QYFA 3BH7A 1PR2A 2RBKA 4FVTA 4MP6A 1UJ2A 4D44A 2FFQA 3ZVRA 2G70A 4KUEA 4IGIA 5DW0A 4EJMA 2DERA 3QKWA 1VJGA 2AFIA 5EJMA 3PICA 3BE4A 3GNQA 1G4UR 2K2QA 2ZE6A 1HT0A 2P4SA 1L4EA 1NN3A 3C5WP 3MCTA 3Q2IA 3P9XA 1G66A 5CHYA 4BMSA 4C1NA 4DILA 1SXQA 2Z8YM 1LLFA 3H5WA 1Z73A 2ONKA 1VJ5A 3K8ZA 2YZKA 2PKYX 4MVJA 3SI7A 4OK3A 1CY6A 4KLAA 1FQKA 4L9WA 4G8DA 4WK2B 1XRPA 4M86A 3KFVA 5KJEA 2F8MA 2FSHA 2I3ZA 3A1DA 3CT6A 4I9UA 4X8LA 9LDTA 1WVGA 2FGKA 3HCBA 4GMDA 4MW9A 4OU5A 4AJEA 4WZZA 5JHGB 4F37A 1EAYA 3FR8A 3RJZA 1Z7BA 3AHCA 2GMWA 5EZSA 3PFGA 1IJKA 2BGNA 1VKOA 3JQ6A 2PJDA 2QD2A 4MCHA 3L6EA 4GLFA 1C41A 2Q7OE 3OKCA 3T4UA 2A57A 2QRKA 2ZRPA 3QFSA 4B09A 2C20A 2RB4A 1QIHA 3JS5A 4NJEA 2QRNA 4A1OA 4EYOA 5K09A 3EXFA 1IIBA 3A6ZA 5F3WB 4QQKA 3T0FA 1DEHA 1E2DA 3F9RA 3E2DA 1D2GA 5CB6A 4NCIA 5A62A 1Y1LA 1DAFA 1HM5A 2JASA 4I81A 3G6WA 2FRDA 4I55B 2K0YA 1BH6A 2G28A 3OPYI 2C0CA 2FPUA 3WB0A 1PLKA 4FYPA 1JQKA 3U1VA 1T36A 5TXGA 5LR6A 2F8TA 2MVUA 1CZNA 1XYYA 5CYFA 5EE5B 3ZIUA 5FX2A 1GT6A 4XWWA 5B37A 2VAPA 2O8VA 3F4LA 4J91A 3SSAA 2QQEA 5EPEA 1FDSA 2GJ4A 3PHLA 4RSMA 3L8YA 5IJXA 1RZRA 2WU8A 2GZRA 3CM0A 3QX7A 4BLWA 5LQJA 5FL7A 2FR0A 3ROKA 2YZ2A 2PNFA 3FZEA 5HJ7A 3G7SA 4ZU1X 5I5EA 3E9NA 2E89A 1JKIA 2R7MA 5AKHA 4C03A 2PQMA 3KUCA 4P7FA 4OI1A 1EVQA 2A5GA 2I2AA 2RCYA 3GFSA 4EHJA 2YNMA 4BRSA 1W2HA 5FIUA 3W9YA 5CLFA 2C1ZA 2HRBA 2VJDA 3EZLA 3MRVA 3PQFA 4QM6A 1E5XA 2B8EA 2XGJA 2WM3A 1MORA 2FPIB 2FX3A 3GZNB 2D7DA 2QA4P 2WWFA 1O95A 5CTAA 4DBLC 2CHUA 1QPGA 1MOSA 2IC5A 3MOSA 4NOLA 4WTOA 3WWOA 1Q16A 5FUWA 3TOXA 4B8YA 5BYJA 3UHAA 3I8XA 4DLWA 3OUZA 3O4VA 3BRCA 1SO8A 1MF7A 2N0SA 5KHLB 1JVSA 3D6HA 5MFZA 1KO8A 1UODA 2WG0A 3KKMA 1R8XA 2B4RO 2PMCA 2QLBA 3D3NA 3D3KA 3MAJA 3O93A 3OQVA 4RS4A 1MHTA 1VP9A 4LTNA 4M6WB 4JR0A 3RSOA 4MZDA 3GNLA 1XZKA 2ZSBA 5ILQA 3NASA 1HV8A 3HM9A 3K1TA 1CC1S 2VJOA 1EXNA 3L0CA 3CEJA 1ZCBA 2HHJA 3BM5A 3HNRA 1R74A 4WINA 1L5LA 5JDIC 5ADWA 4CDNA 5E1OA 1ABFA 5JNLA 5JSHA 3HZHA 2PEIA 3LRPA 2LIVA 5JLAA 2PRSA 5KSZA 4KNYA 1WDWB 1FX1A 3HYLA 5TT1A 2HMSA 3N6RA 4NBWA 4ZGWA 1VGVA 2NO8A 2YFQA 1CY1A 3CEPB 2BKVA 3VU9A 5EIBC 4A8JA 4BJ5A 1Z5UA 1XDSA 4U2GA 4EG5A 4RADA 3K5WA 4MQEA 1EFRD 1KKLA 3GDFA 2HAEA 3NH9A 3HWX1 4TKVB 1P1RA 1K4MA 4AZ3B 5F21A 3CTPA 3H97A 1UQUA 2GT1A 5AK5A 3WK8A 2GEBA 1ZHHA 5DF1A 2RHCA 4LDPA 4L8WB 1VLHA 2EIXA 3RVOA 1DIGA 4KI7A 1MMFB 2I6QA 5JYCA 1F2TB 5KWVA 1M1ZA 4DCMA 1MJHA 1Z5WA 2FW1A 4JWKA 4RFLA 2AN1A 4TWZA 3SIPA 3S2FA 5JS6A 1I6MA 2C07A 2H17A 2PX3A 4TTJA 3KU1A 3H8SA 4EYKA 2CE7A 4GQIA 4IQFA 4W99A 1JLMA 4TUYF 4NFHA 3OJWA 3CLTC 4YAGA 2A7QA 3FOEC 1VIYA 1B6SA 2OZPA 3K6RA 5K8VA 3EARA 3SYLA 1T25A 2GZIA 3IV6A 3LXRA 2OAGA 1RQLA 1SVSA 5DRTA 4NXNB 2Q5HA 1YIDA 4JJ7A 4WWHA 4RYLA 5IT5A 5JV5A 2RJ3A 4PX3A 1EIZA 2IEGA 2R4TA 1YT5A 2GCIA 2QTVA 1IMOA 2G7ZA 4QDZA 4I0WB 5AHOA 3MXTA 4C0XA 2HA3A 4CIDA 4EHKA 5E8RA 6GPBA 3NVKI 3K2IA 3M2TA 3R20A 1C3XA 1MDBA 5JHHB 1WA5A 1Q0RA 1QJ4A 1WUIS 4P58A 4XCQA 5COBA 1PX0A 3W4KA 3WWZA 4HYYA 4XAQA 4IZIA 4AZ0B 5B7GA 2FMIA 2RGUA 2V45A 3MWFA 2ZOSA 3JAKB 1E4OA 3IH5A 1EHCA 1ODIA 2IF2A 3FBWA 2QIPA 4BPFA 3IUSA 1H8HD 4YV0A 2H1RA 2QG4A 2VJMA 1QGAA 3MJVA 1KY5A 5BW4A 1M73E 1A9ZA 4TN5A 1J56A 1BTOA 2QU8A 1LTQA 1N2GA 2SKCA 1TTPB 3ENKA 2KG6A 2SKDA 2ZWPA 2P9TA 3KWFA 4W9NA 4EKYA 1G21E 2C7VA 3HA7A 4JC0A 4QOIA 5GP1A 2HN9A 4BEWA 1ZNWA 4IHKA 1AXEA 3DMHA 4ZO7A 1G5FA 5KYUA 4KX5A 4OHBA 1T0IA 3NPMA 3QVLA 4RIIA 4WLUA 1ZR4A 3AY0A 4OBEA 4EB8A 1EVLA 3TRDA 1UDRA 1SR8A 3D8UA 3O5AA 3PX2A 2P3SA 3OU2A 2NTYC 3AQ4A 3ZBTA 4UDXX 2JGKA 2VPTA 3I1FA 3WRXC 4EKGA 3A1FA 4GKJB 4PH0A 5BO5A 3RS4A 2WV9A 3L4SO 3HV2A 3W3AD 1LJ8A 1L7AA 2PS0A 3JQ7B 4AJPA 4CM3A 3CVXA 1CX9B 1DT3A 5ENZA 3DS1A 1GCAA 2PUVA 4WW0A 5ARDA 1BH2A 5EN4A 1DQPA 1RACA 1M1NA 1BKYA 4XTRA 2FE1A 3KEQA 4DDUA 3LY5A 1YBAA 1Z9BA 3D59A 1DKLA 3I5UA 2JU2A 2XITA 2X0DA 4PSUA 1NSFA 5BOVA 1ZXLA 4YI5A 4CUKA 2MSKA 4URYR 1TUGA 4OJMX 4WZBB 3HUDA 3NETA 3ORHA 2IV2X 3EOZA 4B44A 4EUNA 3W6NA 2XF8A 4RGVA 1XRJA 4D5GA 4QYXA 2O5CA 4WL0A 2VF8A 4BTEA 1IN1A 5F52A 2YRFA 1YS6A 1O6BA 3N70A 4X1IB 5KCZA 1AQJA 4Y2JA 5AM4A 4CF5A 4MV4A 4BVHA 5LZ2A 4FNOA 1GSAA 3T7IA 1QC5A 2PXAA 4PCAA 4CF6A 1AU9A 5LQKA 4UASA 3WK5A 2YDXA 1YF3A 1A8IA 1OY1A 1ZM3A 2OV1A 1XL0A 1BHSA 1WY7A 1KI6A 3ZW7A 5TPWB 3RGWS 1WQ3A 1U65A 3I0MA 3L79A 1OR5A 1OJLA 3PD7A 5EHNA 4MIKA 3V1KA 1K8AQ 1T0BA 2OHJA 5ALFA 4DV7B 1TMOA 2YNMC 3T4EA 3VH2A 4QTZA 1E1KA 4GZ3A 3IIJA 4RKEA 4CKWA 3NHWA 1U0SY 3NS7A 2IEAA 3SF0A 3AJEA 2Z3VA 4OGGA 4N49A 2IEDA 4D3YA 4PICA 5AKIA 2J9FB 1BXIA 4Q4JB 2NU9A 3NTXA 1GKYA 2QVCA 2H2FA 4I1UA 5BUCA 4JEIA 3KKZA 1N25A 3Q3JB 4QQ8A 2BAGA 3UAZA 1LX6A 5A05A 4PTLA 4QQFA 2A0WA 3AIKA 3HWSA 1SRRA 3EHEA 2HU5A 2CQ8A 5DT2A 1LH0A 1Z4NA 4DBVO 5CEFA 1E77A 3ZU3A 4HB3A 1Z0SA 5F51A 1EX6A 1FTNA 2R79A 1LK5A 1GTJ1 1S4MA 3G0IA 4HRYA 1N78A 4Z6KA 3L0BA 3QBEA 4HBZA 1YVEI 1W88B 1UAYA 2H1SA 2LDBA 1RRPA 2F4NA 2P75A 2QF7A 3A37A 3BHJA 3NBKA 3OQBA 4M2LA 4MW0A 2JJ1A 1UFQA 2GYUA 4QPCA 1W4BA 2BGWA 1K08A 3HYNA 2YW2A 2ST1A 3WTBA 3PUXA 1NXPA 5FOTA 1C1HA 4B6GA 3ZDQA 4L7VA 1EE9A 3WDLA 3A9CA 1FW6A 2G9RA 3IOYA 5J2UA 1G60A 1QLWA 2Q1WA 3L5OA 4L0QA 4WA7A 3RYHA 4YRDA 2D74A 2WKPA 4JVOA 3KKEA 4OJQA 4AJ4A 4MWDA 1GQFA 3NONA 1KU6A 1ML4A 4F3KA 5JRDS 1R7RA 4E1VA 6PFKA 3MB8A 3X1KA 3AMVA 4ZJZA 2LPMA 4TVBA 4Q7LA 3QX8A 1Q7BA 1RC1A 5ER6A 3BRQA 1QIMA 1GWNA 1ZK1A 4ARIA 2WT8A 5CD1A 2P5TB 3CRZA 4I4TB 3BSWA 4CIYA 2J6BA 1W2BO 3IDOA 4IOKA 1JHVA 4PYQA 3KQNA 5I4KA 4BCDA 4KW7A 4IDBA 3MGGA 5HQ3B 1W36B 4N65A 1W581 2IH5A 3MTDA 1PJTA 2NADA 2EARA 2BN4A 3BAZA 4ZDJA 3BJRA 1SIUA 1P1IA 4UHJA 3ZYZA 3PFKA 2YCBA 2Q5LA 5D3MB 3RDPA 3AGPA 5ITZA 1IZ8A 3J7TA 4H0FA 4WFQA 2I4TA 3H17A 1HDZA 3K31A 2M98A 1KGDA 2HWUA 5FNVF 1PR0A 4DR6B 3PXUA 4KOAA 3BQ9A 3GBSA 3L84A 1T2FA 2CFTA 3W8RA 4YCLA 4FZJA 4YJ3F 4OSPA 2V0GA 4A6PA 3TRFA 4RABA 3ZK8A 3U43A 1RHRA 4LXHA 1H4QA 2BHTA 3KP1A 1B3BA 2QG6A 1P2BA 3QXHA 3PHGA 2VWQA 2ZJ5A 3MJEA 4WBXC 1NVMB 4CQMB 5HRAA 1EFAA 2FQXA 1U1GA 2HRRA 4M0DA 2OBBA 2VP0A 1E79D 3PJEA 4MR8A 4N7JA 2JD0A 2FF5A 2PUJA 2F9FA 3DMTC 1IHYA 4QC2A 2G77B 3ZKWA 4LMRA 5FBHA 3ANMA 4Z0TA 2QRLA 1G5TA 3FYCA 4LE2A 5JVDB 4G1CA 3CNHA 4BMOB 4WUVA 5IHXA 3TE7A 2QUIA 3Q7SA 4L5CA 5EJAA 3EG5A 1OZAA 5A0TA 4LAFA 4GAEA 3BA1A 4DSAA 2ZUDA 3Q9SA 3NKLA 3FN4A 5FUVA 3BFPA 1H22A 3PCXA 4MITA 2MJLA 1I9CA 3LG2A 1UDWA 4HJRA 4R98A 2AS0A 3LCVB 4Z4CA 3S2SA 5CGZA 3G2IA 2AI1A 1NX9A 4LWZA 5AVQA 1OE0A 4QHYA 5JZVA 1PR1A 1TM3E 3RYFB 1KQSO 4PVDA 3KSBC 1UBKS 2HV8A 4TV9F 4KYIB 1Q22A 4WOBA 3FRIA 4Q39A 3RKRA 4R8VA 4O4IB 2COKA 2H29A 4KE6A 3LDHA 4EZBA 4PN7A 4BVLA 1JF8A 2XKBA 4IIJF 1Q74A 5KVQA 1NYRA 3G0GA 4BYMA 1MX9A 5CMLA 1TW2A 3OZIA 4FOPA 4B0OA 1DE0A 2OGTA 2NYRA 1T4MA 2ODEA 3AVOA 1AXRA 3GW8A 3DC2A 2WVAA 5EHXA 4EHLA 1BDIA 1H3EA 1UM9A 421PA 2IPLA 4EI8A 4EFKA 2Y2UA 2IYEA 3D5QA 4Q3BA 1AA9A 2E21A 4IKPA 4L5AA 1U9IC 4RELA 4H77A 3PHIA 1Z25A 2Q2QA 3I92A 3AUFA 3EVDA 4QGAA 4UTXA 2W7TA 1VCOA 2UUOA 4GEKA 2DGYA 3QEMB 4JI8B 1YRQA 1QIKA 1L0IA 1JLHA 3O91A 1M2GA 4G5XA 2N5IA 4D4HA 4M89A 1A2BA 1WCIB 3IELA 3UWDA 4YXWD 1BQ3A 4H1HA 2R00A 2VLPA 1JLSA 3Q40A 3VYVA 1DAKA 3LDFA 4JSTA 3LUBA 2GNAA 1AKEA 3B9BA 1F1JA 2V9PA 1NY5A 1UMDB 4UFOA 3W8FA 1LPNA 5BN4B 2K87A 4R9UC 4G6ZA 2J3MA 4HQNA 5TEVA 5CFZA 2PX4A 5K4HA 3UWSA 2QPOA 5CK5A 3UUEA 4C3OB 1EFRA 2GZDA 1RWXA 3N0XA 4UBOA 4LRYA 2HYDA 5IK2A 1VJCA 4ZMRA 3EZGA 5ELXA 1WCWA 1NUHA 3SXUA 4U2FA 1GN9A 5E3JA 2GBGA 3UA3A 4CMEC 1G2QA 2BF4A 3BQNB 2DHCA 2RBGA 5HVNA 4BQSA 3ZY2A 3ROMA 4R8LA 1C8LA 1K2WA 3BTVA 2B4QA 2I8AA 4E7PA 4PGHA 2EKLA 5AO9A 2DSNA 4GGOA 3VNBA 1KDVA 4FT2A 3GGSA 1B2RA 2CL7X 2D59A 3ISVA 4CTJA 4F4IA 2DQSA 4PYOA 1R15A 3B12A 3LLMA 1C3OA 1RWOA 2IP4A 1XJWA 1LI7A 3EQ9A 1HTBA 3A36A 1EDDA 1R12A 2I9PA 4QL3A 1PJLA 2X9GA 1CQIA 4O1MA 2IYRA 4FMBB 3PPIA 1H5QA 1WB6A 1G98A 3ZLTA 2IJGX 1HY8A 2EATA 3FF4A 4LHVA 4ZQFA 3NMUF 5BWLA 2AWNA 2RIPA 3FKSD 3RIYA 4YMGA 1C9EA 3HU3A 1WQ1R 3GY0A 3QLJA 1Z22A 4XUGB 2OQIA 1REQB 2VHCA 1QCCA 1QUEA 2KG8A 2IK8A 2DBVO 2X8WA 2X7JA 4CKZA 2C7RA 4GRDA 1XA0A 3MSXA 4H4CA 1ZN7A 2ACEA 4MYRA 4LZAA 4TLBA 4ZI3A 1JQDA 1PL8A 3B7PA 4ZHQA 2IZ1A 3NKFA 2ONJA 2HCJB 1VHNA 1M8FA 3TIVA 1E2UA 3IAFA 2FWRA 3C6ZA 4BAUA 5J58A 4QODA 1CQWA 4E3ZA 2QNRA 5IX8A 1BDBA 2BDUA 1FQJA 4GKBA 1BDMA 1PZGA 1RKVA 4DEYA 2PD6A 4M46A 2EJUA 4QOGA 3KXIA 4G3XA 3FLAA 3IQIX 1I6LA 3PFIA 1TMKA 4QSMA 5D84A 4OX9Y 3RM3A 1YI8A 2EWWA 2QV7A 2XD4A 2A3RA 4TT3D 1VPEA 2P2SA 2H52A 2J5XA 2O3JA 2YZ7A 3L1IA 2CLIB 3DD1A 1X7ZA 3JWIA 3TLZA 1IJFA 1L8XA 5DDIP 3V4PB 2QR2A 4P3PA 1NQWA 1AURA 2FUEA 4FFRA 2FW7A 2Q29A 4DV3B 3GFGA 4G65A 1KQNA 3OSZA 3U81A 3UMSA 3VYTB 1HLDA 2YBDA 4PLFA 4CM8A 1J1ZA 3DUWA 3RANA 2ZJ8A 2G80A 4X41A 5JW6A 3JPWA 1TM4E 4FYVA 4DCCA 4D9IA 1E6LA 1JQ3A 1EG7A 1V2GA 2FEXA 1HG1A 2XUAA 3AFOA 3BMNB 3NR2A 1BHJA 1E1MA 4JI7B 3MBIA 3RS0A 4ZC1A 4I1RA 4OXXA 4KKVA 1INLA 3UPTA 4ISCA 5FUMA 2ADFA 2TS1A 3DWEX 4IGAA 2AV6A 2C88A 4YHHB 4KLZA 2G3YA 5FP0A 3N7UA 4V02A 3NHPA 4HVAA 5H4HA 4E7OA 2HA5A 3CE9A 4PLHA 4QDKA 1IXSB 3I2KA 3DE1X 4IIJB 4L9RA 1XALA 2VRNA 1MT3A 1X38A 4TLEA 5EY5B 1YR7A 3DQQA 4ETWA 5JJBA 1EX9A 2VTDA 2PGAA 4UFNA 4J3NA 1A04A 4B2IA 1N34B 4UQOA 1GAXA 5KP6B 1YA8A 1P5RA 3RTBA 3V3KA 1U7PA 2BGIA 5EEGA 2JGPA 3S29A 4RA6A 1CY8A 1OR8A 5HS4A 3PPYA 2J0VA 3FMOB 4P3KA 1JG1A 3X2FA 3F1KA 2Q45A 3RASA 4IL5A 4GE0A 3P05A 521PA 5K3SA 3CH6A 3SE7A 4IG9A 4CL0A 2VCYA 3ISJA 1X9IA 2D13A 1U3WA 2VUIB 2FXVA 3AR8A 4IVPA 5KQPA 1W2WB 3GLGB 3ENQA 3PC6A 5TNXA 4B80A 1C3LA 1SK9A 2BMDA 4PXSA 4MVJH 3ONEA 5JS2A 2XBUA 3AJRA 4FHGA 4HDNA 3ZV6A 4W5OA 4DIEA 3R09A 1DKNA 1OWMA 2BYTA 4OFBA 2PFKA 3H9CA 3BFJA 2MSCB 1V5EA 2POQX 2X41A 1HDIA 3F6CA 1WDTA 2ZYAA 4OXKA 1JT2A 2ARKA 4H2XC 3QKIA 3JQQA 3KZCA 4LOLA 5FJJA 3SVLA 5LIPA 1Z38A 2W2KA 4H6XA 2EBFX 3U4DA 3MRTA 4RUKA 4D42A 1Z08A 4QT4A 5CG2A 1WBDA 1RS0A 1T5LA 4IXNA 1XU7A 3E2MA 3LUHA 1RP1A 3M49A 4ZDKA 4BO0A 1E9SA 1KZ7B 3IUBA 2QR5A 5K0BA 3G8DA 3WLHA 5E4FA 4MSUA 1UP6A 2XYGA 1NW9B 3QOXA 4KVGA 4BWVA 3C7CB 1IK6A 1R9NA 2J3DA 1DRVA 2B82A 2X5KO 3QQ5A 1PRYA 2G8LA 2XT1A 1M67A 1R0YA 2DLNA 3H4MA 2NMVA 1CE8B 3HFGA 4EL0A 1JS1X 1QZUA 3N6XA 5JQGF 1KU0A 1MA0A 1DTWB 4PY2A 4XQ9A 3V6LA 621PA 2OUKA 4GX5A 4LIPD 4UCFA 2A0XA 2NVOA 1DWOA 3X1ZA 3BILA 3KM0A 1I6KA 3AR6A 1P3DA 2O2SA 1HF3A 2YUTA 4TMXA 3ZQUA 4FB4A 3V4RA 2IHJA 1E69A 1AUPA 1Z6ZA 3OEHA 4FI3F 3L92A 4RFSA 1R27A 3A6LA 4Y9TA 2N42A 3EXEA 1UBNA 1XDWA 3QY0A 1WG8A 5ALQA 2WHRA 2C97A 4HRVA 2X9VA 4E3WA 4Q4AA 2X0FA 2ZUFA 5BN5B 3RLFA 2GTHA 2XVXA 4RVNA 2F3TA 2XCQA 1ZGCA 1XJQA 1E5QA 5D3ZA 5LD2C 1U8CB 1T8WA 2PWBA 1CTQA 3RJ9A 2D62A 2I03A 4KE7A 4V1CA 1FTYA 1L5HA 3LCJA 2FZLA 4D0NA 2ZIAA 1JSXA 3CPHA 3DF9A 4H7IA 4AU1A 4UU0A 1YNOA 3DBRB 5BMVB 5DK6A 2XWSA 1Q92A 3EFEA 2CHQA 1RCFA 5TMBA 3P2IA 2ZDHA 1PQPA 1RI2A 2B98A 1BQ4A 2J3JA 1T3ZA 1VXOA 3EZNA 7CEIA 1FLNA 3K4PA 3O74A 1O97D 4R0MA 1WSBA 3L05A 5DCUA 4OLJA 5IAAA 2JKYA 1L5FA 2QN6A 4R01A 3A6JA 4LWQA 1EM6A 3HO6A 3QGMA 2NVUB 2QJWA 2OCXA 1ZXXA 4QG7A 3BFVA 3L82B 1U0LA 1OTHA 3P9SA 3UM9A 4BUJA 1VZ3A 1CJCA 3IAAA 1VDMA 1T8UA 2YJTD 1H4TA 2F3UA 2WINI 5TF4A 1E3TA 1V48A 4ZQBA 3S5JA 3WFJA 1EDZA 1V96A 4ZYUA 2ORVA 5KVVA 1GDHA 2LRHA 3GMSA 2NUBA 3FHTA 2HHLA 3ZN2A 5LQDA 3UAOA 3BTSA 2OG1A 2K2QB 2HF8A 2B6NA 3IAS1 3CIOA 2FLVA 4R31A 1H5UA 1DSSG 4B0PA 1NT2A 3EMBA 2GXUA 5DX1A 4KWHA 3G6KA 1HRDA 5CJPA 2PSSA 1NUUA 2WJYA 4PBTA 4AQDA 3IMFA 1H2ZA 3DFIA 4WVLA 5DTEA 2CV0A 1ZC4A 3TN7A 3WGTA 1WW3A 2YKGA 4MHSA 1IHXA 3HA5A 3TQHA 4JZYA 4R2XA 1AMUA 1GM5A 4V3BA 1FSZA 2X7XA 1J9EA 3SXPA 1CJKC 1OYOA 2H2GA 3AESB 3PVSA 5L4NA 5CVTA 3ETDA 5LKRA 1R8QA 1EA5A 1QGUB 3OHMA 3EDRA 2BFEA 1W5AA 2P11A 3G17A 2IH2A 4V0ME 3ZTTA 3BIOA 3UW1A 3PC7A 3SYKA 4E2ZA 1KLPA 1XHFA 3HJRA 5SYNA 5KOYA 2X3UA 1AK9A 1G5PA 5FB3A 4NEGA 1FRZA 4HDKA 5P21A 2G9ZA 1M9NA 2C4VA 1AQ6A 2D2EA 4N9WA 4XIFA 2PGOA 4WE3A 5EOVA 4P34A 3B1XA 3EG9B 1TA9A 1VQKP 3OJLA 2IX3A 2CYCA 4B85A 1QPBA 2GH1A 3LHIA 4FJ0A 4LI0A 1XTKA 2GM3A 1I4TD 2WKWA 1E7YA 4UMFA 3TLBA 4ZTZB 1F7UA 4DE5A 5BUZA 1UWCA 3GGOA 2X9QA 3DOUA 4MYTA 4YRLA 1AHNA 3CMMA 4XDGA 2FQWA 3WB2A 4ZYZA 5JH7F 2OYRA 2HJ9A 2PH1A 1FTWA 5IWCA 4C0AC 4S1VA 4AX4A 2CNRA 3GGPA 5D51S 2CDAA 2PT6A 1H8HA 2EX0A 1SCAA 2I7XA 2XTAA 1J2TA 5BRNA 1K7EB 2BFFA 4ED9A 2K6GA 2RK3A 3B7GA 3ROXA 1U02A 1UWKA 1JKJA 2PKRA 2W5UA 3AEXA 3IQXA 1UXJA 4HUQB 4XIIA 3V7WA 1S3IA 3A9WA 2PKQO 3A2LA 1JJFA 4XWOA 1RC0A 4LJRA 1QNFA 2XRMA 2CJWB 3SBEA 3UUGA 1SK8A 2YUIA 4W5RA 4NMHA 4AO6A 3ZXYA 2G25A 1FE8A 2WHEA 4R81A 5JATA 2G1KA 5FPQA 4JL6A 3EGIA 3GJSA 3VSAA 2PWZA 1W4LA 3NT5A 3QVSA 2VP6A 2CLDX 4B6RA 5K0EA 5D5QA 3QU4A 3C2QA 4FGKA 1QE3A 5F1YA 4KPFC 5KBYA 5DHAA 1CRQA 1LVGA 1UF9A 2BPOA 4D9BA 3FSRA 4BQRA 4AO8A 3S44A 3X1JA 4BNXA 1QHEA 5BSKA 2PMKA 4NCJA 4MMYB 4EB0A 3NDRA 1UZLA 4RPJA 1RJDA 2JL1A 4QYTA 4Y6SA 1JYSA 1LEHA 3FUTA 3VC1A 3QM1A 3GUUA 4RSRA 5SICE 1T3LA 4L5IA 2F1JA 2XXAB 3R5FA 1ILWA 1OBOA 1X7XA 2GBCA 3RREA 3LX8A 4O2AB 2GBFA 4GNKA 3GRCA 3TW8B 5IJZA 4WFJA 1EBUA 3OTQA 4DY4A 1F1BA 2O7QA 2QQ5A 1DFHA 2R6AA 3M8KA 3KB6A 4Y2XA 4Q82A 2JAXA 3KTOA 5E1DA 4U7JA 1PL6A 2WRZA 2HSGA 2FNAA 5HQJA 1FXWF 1JAYA 4RXTA 2QAGA 3USCS 3FWNA 4JXKA 2AMFA 2VNIA 3FI0A 1OH6A 1K27A 3TVTA 2JF0A 2A1UB 1Z6MA 4ITRC 3A4YA 1V9SA 3FMPB 4S24A 3SYRA 1H6BA 4DLKA 5IXSA 2GM4A 2KWIA 1DADA 4LXGA 1BN6A 5A2QA 2DGDA 1ZOSA 4JFRA 4JY7A 2QGNA 3AVWA 1AQLA 3NHBA 3NHYA 1M2JA 4MQMA 1KEEB 2HUPA 4U0CA 1Y63A 1PS0A 3H2SA 3SVTA 4B3CA 3E7PA 1P17A 3OF2A 3PTLA 4ZAGA 4Y6OA 1ECBA 1T8PA 1V4NA 3K0KA 2J07A 1VB5A 4IIGA 1NF2A 2GZ1A 2CGQA 4XQ0A 4KXLA 5CX4A 4P80A 2C7QA 1H66A 2PSJA 2PGXA 1QF6A 2P1RA 4MROA 3F78A 3MW8A 2BE9A 1MR3F 4BX8A 3S99A 4BEVA 3I32A 5BORA 4QNBA 3CD6P 2M6KA 3V8RA 1YS7A 3VR3A 1UZAA 2B9EA 1SURA 2JS7A 3D54D 1PD1A 3AY7A 2OCLA 1XHLA 3F8SA 4LXQA 1Y3FE 4BN5A 4IFEA 4J16A 2QTVB 2C7BA 2UUPA 5EKTA 4AW9A 1JVBA 1HYQA 1KMHA 2JCBA 3CF6R 3OU6A 2HEGA 3IAXA 1RW4A 2FR1A 5KYYB 2JFUA 4ZEOA 1CYDA 4EQ6A 4M0LA 2I33A 2JI7A 4NBNA 3EWAA 1NRXA 5H68A 1MUUA 2I7DA 3VH4A 1IQUA 1FTQA 2WVHA 3JAKA 4PHFA 5FXMA 3SR3A 3PVCA 3PJDA 3HDQA 1V8ZA 5CA1B 2P5YA 1YSCA 5P8WA 2JLUA 3E35A 5JNUA 4ILEA 2PXXA 2VJMB 2O2ZA 1WSAA 3OIFA 2Z5VA 3A1WA 4LGMA 3UC5A 4PO9A 2A1TS 1M8PA 3M5CA 1ES9A 4RAOA 1ZI8A 4OI2A 4XSHA 5EE3A 5FTWA 2C7OA 4WOKA 2PUHA 4WQMA 1EUCB 4GXRA 4PLTA 3WBFA 4Z1OA 2Q5QA 1O94C 2R6HA 2PTHA 4RY0A 2H4ZA 1AGRA 4RQUA 4ZVKA 5IF9A 1N4AA 3F8WA 1JZSA 3WC4A 1VQOP 4OU4A 1UMBA 1X13A 4UAVA 4DZRA 1ZNZA 4CMGA 1UPAA 3JVEA 1TT7A 4RS3A 4NIMA 1XVAA 1J90A 2DX7A 3SF8B 4KG7A 4Y1RB 3SZMA 3JSXA 3F71A 1RHJA 2XNJA 3GUYA 5FQNA 1X7WB 3RSSA 2GXQA 2I9KA 1AB6A 2J0UB 1L4HA 1VYVA 2D2XA 2QPLA 3JASB 1RM4A 4FZVA 4DANA 4F6CA 3SEAA 1JPJA 2WZBA 2NT3A 1J49A 4OQZA 4PSCA 4YR7A 2GD6A 2HV9A 4YUYA 3CVUA 1Z0FA 2I6GA 1VB3A 2D0DA 4WZBA 4J4BA 1XTJA 2FWPA 3F7TA 4OQMA 1JW9B 3BXGA 4CBVA 4IEEA 4BN4A 1HX7A 2D3TA 4DWVA 5JAUA 2AK2A 4MYHA 2IS6A 2W6OA 4X61A 4HPJB 2YZGA 4LV6A 1F14A 1KC3A 3KOOA 4OXRA 1EWTA 3O2JA 1XI2A 1SJ9A 2WOOA 2WPDA 4KGXA 4OEHA 5I7VA 3EXHB 2VZ8A 2Z3ZA 2NWQA 4R16A 2XMQA 3CZRA 3FTCA 5DTJA 5G02A 1V37A 4U3JB 3S7TA 2ZAYA 3QHPA 2JGEA 3DL7A 2XRZA 4B9EA 4BC1A 1I80A 1XTSA 2UVPA 2XYPA 2WG1A 4NH0A 2W6NA 2O5RA 1QRTA 3T94A 4UBNA 3TZBA 3KQSA 3I9V6 4ODIA 2G5CA 2I8CA 3QWBA 5BNWA 3CUSA 2HF2A 4XXHA 1P5ZB 2GPJA 2C8VA 3HWWA 5C3UA 3V48A 1K30A 4MIOA 4G81A 1GGFA 1BEUB 3DT8A 5CA0F 3OLCX 4G24A 4WX2B 5B53A 2LCIA 2YC2C 3U7QB 1N0WA 2WJWA 1I4LD 3GRRA 1HNXB 3D6UA 4I66A 1ECPA 4PC1A 1DKPA 2JGDB 1XRLA 3NYIA 1W94A 3WBKA 4EGQA 2TECE 4NXMB 1CEYA 4BQNA 3G0HA 3AVTA 4Q02A 1ZJYA 2FZKA 4UCXA 3RC1A 1EVKA 4K40A 3PXDA 4B32A 3R9WA 1G0NA 4CCAA 2RG7A 4HS4A 3P9NA 3PD1A 3OZAA 5EZYA 3VHLB 1W88A 3DW1X 5BV0A 2QX4A 2QUJA 5F7ZA 2Q0QA 1ZUIA 1XV5A 3FPGA 4XLLA 1QPZA 4RVFA 5TS3A 4EI2A 1T34A 2R8RA 5B55A 1KZ6A 2E37A 1N7HA 5AW5A 3OZCA 1YKSA 3K0SA 3MBOA 4FOLA 2OV8A 2ZTMA 2QLNA 4JLWA 1JILA 4REQB 4YP9A 3RYHB 4DY6A 4UZEA 5EWJB 5JJKA 2C9OA 2HNKA 5C37A 4Q21A 4OGKA 2Q4EA 3G5LA 2NZWA 4X9XA 3NW9A 5FV4A 3MWLA 1KFCB 2OD7A 2X7HA 4BCBA 1XKTA 5BT9A 1B8PA 2RHRA 1CF2O 5H3CA 4HFNA 4EPYA 1W0KD 4Y2UA 1PV4A 1W29A 1Y5NA 4AMZA 1V3VA 2H2AA 3GJ7A 3WL6A 1MABB 3Q1LA 4TLDA 1ZPDA 4UM8B 1X1SA 5I5GA 3W79A 4KPUB 4FHZA 4ICIA 5I51A 4ZANA 5CJJA 1XZEA 4FE7A 1T2AA 4BXOA 4RPKA 1ZD9A 4AMUA 4KQ9A 1V9LA 3MMZA 4L3OA 1N2CA 5ITVA 2HT6A 4EJ0A 5FI1B 4BNNA 3KDAA 1U8EA 1UK9A 1ZGZA 2PBLA 2ALJA 2ZAMA 3CW9A 3JRNA 3M6LA 4RXMA 3DMYA 4XQEA 1JFVA 5FULA 3ICPA 3GRUA 1S2NA 1CP3A 4LRSB 4KX3A 5GV8A 3GFVA 4YJ3B 4B45A 4CKEA 5A1JA 3T3OA 1ZAYA 3P9IA 5LXTF 1D1QA 4JHXA 5JQWA 4YRZA 5CD9A 2BCGY 2PMWB 4KRGA 3CGGA 5AVVA 2EJWA 4G85A 4GYJA 3DUFB 4HDMA 1JEQB 1P0FA 4JI3B 1JL3A 4BS9A 2QN1A 4RD3A 1EFDN 4FUTA 5DYWA 5E2IA 3ZWQA 3KV1A 2XI4A 1P1JA 5EIFA 1SWWA 2D54A 6AT1A 1R16A 4XD7D 3A1VA 4HSGA 3RYCB 5DCWA 1A8OA 4JVMA 3HADA 2VDQB 3NC4A 3QWHA 4BJ3A 3GA0A 4TYYA 3U26A 3QH4A 1PW7A 5IBQA 5BWNA 4FK8A 4TLMB 5I9MA 1DJNA 3I55P 1M54A 1UM8A 3TECE 2I1QA 3LC7O 1SQSA 1XCOA 2DQZA 4MS4A 3T3HA 2FRDC 1QDUA 2VHEA 1RZVA 1GR0A 4UU8A 3W6UA 3UUFA 1KARA 7GPBA 3JW8A 2ADOA 1LDNA 4JMPA 1F4PA 4PYJA 2I2DA 3OLYA 3A6EA 2CF6A 1WRBA 1ULAA 5TVGA 2HU2A 2YFYA 1PVDA 2BF7A 2WFZA 4GL4A 3SZGA 4RSGA 4TZTA 3DTYA 4E46A 7REQB 3PQ5A 4UTNA 1DG9A 3E81A 4YBZA 4PIPA 4AXXA 4LECA 2B34A 3UT6A 4TSKA 1H2YA 2PKEA 2OCBA 3DKVA 3QF4A 2ZREA 3HBJA 1C7RA 3H8JA 3OOWA 3CX6A 1KIAA 1DBWA 3EIXA 4EW2A 5TT0A 3EEOA 4PV7A 2L17A 1GOTA 2WLTA 4XWTA 5F5LA 3E5RA 5CCDA 1UM9B 3W7VA 3GHYA 4ARAA 5CITA 2P27A 1NXTA 5D6OA 1YDFA 2XCUA 2X40A 2BM8A 4GX2A 1P4SA 3FNFA 4K1LA 4X1YB 4PQRA 3FWYA 5DNDA 1KQPA 2X5XA 3U3OA 4MTCA 1HE8B 2V5UA 4AYXA 2D4HA 4LXTA 1JTFA 2DBQA 3U7FB 3VO1A 3PRKE 3UMJA 2QD1A 3VBEA 1IUNA 1K0UA 4U0FA 2FPMA 4HNAA 4XUCA 4D9CA 3ICEA 3URKA 1B74A 2REQA 2OZLA 5LZ8A 3KD3A 4RXUA 2KE5A 5DOZA 1KQ3A 1SRQA 3BE8A 1N75A 4PIVA 1JR3E 4Q9JA 3PYMA 5I8WA 5BN4A 1M1XB 1E9BA 2Y0BA 3DOHA 4ENWA 4RIEA 5EWLB 4QX6A 2PVCA 1NA5A 3ABOB 2I54A 3P0FA 3HSYA 4LX8A 5HF9A 1A5AB 1JIJA 2ZTVA 6REQB 1YJWP 2O8CB 5EHIA 1JLKA 1POWA 1WP4A 1WPRA 1U7HA 2PD3A 1HDXA 2GEUA 2OD2A 3R3SA 4KH1A 3GRVA 4NYJR 1J09A 3IOMA 2P7IA 5G2OA 2EKZA 4LXIA 3LNTA 2O1XA 3QMMA 4N5IX 2GARA 4OUDB 1GXSB 1RWNA 2XB9A 3P20A 4R41A 1CDDA 3G29A 5JAHA 4WDRA 1HPLA 4QO7A 4RZQA 4TMKA 5CLIA 3UK6A 4WJLA 1PQ4A 2YVKA 4TTSA 1K6JA 1PFVA 5KU7A 3L5KA 5BSWA 4BBJA 5A5DA 5JRJA 2E4ZA 1G59A 1RJEA 1PZHA