1ZMBA

Crystal structure of the putative acetylxylan esterase from clostridium acetobutylicum, northeast structural genomics target car6
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
284
structure length
284
Chain Sequence
MVKSFLMLGQSNMAGRGFINEVPMIYNERIQMLRNGRWQMMTEPINYDRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLFRHALTEAKFAMESSELTGILWHQGESDSLNGNYKVYYKKLLLIIEALRKELNVPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFEQDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNRKHVLEPLINENELLNLNYARTHTKAEKIYIKSMDFALGKISYDEFTSELMKINNDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylxylan esterase related enzyme
publication title Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
total genus 94
structure length 284
sequence length 284
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03629 SASA Carbohydrate esterase, sialic acid-specific acetylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.110 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1zmbA02
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1zmbA01
1V2GA 4JJ4A 1ESCA 2WABA 4K3UA 3DT8A 1DEXA 1FXWA 4K7JA 4PPYA 4H08A 5JD3A 3BZWA 3DT6A 1BWRA 2O14A 1Z8HA 4JJ6A 3DT9A 4IYJA 3P94A 1JRLA 4JKOA 1VYHA 2HSJA 2WAAA 2VPTA 3DCIA 4K40A 4JHLA 1IVNA 4M8KA 5HOEA 3C1UA 5A4AA 1ESEA 4XVHA 2WAOA 4JGGA 1K7CA 3PT5A 3SLRA 3MILA 3HP4A 4OAOA 1BWPA 4LHSA 2Q0SA 1FXWF 4RW0A 1YZFA 4HYQA 3SKVA 4RSHA 5B5SA 4K9SA 1DEOA 4NRDA 4Q9AA 3U37A 5CD9A 3KVNA 4OAPA 5BN1A 1J00A 4S1PA 2W9XA 3DC7A 2APJA 1ESDA 3W7VA 4DEVA 4Q7QA 3RJTA 2Q0QA 1ES9A 1ZMBA 1WABA 4I8IA 1PP4A 1VJGA 4HF7A 1U8UA 1BWQA 4TX1A
chains in the Genus database with same CATH superfamily
4PCAA 1NC1A 4OH1A 1Z6QA 2QTHA 3MOGA 3EDOA 1D0SA 2PGNA 5K3FB 5KQPA 5TJ9A 4ZV4A 1M3SA 1PUIA 4NBTA 2W6PA 3F3SA 1P33A 1X14A 1VQPP 2MDTA 3FZNA 3DDCA 4KV7A 5G4KB 5A7GA 1REQB 3UWPA 1IPHA 1MHPA 1UEXC 2X41A 5K3FA 1RAAA 4FYPA 3UWKA 3H97A 3NJ4A 5C46F 2Z98A 5KTYA 1WBJB 5G4KA 2J6BA 1REQA 4DYHA 5ESXA 3T7IA 1IU9A 3E4DA 3Q11A 4UASA 1T8PA 3OQJA 4L1KA 1VHQA 1YJNP 5AKJA 1J97A 1RXCA 2ZJFA 1OPXA 3E35A 3ND8A 4ND4A 2NXEA 5L8VA 4W7HA 2BRUA 3ZGZA 1I0ZA 1JR2A 3JYLA 2OXTA 1G9TA 2GZEA 1PSDA 2A86A 4D8UA 3EX7C 4QNBA 1VBMA 4PAQA 4UU0A 5BRJA 3OPQA 3SVLA 3JD2A 2ATIA 4ZEXA 3NWEA 4HNAB 4Y1EA 2Z4RA 4FYKA 4ZHQB 2W2QA 1CF2O 1PG0A 4CM9A 4NZOA 3VPSA 3F6SA 4HNAA 1OR5A 2ZTVA 1EZ1A 3DAYA 3EVTA 5AMXA 1VJDA 3RASA 4ZHQA 2HDHA 1JDPA 2LWIA 1R5NA 2VPTA 4D45A 2IX3A 2B4TO 4F92B 1Y4UA 2X1MA 2DH5A 4NEOA 3FPLA 1R6BX 5E8JA 4AD8A 2G76A 4FE4A 5I8PA 2AB0A 4RXUA 1E1RD 2QZZA 3LZ6A 5E2AA 2FUG6 5BWMA 3W5DA 1JECA 5AI9A 1RBMA 1B0UA 1U2ZA 2NYUA 3T5GA 2XMSA 3FH0A 1MO2A 3D2LA 1EP9A 3LZDA 1CK4A 2XE8A 4N0DA 5EN4A 2YMPA 3ADPA 1GNRA 4K6GA 4TVKA 3OOSA 4F9TA 3ETCA 2GT1A 2CLDX 3CD6P 1V7QA 1VSQA 5B2ZA 3UWSA 4PQGA 1WQ3A 4FZ5A 3FCYA 5DT2A 4ZD6A 2IDKA 2F67A 5DBGA 1I6MA 3LMOA 4M0DA 2V6IA 3M9LA 3JASA 3AIOA 1E66A 4KVAA 4RH0A 4Y6RA 3S2EA 1JFFB 5K0EA 2O5CA 4WAUA 4N76A 1V1RA 2K2QB 1Z28A 2C2WA 1HUQA 4OJTA 4YQYA 4EPWA 3CCBA 3V9PA 5JS8A 4YY3B 1QC5B 2CLOB 3QU2A 4UHPB 1JFFA 2XYVA 1ZR4A 2K2QA 2C4VA 2JEOA 2O3TA 1R12A 3NKVA 5ANRB 3ZIAA 1QC5A 3ZJ4A 4NMLA 2XDQB 3H5TA 3FZGA 1HWYA 4DS3A 3G7SA 1YFLA 1E2MA 3UC9A 4CV3A 4HC4A 1KA9H 1T8SA 1ZOOA 2XDQA 4YAIA 2FXVA 4HBZA 4G37A 1PG2A 1S01A 5LQSA 2PAFA 1TPZA 5C1OA 2FE4A 3VBEA 4RTRA 5E1DA 4OGWA 3G2QA 5D5HA 1OA0A 4IEFB 3EVEA 5FPYA 5IN5A 5F4ZA 2GVNA 1DRVA 3PTAA 4MRTC 3FDFA 2AFVA 1KEKA 4M49A 2R00C 1HT3A 3K0KA 2WWVD 3ZWPA 4AMVA 4LE2A 2OBNA 1WZIA 3QMMA 5EJ6A 1G9XA 1ZJZA 5U4QA 2BM9A 3PHJA 1L7NA 1PJLA 2ZBDA 3VZSA 1WMAA 3P1JA 3WRXA 3O3OB 5AW4A 2LR0A 1P77A 1E9FA 3C7AA 2D5AA 4M7PA 1DRKA 2P9ZA 2V0NA 2YKGA 1X6VA 1QWSA 4AWAA 4FFOA 1NX6A 2F1OA 2HRDA 4GH5A 4L78A 4Z54A 3Q8KA 2PJUA 1TGYA 1N34B 3RLFA 1OWPA 3OP4A 4LZPA 5IXJA 3QBTA 3ELDA 5KTOA 4Z9YA 1SBYA 3UVEA 1VJ0A 2FPXA 3ZCVA 1NXSA 5FR2A 2H1CA 2FMUA 5LD2B 4KNYA 3D2AA 5P8WA 4NMWA 1BAPA 3NPAA 3C1AA 2DPXA 5GIPE 4PGMA 2E89A 4LJ6A 1R6VA 1GFWA 2WVHA 3EOAI 4EF6A 4QECA 1OAKA 1G21E 2OFXA 4R16A 3MGEA 1GU0A 2O06A 3UMMA 5ADHA 2H08A 2WKPA 1H3NA 1JT9A 2DR0A 3HSYA 3IR6A 5DM4A 3WLSA 1W48A 4B85A 1DV5A 1NBMD 1A8PA 2YN2A 3HUDA 4WERA 1TZKA 5DXJA 4PZ9A 3VUFA 2Q29A 3NR2A 4EY7A 5KBYA 4DTIA 1GILA 3I2IA 3ITDA 4G5RA 1PZEA 1M2EA 1DAGA 1K08A 1J1ZA 1EWRA 1NMQA 1LWOA 2RB4A 2IUSA 2N42A 4PBSA 4CIWA 3AR9A 5J1SB 1EFDN 3R3YA 3HHPA 1ZVMA 3MW8A 4JY7A 1R6DA 3KQHA 3T61A 4DNFA 1B2LA 4MVJI 2BLNA 1ACJA 4YJDA 4FYVA 5F5NA 3X1YA 1E77A 2WPTA 1P8JA 1G3IA 2YVUA 4RZ3A 2VXOA 5NULA 4HWTA 3QEJA 4RPIA 1M2HA 3BJMA 3BQNB 3JPWA 1OE0A 3B3FA 1HFWA 3HRHA 3OQBA 1I7NA 3PNQA 4GGMX 2BGTA 3HBLA 4N0PA 4ON9A 3C1UA 4MIOA 1Y8RA 4TXNA 4BKPA 4KWIA 1Y9ZA 3Q3GE 1WY7A 4L8FA 5MN5A 2BGIA 3G68A 3AIIA 4QT4A 4MV1A 2WB4A 1G63A 4ZU3A 3AJRA 4D9EA 1E2NA 1EHYA 1WUKS 4INJA 4X94A 2B83A 4DLYA 4DZRA 4ER7A 2OK8A 4P80A 1X8JA 5CNJA 1S9DA 3PVCA 1E0AA 1PTJA 1XYYA 5AJYA 1ZSVA 1JEEA 1NOKA 1GA1A 5A0FA 3FNGA 4RLQA 3WX0A 4LVOA 1YRHA 1HE8B 2PSSA 1FLNA 1ONSA 4U0JA 3AVYA 5JV5A 5DXFA 2PGXA 4EG5A 3GN1A 3CO5A 1C1HA 2AX4A 3B1FA 4P7KA 4OQDA 1JJVA 3ESAA 3HBAA 3U7EB 1TMKA 5G0UA 1C4WA 3UGQA 5EP3A 4O2RA 1OXSC 1YRAA 2HBYA 3SXUA 1DBVO 1QGDA 1N5RA 3D4LA 3WE7A 2OM6A 2EWVA 3OKPA 4RTSA 4WX2B 4EY5A 1Q1EA 2ENUA 2I0FA 5F9HA 1F1BA 4A1FA 1M76A 2VDWB 3OMLA 4LOLA 2SECE 4AFNA 3D7KA 3EGDB 2WIKA 1BZYA 4IQ4A 4OFZA 4XX1A 4IGKA 3QUBA 3PGLA 3OCVA 1EBFA 1PJAA 3NO4A 2WJPA 4LY0A 1TLLA 1YHNA 2ZZKA 3EGDA 4BKUA 2BISA 1S4MA 2OGSA 3A26A 2VT7A 4BDTA 4X95A 4J07A 3RUPA 3GHYA 1W8DA 2C9YA 1Q0TA 1CUAA 4L8VA 4O5AA 4RANA 1BA2A 5H5JA 4ZVNA 1T3LA 4QA9A 3UJ9A 3NGXA 3JQDA 2J33A 2VVTA 3GUCA 1N2CB 1CVLA 3S1LA 5JSYA 4CE6A 1N2IA 4RFVA 4CT4B 5AJVB 1G6OA 1ZM4A 3QYAA 3HMQA 3LPDA 4MQFB 4F4UA 1CZLA 1OLSB 4QBGB 4RPHA 3LY5A 2R6GA 4KFRA 4XA8A 5FAKA 4XQGA 1OBFO 3WSWA 4H2WC 3QMPA 1DV2A 2QUHA 1KY5A 1Y98A 1TFRA 2WJ3A 3BRSA 1OLSA 2C2OA 2FWAA 4BFYA 2IPLA 3J81A 1UOPA 1MA0A 5KYVA 3AX6A 1F2DA 4Q6WA 3BFJA 4PZAA 1R4ZA 2JCSA 2QJTA 1JFLA 4O4LF 3RV3A 3IQDB 2FZLA 3DL2A 2ZYAA 4QGGA 5HV8A 1PSWA 1R0WA 2GHIA 1QYIA 1I4TD 1ZG3A 2VJYA 1ZN9A 2DWQA 3EBLA 3PJGA 3PQ6A 5E7IA 4CIYA 4JU8A 2HNBA 1RRKA 3VR3A 4DQLA 1XMJA 5DW0A 2ZUEA 3CEJA 4N82A 5CGZA 3RYFA 3RBVA 4I3GA 1ABFA 1PR3A 2C82A 3RRNA 3VKFA 3ZY6A 3WDKA 1T6YA 4L07A 2VQSA 1BA3A 1UCFA 3LP8A 3SVTA 2KORA 1CUEA 3DW3X 4JEHA 2F90A 4LHEA 1UDBA 4OYLA 1T43A 1RPNA 3DNFA 2VAMA 3RHFA 3NBZC 1T25A 4E09A 2BZSA 4CDNA 5FNZA 1OXKB 5I01A 2CWWA 2VWHA 4QLOA 2DULA 3B5IA 1JLHA 4MMZB 3W04A 1RO2A 1OKKA 2D8AA 5I9TA 3BPSA 4NPHA 5FTJA 1AVTA 2A3RA 4UAGA 1G60A 4MRAA 5E6UB 3JR3A 1YE8A 3VSAA 4KQJA 3TUZC 2JQ4A 1FNSA 3H5OA 2QSYA 3CW2A 4RKEA 3P9IA 3EUWA 2NIPA 1KZ7B 3K1ZA 4L28A 5E6UA 1KBQA 3MSCA 4PQFA 2OBYA 4IFTA 2ILVA 3PT5A 3R3VA 1E9BA 4HB0A 4OU4A 2QM7A 5FJJA 2JIBA 1J7KA 3F5FA 3HKBA 4ZICA 2PAAA 3A4IA 1KVRA 2A94A 3LA6A 3F6EX 4S0ZA 5A5FA 3ROZA 4P0QB 2OVBA 3L7YA 4B84A 3N5CA 1HDGO 3PA8A 1AO3A 1YZFA 4PVDA 2VK8A 3SZ3A 3V7WA 4DM7A 2OCBA 2FR0A 4E7OA 1GPJA 5BW8A 2J7PA 1NU8A 4Y3UA 1X86B 1CRPA 4MUBA 2OO5A 1FJ2A 1LFAA 1LDNA 1Q91A 1U8FO 3CUUA 3SFZA 3T7RA 2V03A 4BUCA 2K7FA 4TMYA 3BIWA 5DGXA 4PSCA 1MB9A 5EQJB 2GLXA 4CG2A 4EG1A 3EC7A 1Z4OA 1DKOA 2F1KA 1KIAA 4B8YA 4XQ0A 1FC0A 2H92A 2HCBA 4UZFA 2BV3A 1FFHA 1LLCA 5DYTA 3FSRA 1A98A 1CEQA 5KWSA 1XAGA 3NYIA 2R87A 4CIXA 5CEFA 3WGHA 1AX9A 2ZWAA 4FB4A 1EJ0A 3G23A 4DR4B 2QTBA 3LT0A 2J3MA 3OURA 3JQEA 1IEWA 4WXRA 4TZ0A 3VH4A 3N76A 1Z6YA 3Q2IA 1EFPB 5IMSA 3LRYA 1DEKA 2PKQO 4WDQA 1M7BA 3CUTA 4OK6A 4S12A 1XG5A 3VQTA 1EIAA 5C4IA 2HSWA 3BGSA 1TA0A 1EFPA 5A0TA 4RF2A 1ZCJA 2H54A 3JWHA 4RVOA 1EVJA 1DKNA 1TJ4A 2IITA 3DG9A 3H6GA 4XQCA 1WZNA 3KZ1E 1EXDA 2W6JD 3BGOS 3QXXA 3VHLB 3CKMA 3BMOB 1XROA 3PQEA 4TXLA 4WDRA 3R5HA 1P3JA 2NZVG 5HIKA 1M8FA 4HO1X 3BMOA 3KT8A 2BIFA 5CFMA 1SD5A 3Q0IA 3WLLA 2GYKA 1YZTA 2DH6A 2BWJA 4KTTE 3K70B 1XE3A 3ZK7A 4KR7A 5F35A 3O03A 4K9DA 3LKDA 2NZUG 2BR4A 5ALDA 1H2AS 3KV3O 5JH7F 1SD1A 1UXOA 2C3MA 8ADHA 3RS9A 5DSZA 4V39A 1OXTA 1IEQA 1ZXXA 4J2OA 5HIJA 4ESEA 1KYWA 1LFDB 4QOEA 3E22A 4BLTA 4TV8B 4TKZA 3R3ZA 1XNQB 5BSHA 4AJLA 3ESBA 1ZK0A 1YONA 2PGOA 3DMDA 3OJLA 1M1ZA 1PFVA 1Z62A 4ZMBA 5EW5E 1QE0A 1XXHB 1NQTA 4TV8A 1KMMA 1Y42X 3F49S 5F21A 4GUAA 1C4XA 2Q8NA 3AEQB 1LA2A 1R5OA 4C87A 5F1OA 1HURA 2PQ6A 1XXHA 1J07A 1Q84A 1CPYA 1ICIA 2GCIA 5LU8A 3BMNB 3QFRA 1L5RA 3O8BA 5CA1F 2BF7A 3IAM1 1UFVA 5FP0A 1XR3A 4D80A 1F0KA 2YQZA 1Q1AA 4FT4A 4OKIA 4QQNA 4GWLA 4NBRA 2K94A 3E3AA 2JL1A 4WZAB 1N2SA 4L4XA 3WL6A 3Q7PA 3TTYA 2FUCA 3E9ZA 4D2IA 1XTKA 3B1KA 3I83A 3JYHA 3AU8A 1U8CB 3C5WP 4O4JF 4WZAA 5JS1A 4TN5A 2QVYX 4EIWA 5AOBA 4L4RA 1A4RA 3QK7A 3B13B 3QKTA 4DB2A 4KO8A 3TNFA 5EQTA 3GZNB 1WXGA 1ZGCA 1FSZA 1O1YA 1Q92A 3PXAA 2ZJOA 1W4ZA 2PT9A 5HKOA 2WW8A 3GZNA 1AGPA 1E9CA 2ONCA 4WTOA 4B0PA 1LNSA 1OTHA 3WIDA 1SHTX 4TTAA 1DHRA 5LBUA 1LV7A 1YZGA 3DAPA 3OUUA 3TFOA 1JTVA 3GJ4A 2DRIA 3KOZA 3R9WA 2VZEA 1ILWA 5ALTA 3NJRA 4NYMR 5DWQA 1AF7A 2QD5A 3CLRC 1MJHA 1VHJA 1XVAA 2JK0A 5K6TA 1RLTA 1NASA 2QDXA 4DQDA 2JVJA 3RVRA 2PJZA 4LG1A 3ZE6A 3G2OA 5KTMA 4Z4CA 1ULBA 2LW7A 5GOZA 5FI1B 3G2HA 5IXSA 1IWOA 1U0GA 2D1TA 1YBHA 4M86A 5F3RA 3BREA 3KXIA 1WCWA 4WK6A 2QW8A 3DWEX 5EIOA 4TL6A 5IPFA 2R00A 2R3SA 5K8UA 2DYKA 4CTMA 3OH8A 1AA9A 2YX1A 3V55A 2G6BA 1J56A 4OBXA 4ZT7A 1JKFA 5CDHA 1G8GA 3WLJA 1TCCA 5IBQA 4L50A 2QEQA 1L4HA 3T4PA 4OXNA 1ITZA 1EFLA 2B1RA 2EBHX 3H9GA 4JLUA 1E2JA 2G4VA 4JLNA 4MKZA 2MYTA 4RF4A 5JD6A 5KS2A 3BF8A 3VR6D 1SO8A 2JD2A 5AW9A 1B6SA 1JKXA 1BDJA 1JLKA 4FQ7A 3RW9A 5ALVA 5DFAA 1WPQA 2R79A 3L4SO 1UBLS 4LJ5A 3IMCA 4K6KA 2X9LA 3OLQA 1C30B 4BPGA 1SIOA 1XLTA 2G04A 2Y3IA 3GNSA 2BJWA 4LZAA 4MB2A 4YRQA 3ZGVA 3UANA 2FDRA 2ZSEA 3JVDA 2EU8A 1C30A 1OGIA 2I6QA 3NM4A 5A3VA 2ILTA 3JVIA 4P3XA 3W6ZA 4H7EA 5TVGA 3KOWA 3K30A 3GU3A 3RTDA 1CY8A 2CL7X 3B7GA 4KO4S 4F3YA 1DXYA 4F2DA 1GEEA 1GA6A 2W6QA 3CF0A 3DOJA 4BFUA 4EELA 1FBTA 1LLDA 2G88A 3WNBA 1P1HA 2P2GA 2Q28A 1VECA 2H59A 3B3GA 3NCTA 2AG1A 2ZJ0A 4U2GA 1UEIA 1LJUA 3HV2A 4XYMA 3U7QA 2R96A 4R2KA 2AEEA 3TB6A 3HUEA 3DMTA 2P0YA 1IXRC 1MTZA 2IZ5A 3OOEA 3OD1A 4XJSA 4R9VA 3D8RA 4RACA 3A1CA 2OEPA 4NCIA 1U4SA 2G9VA 2NZYA 3DC2A 4U3JB 4XD7A 3EPHA 1SJ9A 2R7NA 1V2HE 4EMTA 4GEKA 2VHCA 1E62A 1YQTA 3F2VA 4RZSA 3QU7A 2JGEA 4U3JA 3SWWA 2CMKA 2MJLA 2I6FA 3RBXA 4DWVA 2QLBA 3KPYA 2WAAA 4GVLA 5EC8A 4ZI7F 1XQ6A 3PF9A 4MVYA 4YK7A 5FTLA 1FNDA 1JQBA 3SR0A 1QWOA 3UK2A 2CVOA 3MIIA 4BVLA 1YVDA 4LECA 3QIAA 2Z8YA 4B3DA 1I7LA 3WHPA 1ISJA 1WL8A 2NZ2A 4K03A 5INTA 3U62A 2R6R1 3DKRA 3L0CA 2FMXA 5D85A 3FYHA 4GPD1 5HRCA 2UXDB 4NAUA 4MI1A 1T8YA 4YX9A 4CT5A 3OTQA 2ZIXB 3P26A 1E0HA 4YMHA 2V5VA 4MXDA 3HO8A 1VMIA 1DVRA 1JLSA 1GRQA 1XZIA 1XZFA 3EGVA 2DPHA 2XNDD 2EKLA 4BFCA 5JJKA 3KWJA 4XWWA 3BIFA 1I7QB 4MMYB 1QXSA 2AH5A 2P6OA 2K92A 2H2AA 2B5OA 2OHVA 2BKVA 2BDUA 2R6CA 3CWCA 3D6HA 4P84A 5YASA 4ARZB 1CS0B 1GN8A 3EFHA 4M8SA 5G3ZA 3L0ZA 1WB4A 1RS0A 3KKEA 3QUSA 1YBMA 4JBHA 1CS0A 1EJ6A 1QGZA 1E2GA 3RVBA 1CRLA 3PT9A 4KKVA 1E3WB 3QQ5A 1PFWA 3LKBA 2BKAA 3DFUA 1XTSA 2RSLA 1CFJA 3AR6A 4OA5A 4CUZA 4ZGBA 1M8PA 5HM6A 721PA 1YQGA 3CKYA 3IXMA 4EZEA 3CVUA 3L7OA 5HIMA 1RLMA 1AQ6A 2NXWA 2QV7A 2XECA 3R77A 4XARA 3HA2A 2BUOA 3DTVA 3L7BA 2HF9A 1VIMA 1JEYB 2QVXX 3FFAA 1SXJC 3BSYA 1XLWA 5CW2A 1WG8A 1XEWY 5EMKA 1XF9A 1KOGA 1JEYA 4KN9S 3UPTA 3IPXA 1WB9A 3GH3A 1KH2A 1HI9A 3VUEA 4KPUB 2H5IA 4OFWA 3I92A 4XSVA 1JNYA 5BQXA 1E3DA 3RAJA 2W5UA 1O7JA 3OKFA 3W6OA 5A4MS 4KPUA 1WV0A 4ZAFA 5E3HA 5JO0A 2JFYA 2KMLA 2ZI4A 1JKMA 3OY7A 2HEIA 3SZGA 1ZXLA 3A3OA 4HZUB 4M0UA 5EE9A 2XMZA 4FE3A 4OLFA 5FKJA 2GWRA 5HS6A 2QTLA 4U0BA 4XAQA 1YULA 1Q20A 3UOGA 5BV2P 4DV6B 5HEKA 2VOJA 3AM4A 2O1WA 2Q27A 5DNAA 3DS4A 2M6RA 3FSJX 5SY9A 3EH2A 2REOA 4RSRA 3QE2A 3R7BA 3V8EA 5TEWA 1T0HB 1G64A 4QU9A 2WD9A 2YWFA 2YJZA 1QHHB 3B12A 3M8KA 3ROFA 1DC7A 3V46A 1RCUA 4KW7A 4QEZA 4ZI3A 3CCQP 4GOKA 1KJNA 2WY2D 4LFBB 2HJHA 2BEUB 1M83A 3OMWA 1VIVA 1SC6A 4L8YA 1L1RA 4N40A 4Z3DA 3Q6NA 1CRZA 3CNQS 3W9UA 4RHEA 2BEUA 1L4BA 2C0PA 4MWDA 3INYA 3HO6A 3EYAA 3OLVA 4YCMA 3GLHA 1A50B 4DA7A 2DFNA 1NBHA 2ST1A 3P9CA 4ATNA 4MV6A 1ZMOA 1SC4A 4KU4A 3BKWA 4LV6A 3DEIA 3H65A 5ALXA 4H0CA 5EEHA 3V2HA 1W4LA 2GJKA 3LF2A 1GCOA 5DGDA 5EJFA 3ZE1B 4BUZA 4CQNA 5CVDA 2RHBA 2JLRA 3VAZA 5JZMA 4MS3B 5CFOA 5JZOA 2GBFA 5CVJA 3DEHA 1SGWA 4B3XA 3FF1A 4TGLA 4MS3A 4GNRA 4OX9B 2Q7DA 3TOVA 5E0OA 1ZUIA 5FOWA 4QUAA 3USCS 1O6ZA 4ZO9A 1M2KA 3FVQA 2V7BA 1H5NA 1M2VB 4WY5A 2GA8A 1GPYA 1TJNA 5F1PA 2PWBA 2CNLA 5AVYA 1L8LA 3RC7A 3RS0A 5AR1A 4HUTA 3GRVA 2N5HA 2H7YA 3WG9A 2JFXA 1H6CA 3DTJA 1FUKA 1M2NA 1SUBA 1FFCA 1HKHA 2JASA 1TVMA 3AJEA 3N2LA 1AZLA 1CZKA 4G23A 5LZ7A 1JA0A 1Y1LA 3SBOA 1T9CA 1THTA 2RCNA 2LKCA 2XKJE 4E08A 2IU3A 5JECA 3O3CA 1VYTA 3PD7A 4IXWA 1WW3A 2FWJA 1DRWA 2YYZA 3KBOA 4Y2GA 4QVGA 3M6AA 4F4HA 4MJ7A 2F8TA 4P08A 3F6RA 1NE7A 4C08A 1UAAA 3TW0A 1NQOA 3RHZA 1KMCA 2KJQA 1MJNA 3L7KA 1NLUA 2RGDA 3T9BA 1W36D 2QORA 4CZ2A 3LUDA 4FJ0A 3TGPA 3F4BA 4BU0A 4MUXA 3GP3A 4G3XA 2ZUSA 1I6WA 4CM3A 4JT9A 1WNTA 4YREA 4I9GA 3TL2A 1P0CA 5F2EA 5IVHA 3VBCA 2CDAA 2FEAA 1WIWA 3O4IA 4M0KA 2I1VB 4IHAA 2HPZA 2VHQA 4LPSA 3QEMB 4MB0A 1TMGE 4NU6A 4RK6A 3RVKA 5K0FA 3ER8A 2JYGA 4MW1A 3WWDA 4M1TA 1J8MF 4HT3B 2GBGA 3NX4A 3QEMA 4MINA 2L22A 4XFZA 4H1WA 2LCFA 2OB1A 5FUMA 2AFHE 4W1SA 2RGBA 3WVNA 4LDRA 1NYTA 1L7MA 2XOEA 5TJHA 3ZS8A 1Z0IA 1OTXA 4X63A 4CM5A 1QK4A 4Q01A 5DYIA 2POQX 2WTXA 4C43A 1U2EA 3OECA 1A4XA 1L1QA 4LGYA 1PLLA 1CVIA 3GPDG 5CJJA 4FB5A 1GWNA 3PNMA 2G9RA 4DR6B 1SC9A 4UJ5A 1AUVA 4UD6A 4DR5B 1C3XA 3DL0A 1BDIA 2O8FB 2CDCA 2GFIA 3INNA 3DEZA 1QP8A 1T3SA 3MLAA 3NKLA 3QITA 4LRTB 2HLHA 4P4UA 1MJGA 2O8FA 4PYOA 2BMDA 3SX2A 5HK8A 5HDBB 3K73O 4GMHA 3IR5A 1TM1E 4A7PA 2NTYC 3AC0A 2E0IA 1PR6A 4JVOA 1XEXB 4TYMA 1WQ4A 4FK8A 5BR1A 3GEPA 4RCVA 2WM3A 1Q6YA 1XAIA 3T99A 2C5FA 4DAEA 1XEXA 1NVUQ 1V43A 2WT8A 3OQVA 4DCTA 3BXEA 3KYCA 1L8QA 5GVRA 5CU7A 2P67A 4MW2A 1OJLA 2ZS8A 3WWEA 4ZZ3A 2QROA 3DWIA 4G5FA 4XUEA 2PE5A 1NJ5A 2VHTA 1NPDA 4Q66C 4BPFA 4DT1B 1QZTA 1YR2A 2KLBA 2B2NA 4R2HA 3NHAA 3IA7A 2GYUA 4D3YA 3TQOA 4DT1A 3S29A 2P4UA 1S1CA 1IG0A 3B36A 5JZSA 2AZ4A 2PO5A 4JI6B 4ZARA 5C35A 4MTCA 4MS1B 1GZ5A 2B34A 3SQDA 4B47A 1YNSA 4NICA 3LQ1A 4JLAA 5FUVA 1WCXA 2R44A 1N2OA 2IHBA 1C8KA 3RRYA 4CU2A 3SR3A 1J49A 3TOCA 1E2IA 4MS1A 3WLTA 4QDZA 3ZDYB 4ALLA 3A58B 4L4UA 4UM8B 3U9TA 2WYUA 4MGKR 1SC1A 3GIDA 1YUBA 2XUKA 3EEBA 4BQNA 3KZXA 5LM3A 4ZEWA 2VOEA 1Y7HA 3PGMA 5KQRA 4BP3A 4OKNA 2B9VA 3RYCB 3KQUA 4PM4A 2MIIA 1ZITA 2HDOA 3AK4A 4UXJA 1QQAA 2V7VA 3T9FA 1W5AA 3VX4A 3WOVA 1K4YA 3E15A 1YS4A 2KE5A 4KQWA 4RELA 5CLQA 3LPLA 1RLIA 1UPTA 2WUVA 3H1GA 3WTCA 1TQDA 2PXCA 1Z56C 4ZO8A 1SZPA 4CMEC 4L0MA 1PJTA 3EQ8A 1NGSA 2Y0CA 5DHQA 4ERNA 4EYQA 3KB8A 1GZ7A 3OF2A 2IA5A 2E4YA 4UU7A 3CLSD 2QYSA 5JPDA 4MO9A 3JQPA 4BNDB 3V1TC 2O9JA 4TLAA 5HBGA 3VO2A 5I7RA 4P3YA 5IKPA 5JPIA 3ZDAA 3GARA 2DBQA 2ZR7A 1NHWA 1UZLA 2BJHA 2ODNA 2WWRA 3EFBA 5JCPA 2WIAA 4MA5A 2DUUA 1CUGA 4GPIB 5AXCA 1K5HA 5IFLA 1A72A 3TQCA 4XQ9A 2H2GA 1EEXB 4R8KA 3WLIA 1ES9A 4KE6A 3QOFA 3UXEA 1Q16A 2QM0A 4LMAA 4HXEB 4TV9F 5JAOA 3P9YA 2OFOA 1ZW1A 3CZCA 3RAGA 4CW7A 1UBNA 4WJZA 3PUWA 2HWXA 4YAEA 3NATA 4GAEA 3KNZA 4QU8A 1GPWB 4YHHB 1T8RA 1PFGA 1Z0UA 1VQ4P 1OY1A 2F3PA 1RQGA 2YY7A 3GNQA 4DIUA 4LRUA 2YW2A 4YFVA 4BZXA 2JO0A 4ZYWA 5K0SA 4FBGA 3ZLBA 4PO9A 1LF0A 1ZRSA 4RV5A 2YWRA 1U7DA 3M1IA 4D9JA 3MM4A 1R5JA 2RI6A 3DHEA 3RU2A 2R2AA 1L5VA 2MSNA 1DWUA 1Q21A 1E6LA 2R6HA 5AVTA 1P4GA 2G9NA 2Z6UA 4I5GA 4R5MA 1F2VA 4LOHA 1SZCA 2B8JA 1YWGO 5K4AA 4PYMA 3IDFA 3V1MA 4RADA 5HKLA 4U9UA 2ZQ5A 5GINE 5IG2A 4FW9A 1ZESA 3VYVA 3DMHA 1AMUA 1SUEA 4RPJA 1KBZA 4GX0A 3WJAA 1FYFA 3TLMA 3ENWA 3R3SA 4Q1EA 1TZMA 3FOBA 4OQ4A 4Z4EA 3CKKA 4HVTA 2DNWA 4UNRA 3OW2O 2HSDA 3LRXA 3BMXA 2ANBA 1PX0A 4Q4HB 1LBIA 5ARDA 1YMQA 4ENPA 3EHDA 4GLLA 2EP5A 3OQ6A 2QTZA 1V95A 4KP7A 1JXAA 4OQYA 2JIMA 1SG0A 1OBOA 1HOTA 1HRDA 1HYHA 4WBNA 4JP5A 1O9HA 1TK3A 2WA2A 2Z2IA 1C7FA 2JGDB 2XSZA 3K09A 3S7ZA 4F04A 4GBMA 4CIBA 3NHWA 1EKXA 2NTNA 2IELA 1LPSA 2QRJA 4MWEA 4S1TA 1WMFA 2D7JA 5EG5A 1FXSA 2JGDA 4OP2A 1V41E 2UYOA 1A9TA 1IUQA 2PVSA 4YV2A 4D0LB 1SG6A 2D7CA 2Z57A 4RD2A 3F7OA 5HHTA 1R4AA 3AVUA 2XJ4A 3V8QA 5KP6B 1KS9A 1LVGA 2CB0A 3LWNA 3T9EA 3L7DA 1OFUA 1OWMA 4OHUA 2A0UA 1JVBA 2PQMA 5MN6A 2R47A 4AURA 5CG2A 3EVBA 5AM2A 5HZMA 4NYIR 8OHMA 3G1TA 3PLNA 5A6SB 3Q2OA 2GTHA 3EVDA 1E7MA 1HH4A 4JL8A 2R4TA 2IEBA 3B6JA 5A6SA 2CKDA 1N2JA 1Q7GA 1KPHA 4PF1A 1VA5A 3CW9A 5F76A 5LB2A 4K0KB 2NTJA 4JOBA 3ILXA 1SXJB 3AEKA 4TM7A 5I4KA 3T5MA 3VJMA 4ZEVA 2ZANA 4DWJA 2QX7A 1BHSA 4V0MA 3L01A 3UXMA 2DFTA 2HRZA 1SXJA 2MWMA 3ABQB 1NVVR 1A82A 3DV0B 2H4JA 3MWDB 3P2KA 4EB3A 4JQOA 4DF3A 4CA3A 5A06A 1H2RS 1O94C 2O2IA 1CIPA 3DOIA 5A4KA 1YIAA 3UMJA 4M89A 1W7AA 2E6KA 4TMFA 4BECA 3TZLA 2XVXA 4WBNF 1NSTA 1NVVQ 1VRVA 2RONA 3AG5A 2RH5A 5JIBA 5IYZF 1B16A 1PFQA 3BX1A 2AT1A 1IZ0A 2FLWA 2PSJA 3GEDA 3STUA 1ZC3A 2Y6UA 3T3HA 4QNMA 3W9SA 1W4CA 2PKCA 2EGUA 2MR7A 5ALZA 3ZYCA 3PRJA 4HEA1 1FQKA 1F8YA 1J6UA 2WYVA 3PUIA 2Y0BA 3VZQA 3WYNA 3A14A 5ALMA 2ZB3A 4MO2A 2ANCA 2G4LA 3ANTA 3LC0A 1GTZA 4LYHA 4JI5B 4RD1A 4X8LA 4BPBA 2WC1A 3FWPA 1D6NA 3JALB 3ET4A 2OHGA 3N2KB 3WGIA 3DS1A 2R60A 1NMXA 2QD3A 3GJ5A 3S5JA 1E3QA 5H4GA 2CFOA 3JALA 1E7SA 1KY4A 2JDIA 2WU0A 4JLKA 3N2KA 3RRMA 4GPAA 2ONTA 4AZVA 1AKMA 2A9JA 5TMPA 3DT8A 4DB4A 1S96A 3LU1A 1W73A 4HQNA 3T7JA 1Z45A 2C4WA 1MQSA 2RG1A 3O74A 4C4SA 2ZWPA 3MTJA 4Q4AB 3ZGNA 1RQNA 2CDNA 3L04A 3RRBA 4MCHA 4Y2SA 4BP8A 4A8TA 1PL7A 2NLOA 2GZ2A 2ZS7A 1Y34E 3LC2O 4Z8XA 2PMEA 4DLWA 4KIGA 4Q4AA 3LX6A 1VLMA 2ZRIA 5EHXA 3L8YA 1ZONA 5IT4A 1N7GA 1J5XA 2HRBA 3ZX5A 5BT9A 5MDHA 2W90A 3QH4A 5LDDC 3G6EP 4G8BA 4DRXB 1UBTS 2FSSA 4DPKA 3T3NA 1CF4A 5GP1A 1A7UA 2AMJA 2WWHA 1ISPA 1DTWB 4EKEA 1U81A 5F23A 2ZVJA 4MRSA 4DRXA 2W2LA 2XCOA 3DVQX 4EVSA 2YHBA 1DTWA 2B94A 2YV5A 4JT8A 4RBNA 4BBAA 1DP4A 2JGJA 3QLVA 4Y7DA 1LBSA 2QQGA 5AM4A 5J5VA 5L7YA 4F2WA 1FDIA 2FETA 2YIJA 2CVPA 2C8LA 4MW5A 2J48A 3Q8WA 5DO9A 1XA3A 4JP2A 2ZIGA 3DDZX 3G13A 3QBVA 4HB2A 1GRVA 2FK7A 4LJLA 4CM7A 3C6MA 1A9SA 2HFJA 2RIRA 3IP6A 5BWNA 2I87A 2XBUA 3A27A 3ABRB 3RF6A 2WF5A 2RKWA 3D7LA 4HGPA 4R69A 3MOSA 4KQXA 3IBGA 2RJNA 4P9NA 3AF0A 3EBPA 4IDQA 1G5IA 3TIFA 4R40A 3WR5A 2O0LA 3U4IA 3OFVA 1ISRA 1INLA 1XB2A 2PMFA 1MF7A 3HCOA 3O21A 4JYBA 4D81A 1J0AA 2IYPA 1WB5A 1ZDMA 2GO7A 4FD3A 5J47A 2OV3A 3V4OA 5GADl 1PD0A 1LLUA 3H6KA 3FR8A 5JY1A 2MR8A 2XZTA 3ZDFA 4G1MB 3ANLA 4MW4A 3D8NA 2VUIB 3T7CA 3E7XA 2GAAA 1EHIA 2I67A 5KQGA 3HL4A 5F78A 2VQEB 2X0DA 1T9DA 3LP5A 3AL0C 2QT9A 4J1SA 5FBZA 3AFIA 4GMXA 3WNVA 2H52A 4OHFA 4X71A 3IOYA 4MDHA 1TVEA 3T5TA 4CGYA 2DWUA 5AVKA 1GZ3A 2NPIA 5AOVA 5JCJD 5JVDB 5AOCA 5I4BA 2BM0A 2I4NA 2YC2C 4BMCA 3G9ZA 3UQZA 3ZY4A 3GY0A 1KHTA 1XYGA 5JVDA 4OUDB 1XTRA 1KK3A 2V7XA 1MAWA 1A3CA 1F0YA 4JROA 4OUDA 4RF5A 2ZSKA 2DFLA 2W2PA 2YJGA 1FRZA 3AY7A 3G9XA 3P9NA 3PHHA 2XGJA 3HRKA 1G21A 3VZBA 2J5BA 1W76A 4M1SA 1WABA 2SCUB 3DZGA 3K9HA 2HYIC 4TS1A 4EL5A 1N9KA 2JAOA 2H6EA 2O2DA 1P1KA 4OIMA 4LQ4A 1JBKA 2GAJA 1D1DA 1OX5A 4OPMA 3TMYA 1HLFA 3VKGA 2IBTA 2Z2JA 1DWOA 1RLOA 2ZT6A 3U13A 2WIJA 3QNMA 1G8YA 4Q3DA 5FOVA 4AS3A 1Y80A 5LJIA 1HXHA 1T3ZA 2OCLA 5DISB 3SR4A 1BMFD 1KFKB 3Q1KA 1IXSB 1JX6A 4D8YA 3W5CA 5AJUA 4LMPA 3EQ9A 3V7FA 1SVSA 3B2QA 2IOQA 1YJXA 3BCRA 3GOQA 3QBDA 3SKXA 4KIUA 3SJZA 1BDMA 2R7AA 4CM4B 4URZR 3DLBA 2I6SA 4HQ0A 5B37A 3EEOA 4CCAA 5KO2A 3RADC 1RYYA 1H2YA 3CZ4A 4XLTA 1XTQA 3WDMA 4CM4A 4D9MA 1KZYC 2BGGA 1FA9A 2BMFA 1BEZA 3E8XA 3U4HA 3DJFA 1FP6A 3DWGA 3LZCA 2WU8A 2AS0A 2IZZA 4XJTA 3LAWA 3SYNA 4OJMX 1YZVA 4OXXA 5TQ0B 2A9PA 5HDQA 3ZJYA 2ZIZA 2AQKA 3HU5A 1ZN2A 4CNBA 5I9IA 3WAJA 3N70A 1JJBA 3TLKA 1ZUHA 4DC1A 4DE5A 1GQ2A 5B4VA 1Q95A 2BHRA 2I91A 4E2WA 2ADFA 3BJIC 2YBDA 1PV2A 5JNSA 2XIJA 1AKWA 4B6PA 2XIQA 3PEVA 3QE3A 5GTDA 5TS3A 5LZ5A 2HH9A 3E4CA 2CCJA 2FEOA 2NUAA 3D2CA 3E27A 1M0WA 4J0CA 5ALLA 5B53A 3T1NA 2XXBA 3AF6A 2YOHA 3NAGA 1N77A 2EKZA 5B58C 5L7TA 2BGNA 1GADO 1MDFA 3L6RA 2WT9A 5KVCA 1C5KA 1K7EB 3FM9A 1OWLA 3KHSA 3ND5A 2C4KA 1QIIA 3QEKA 3FNBA 4HDMB 1V5IA 2JFHA 3NIDB 2D54A 2NV2B 3PYXA 4OB8A 3WNCA 1PYOA 1EDOA 1RPJA 2ZEJA 2IOFK 4FYJA 4DC0A 1XF1A 2PWYA 1IIRA 4HDMA 2OCGA 5DE3A 3TSWA 4CFYA 2YYYA 1E32A 1F51E 3DEKA 3QU9A 2PWPA 3T06B 1Z83A 4RIFA 3KKZA 2PEYA 2MSWA 2C9BA 3DPHA 3Q5GA 4PLYA 3FBTA 3D1LA 2B3TA 3UHJA 4ESHA 4U8GA 3EARA 3HCWA 5C31A 2PZBA 4R41A 2GYWA 3U3RA 1U1CA 6CHYA 5BSRA 2AXQA 2V4ZA 3GT4A 3L1HA 4RSHA 5CXXA 3V00A 5EEGA 3LT5A 2GKOA 4UQPA 5K7SA 4F96A 3FAKA 3UAYA 1JXOA 4FS8A 4CMEA 3TQQA 2FZCA 5FB3A 1BHQ1 2XA2A 4P5PA 3GEBA 4IIHA 3SYKA 1ZD5A 4GOND 1C80A 2OOKA 5ALOA 4YWHA 3RSSA 4KVFA 3DD5A 1KYQA 2IL1A 4UVGA 2WF6A 1GZHB 3FZQA 1XZQA 3D8TA 3QTTA 5HSGA 3MCVA 4MHSA 1BE8A 3RU9A 1RKBA 4CM8B 2BBTA 4RK7A 4UAUA 5DCUA 3BWMA 2YFKA 3MJSA 1NONA 1DKUA 1SCJA 5C53B 2XMGA 1LW7A 2YWCA 2YJ3A 2YWGA 1N3YA 1TYBE 4AAYA 1ESDA 5KU7A 2AYZA 5ALWA 1U0SY 2CLKB 4FGUA 4Y2XA 1CDEA 4CM8A 2QXTA 1D6JA 2OXCA 5AJZA 4ZANA 3JQCA 4P2GA 1CYEA 4MVJD 1GGHA 3TS1A 1PG5A 1M8JA 3ZWBA 3LC7O 2ZBPA 2JH3A 3A6GA 1Y89A 4UMDA 5H3CA 1O4WA 5A5DA 1G98A 5KKCA 1V0JA 1VYVA 4NZNA 4QDKA 4I9HA 3UUFA 1JYFA 1B42A 3W90A 2Q5HA 3K7EA 1KORA 4NS4A 1CRQA 2PH5A 4S1OA 5EP2A 5I7OA 5JXWA 4PZ0A 3ZBQA 1PSZA 3TLBA 1UPUA 2MYNA 2QT0A 1F12A 2LCIA 5AO9A 2O5EA 1HO3A 4Q18A 5DEOA 1NJ6A 1EGVB 3GGOA 1FU8A 3ZIUA 1FVFA 2JS7A 3MJHA 1G18A 2EKPA 4JYPA 2HWUA 1BN7A 4AL4A 4PLGA 2CCKA 3CRMA 1M1KQ 3VNRA 2ZE6A 2BL4A 3FMPB 4BYMA 5ICGA 4YCAA 2XB9A 5LC1A 5EWMB 2J0SA 4LF5B 3VHRA 1YBVA 4I1VA 2HTEA 5I47A 3HQ4O 3E1KA 5ITWA 4OMUA 1D6SA 3E9RA 5EWMA 3O4HA 2O14A 3QVLA 4IEEA 4Y2QA 3W1WA 3HXPA 1QDUA 4B7UA 5B4UA 3NHFA 3OBIA 1EQUA 3A9WA 3BAZA 4Z53A 3EJDA 1VCOA 2BSXA 2EG9A 2FNAA 3DUFB 3NDIA 3FTEA 3MWEB 2UXBB 4ZVUA 1H0HA 1KRHA 1FBNA 3BFKA 2JB9A 2VKTA 4L08A 5LQRA 1W6RA 4W5NA 2C2KA 3DUFA 4NL4H 3OC6A 4N41A 3MWEA 1TADA 1WPRA 4WH0A 3WB9A 1OYOA 2IC5A 2QTVB 1EDBA 3L7CA 4YFYA 1E1CA 1KJIA 2HA5A 2MTBA 1UBRS 3SEAA 2M32A 1FQWA 1JSCA 1WY5A 2HIHA 2W4MA 3PQCA 4K9PA 4ZKEA 2YWBA 2OBFA 2QTVA 3CX3A 3O84A 4LSWA 1RPZA 2GDXA 2GGSA 5F1KA 3M4NA 1GFSA 2E4VA 1X3OA 1R0YA 5IM5A 3WMEA 4D4LA 3CLHA 1BX0A 3C5HA 3CS3A 4CLEA 3ZBTA 2JFZA 2PRJA 4GM0A 1NAHA 5TDHA 2YYSA 3PQ2A 3U16A 3DTTA 4KFTA 1VMAA 4R1OA 1QU2A 1H3FA 3LYUA 5DKFA 2XGOA 1ZYUA 1P1RA 4FXOA 2WJ6A 3DULA 4LXHA 2Q3LA 3FTCA 2BY4A 3S7TA 4JLWA 4F3KA 4KUHA 1KI6B 4GE3A 5F98A 5ER6A 1ZIXA 4QLAA 1KO7A 4MSUA 4OHKA 1AT1A 1HK7A 2JEYA 3Q12A 2WFMA 3EXG1 1E4OA 1GARA 1LQTA 2IXFA 3CMMA 1XKQA 3E3NA 4DR7B 3CC7P 1ADJA 3CX6A 3N6RA 1TE2A 4X60A 1I8TA 3SQWA 3X43A 3TQHA 2Z2KA 3DE5X 4O33A 1N8RQ 3NOVA 4LFCB 2JCGA 3CF2A 3GCXA 1OW3B 4HTFB 2JU2A 1ZN8A 4I1UA 1KYIA 3M70A 1K06A 3CHYA 4KDEA 3TLYA 3NAQA 2FUNB 1QNFA 4MAMA 2K87A 2JFBA 1KH3A 4HTFA 3IEIA 4PTZA 1GPH1 5FFNA 4RWEA 1E1DA 1D3AA 2XTNA 2EX0A 3BB3A 4B7CA 3A32A 5CFQA 5K5EA 4RFSB 3FE2A 1HYBA 2P6NA 4M7WA 4FX2A 5DX1A 4B3FX 3R3WA 3MB8A 2GZMA 1A76A 3H3JA 1IJKA 2X8JA 3GG9A 1RJDA 1WD5A 2XDYA 1DC4A 3ID6C 2UUPA 4RFSA 4WLNA 5TF0A 4EB6B 3ZHYA 3T0GA 4B6OA 2H31A 3LO5A 4H3KB 3AM1A 1JUDA 3E9YA 1HA3A 1Y1QA 4OYYA 2TYSB 4NFSA 3UAWA 4BN0A 1W9HA 4EB6A 5LWQA 4ARCA 2OCPA 1X7YB 4MR9B 2C9MA 3WL7A 4JUAA 5JHGB 2FMTA 4JNCA 1XZAA 2XNCA 2XUAA 2QX4A 1X7YA 3MS2A 4MR9A 2PGDA 1JMYA 1RZVA 1JVSA 3EJ6A 4FTWA 1NNI1 2B0CA 2C1ZA 1Q19A 3IOEA 1JBEA 1E6CA 3CM0A 3G2KA 1JGTA 1X1TA 1G8JA 3OWHA 5THQA 1E9AA 1N1EA 3R5TA 2VJPA 2I2XB 1KZ6A 4QJ4A 2PUFA 1WX1A 2DGDA 4N1AA 4U7GA 3ROEA 3VM6A 4OVKA 1U6JA 1YIJP 2C9ZA 2X22A 3NAMA 5I7VA 4K8OA 4UM7A 5HF8A 1HQDA 3D6NB 3K9FC 3PUZA 3CNOA 3PL5A 1MRNA 3OOHA 3QG5A 3LA8A 4Z99A 2W58A 3TPCA 1BE1A 4D1YA 4E32A 1E6WA 4N7BA 4BNWA 3BZWA 4OQMA 5MHTA 3DQQA 3HJAA 4AKSA 1VI2A 4R2WA 2B82A 3B5JA 1YTLA 2H85A 4MITA 3UPDA 1DNYA 3TN7A 1XJ0A 1U63A 3FVRA 2C61A 1HE2A 5TF4A 1K2VN 1DLJA 3OQ1A 5AHOA 1IY1A 3ELBA 4AXXA 4E70A 3KO8A 3A1UA 3PENA 2LIUA 2HKIA 1WUHS 1QV9A 2D74A 4H0NA 1RACA 3MHPA 3OZDA 3E70C 4N9QA 4Z7OB 4FN5A 3BBLA 5CDGA 3RG8A 5SY6A 2H1HA 3I42A 4A8PA 2C83A 1YI2P 4OD0A 2N3ZA 4FR0A 2WUGA 1PV4A 1QRDA 5JFGA 3I8SA 2X0JA 1JILA 2KQUA 3LYLA 3D3WB 4DMCA 2QU7A 1DXHA 3NT5A 1AQUA 1FS4A 3AGQA 2P0AA 3K5WA 4JGIA 4URXR 5ADWA 5IU6A 1CR6A 5UKDA 4JLVA 1S2IA 2C5GA 2ZB4A 3LOPA 1T8KA 3D3WA 4JVLA 4ZZ2A 4DMLA 4DDVA 2G80A 3L0OA 1W1UA 4KLNA 1Z8FA 3AI3A 5GY7A 5B1EA 4I50F 5CVVA 4ZRNA 5HJ5A 2X4LA 2R4QA 1AUOA 2B61A 2ZYUX 3HP4A 3N0RA 2O1XA 3PKJA 1OIVA 4O2BF 1VE7A 4P8RA 4PAWA 2TRSB 2PV7A 1XD8A 4OHVA 5AKKA 4DLXA 3TK1A 3RSQA 3UJCA 2X5NA 4WNCA 5ECWA 3EPPA 2QP3A 4MA4A 1E89A 1TMOA 3W6UA 5FHRA 3ITEA 4CU5A 3MINA 1Z9BA 1R88A 2ZJ7A 1GGEA 2OXIA 1OA1A 3FDIA 2P9JA 1JEJA 3NYRA 5DOZA 4DBVO 1OT3A 1YRQA 4HP8A 4F3RA 2DR3A 5GMOA 3TAUA 4RY8A 2B0JA 4FFVA 4LTDA 5SZIA 5CFPA 1ZMTA 2YNMC 3HB5X 2Z08A 4CWAA 3C3MA 3FUXA 4P98A 4N8EA 5JCZA 4HRXA 5E6SB 5BYKA 3DVLA 5IBPA 3BKXA 3ZE2B 3NVKI 2NSHA 2RGNC 4DA4A 2ZUUA 4YBZA 1GGNA 3EEFA 2C31A 1Z6ZA 2UZ3A 1ADFA 3RJZA 5E6SA 4L76A 4ZCTA 4OQFA 1LRLA 3F7MA 5LDHA 2XTJA 3NETA 5HGOA 2ZJ8A 4GPZA 2KX7A 2VIIA 4LHWA 2HO4A 4PGGA 3SG0A 1CC1S 3BXFA 4TUYB 4N0MA 2I8LA 2V7GA 4QGHA 4XI9A 4DV3B 4B7XA 1MPXA 3GGPA 3DKPA 4YJ3A 2OBXA 2B5VA 4TUYA 4RVFA 2VLNA 1LK5A 3D81A 5ALEA 5FTKA 3IQFA 4CF6A 4JITA 2PEIA 4O2LA 1JBQA 5TR9A 2A84A 3SICE 3W7AA 4NULA 2ZRCA 4GZLA 3HZHA 1RJEA 3TM5A 2O0JA 1EGHA 2GKGA 3RWBA 3S2ZA 4D6XA 4D9CA 3VPAA 5IHPA 3CTMA 1QUFA 2Z9CA 5TY0A 5IAGA 3ZHUA 4O4IF 3OX3A 4HWSA 3C24A 2IEAA 3D3EA 3KX2A 3PE6A 1ODLA 2FF5A 3PPYA 4R2MA 3BT7A 3ZXUB 3GJRA 4X7RA 3EWIA 1O0SA 2HR1A 3T3IA 4JU9A 1VKZA 1XFAA 2FPKA 2ZJ3A 2NAFA 3B1VA 3GK3A 1OXXK 2H1RA 4ZAGA 3R8XA 3DH0A 4NOJA 1NJFA 4R84A 2HQ1A 5K0JA 4ADSG 1RWXA 1EGMB 1VDMA 2IPOA 1X1AA 3AUFA 3OJFA 4HJRA 4S0XA 3SX4A 2X58A 4F1WA 1U80A 1PFUA 1UADA 5FORA 1A2QA 2FPWA 2EJTA 2HF7A 1WOYA 1C4OA 2ID8A 4MEJA 4AKGA 2AD5A 4I66A 4CGZA 1ENPA 1ZKDA 2XB6A 1PL0A 4RZHA 4YCBA 1RXYA 2VWPA 3TD9A 1K63A 3GH1A 1GKYA 1KKUA 2QRHA 3ANNA 2C77A 3F47A 1LI4A 4V0SA 3UOAB 3KC2A 1B0AA 1TQ4A 2XT6A 4TWIA 2VRNA 3ZV4A 4EJ2A 1Z39A 3FYUC 4DLNA 1YRWA 4MV3A 3TG2A 2VHXA 4M8KA 1AN9A 2FV8A 5DNEA 4C0QC 1YIDA 4LJRA 2F62A 2H7VA 3ZHOA 1JJAA 1JR4A 4ETMA 5CM8B 5AVQA 2KOPA 3TGLA 5LQCA 3LQ2A 4P1ZA 4QLBA 2GM5A 1DB3A 4FGKA 1U8TA 2YS7A 4HL6A 1FP2A 3BK2A 4EF5A 1H8EA 4N9WA 2H9AA 5BPHA 5B6IA 1DHTA 4G1VA 4X9XA 4G0UA 1HORA 1BXGB 1W25A 3AWIA 4S1NA 4EI7A 1LB1B 2GXQA 4F12A 1O5IA 1UBCA 2ECOA 2HMVA 1BXGA 7MHTA 3CLVA 1YNOA 4NR0A 4G0ZA 4OJQA 1FIUA 4E2YA 3S2SA 3VNQA 3LT1A 2PKWA 3V34A 1X1EA 3HGMA 3QPAA 5THKA 1OH6A 3N2EA 1XN1A 1JFVA 1FU7A 1I33A 1M66A 2WG2A 3PRKE 4MR7A 3V1LA 3CUEF 2WYWA 5JSUA 3AFOA 3C3KA 1YUNA 3N2GA 1PEDA 1DQSA 1U0BB 1ZNWA 1QKJA 2IOFA 2XV6A 4D74A 2AC2A 1B76A 4GBGA 4QQRA 5T6MA 4KLCA 3NM6B 5JXGA 4P2BA 4R1NA 4Y9TA 4ENQA 1RYHA 5BN1A 3AR8A 3EH1A 2R6JA 3L40A 4MV4A 2V7QA 5AXAA 4UBJA 1N2HA 3OICA 5HX7A 3A3NA 3IV6A 5KNCH 5ERYA 4U7PB 1Y5IA 1PW7A 4XWOA 1DAPA 3VPDA 2V6BA 1EGAA 3AQIA 4R8MA 4KIWA 3GLVA 1IPEA 2D8MA 4FM9A 1YFJA 1E2DA 1QIKA 3CEAA 5JDCC 2O0KA 2Y9MB 2P1DA 3ZCXA 3CEMA 4C7VA 1ZPDA 2VT2A 4LUCA 3FRIA 2BZ1A 1E98A 4EB0A 1PR0A 1UAYA 1ZH6A 3OUTA 4G97A 3ZD9A 5KQSA 4Y6LA 2NZWA 3JZMA 1W85B 3AVPA 6PFKA 1V3UA 3L8GA 5IKMA 9LDTA 3JQ7B 5C4MA 4QYSA 2EFGA 3QLUC 5CB6A 4XGIA 1N92A 1W85A 5HR5A 2JU1A 4MPTA 5IARA 1EB8A 4BOYA 2CLFB 3JQ7A 3GLIE 3TZQA 2R8EA 5KX5F 4MPPA 2J6IA 2VL7A 3TQRA 1UIRA 4QTZA 2ZDQA 4Q34A 4NK4A 3RBZA 4N3AA 4P0PB 4M0PA 3NBUA 1AHNA 2PEKA 3U48A 3V4LA 1J25A 1T1RA 3KEGA 4FZJA 5FBVB 3DDUA 2VK1A 4IGAA 3PX3A 4FDAA 3LVQE 3P71T 3Q1LA 4XFKA 3UGKA 1Z5ZA 2H3EA 4B3SB 1RDFA 2CJPA 3IDQA 3LNCA 1K3UB 2J9ZB 4G36A 1SN7A 1Y7LA 3TLEA 2MHCA 4HNTA 4JLDA 3EMKA 3JQQA 2ZVDA 4M37A 4D8VA 4PN3A 4JC0A 2XYQA 4KIFA 3ZNNA 2WU3A 1M67A 2WSBA 2ETVA 4H4CA 4P33A 3WLMA 2DJIA 1IZZA 5LYJB 3AKYA 1F17A 2FACA 4UUMA 4BNYA 3BRQA 5JEDA 4L5IA 3P4YA 2W6IA 5AKHA 5DYYA 4CM1A 1GRCA 2QUJA 4F8YA 1OB2A 5U9CA 4UE6A 4XYLA 1FVXA 4WK2B 1S7GA 4UBMA 2WJZB 2WI8A 4HWRA 4ZJZA 3V9AA 2YVQA 3W3AD 4AF6A 4F38A 1F6WA 2O2EA 4PICA 4B31A 2DFDA 3W8FA 1KK2A 1U3DA 3AFGA 5ADVA 3ABOB 3PSAA 3WYAA 1NDHA 2EBFX 3QP9A 4NHOA 5IDQA 4BS9A 1UL1X 1PR5A 2CL0X 5CW1A 1UJ6A 5J43A 4L9AA 1J0DA 1QSGA 3EWAA 2X0EA 1U8XX 1XVTA 5GWXA 2H1OA 3F8TA 2H9IA 3TECE 2WKSA 1KSJA 2PT7A 1Y4AE 1NVWQ 5K51A 1TD1A 2VHVA 1CHDA 3G59A 2HZ7A 4EFKA 4EGCB 1NVAA 2C5EA 3GHHA 1JSZA 3JTMA 1CF9A 1H05A 4A3SA 3PDCA 4UPEA 3I52A 1U9IC 4PZUA 1U0HC 3AILA 4EJ6A 1YVPA 2P2LA 4XDZA 1I3NA 4NZPA 2AFHA 1DTEA 1CR0A 3CKLA 4CKEB 4YAUA 5ELXA 3NMUF 3ADBA 3EGIA 3BWXA 4HGOA 5EP4A 4BMPB 4BLVA 1JHYA 3CLTD 3OE1A 2BONA 1M8GA 4CKEA 4DLLA 4BX8A 1F5NA 4YV1A 2I7CA 3ON5A 4OL0A 1PJ8A 2PM8A 3TXXA 4IIFA 1T1IA 1SEVA 4C07A 4KXNA 1RQ7A 2ZJ1A 3VMFA 3LLMA 3U4MA 1MO6A 2IZ0A 4BV3A 4GC9A 3H5IA 3QE0A 4CR7A 2XKKA 4DIEA 4REQB 3FHLA 4ZVTA 3WMWA 5CCDA 4GECA 1HE5A 5J4KA 2VWQA 2G1UA 5KSWB 4JSYA 4DLAA 3HSSA 1QIGA 4REQA 3MCUA 1EP2B 1AGYA 4D4KA 4GPBA 1JJFA 4PX2A 3T1OA 4DY6A 4Z4HA 5CA0B 3T1HB 1VB3A 2ZDGA 3QNUA 4UDOA 5LOVB 5A5EA 2LDBA 1UR5A 1YKGA 4BP9A 5ALYA 1COWD 1ESNA 1L4UA 3FD8A 4J0FA 1PZFA 2DT5A 1Q81Q 2CYBA 4IH4A 1ZRHA 1BH6A 4IHJB 3ZNQA 5LOVA 2WG1A 1T2EA 5EJ9A 4LGMA 2V7UA 1I3LA 3P20A 4IHJA 4WFKA 3QKRB 4TMWA 1QO0D 5LKRA 3EISA 2WWYA 3VVMA 1UT5A 3QKRA 3P9QA 2CW5A 2RHHA 1VL0A 4XUGB 2V3CC 4FHFA 1GSIA 3OOYA 1UP7A 4H7KA 2VF8A 4QWMA 4F45A 4YMLA 2HJRA 2NXJA 2OQ2A 4G81A 1XTIA 1FMJA 5HP4A 1T1SA 2P7IA 5FBQB 4D8TA 2CXPA 4J2HA 2CL6X 4LK2A 3C3PA 4BO5A 3AXTA 1X87A 1IK4A 2ZULA 1VSUA 1WLSA 3U4AA 2G83A 4KBGA 2WA1A 3CCJP 4UCQA 3RIGA 4RK0A 4LRQA 3CC8A 3BVPA 3SS9X 3AVVA 1GR0A 1TKRA 2QRVA 2ZJ5A 4QEDA 4C04A 2II6A 2IGTA 3WGYA 3TLJA 5JLAA 2GTPA 3PNPA 1H3EA 3DGEC 3KK0A 4WK0B 3SHWA 3EMDA 4YXWD 1XTVA 1Z3IX 3SIXA 2XVZA 3C6QA 4BCCA 4GT1A 2OYCA 2OTLP 1CQZA 1KO5A 4AJ9A 4B3JA 6ADHA 3ACBA 1VZ2A 4P7FA 4QYTA 4A2CA 3CUKA 5E9JA 4EF4A 4IJUA 2NX2A 3INTA 1EBBA 4E5PA 3LGAA 5AHRA 3PF8A 4C22A 4F4DA 3TWOA 1ZK2A 3FFBA 1T9ZA 1IDOA 1VG1A 3NEJA 3NIWA 1V5WA 2BBWA 2ZTUA 4XWAA 4EA6A 2XZLA 3GT0A 1CUFA 2E21A 5TXGA 5L7WA 4I46A 2OE2A 2J0QA 3COPA 2B4YA 3WZMA 4KWHA 1EIZA 3T6KA 5LDGA 3ZNOA 4QYXA 1TO6A 1NBOA 1Y7IA 2JPDA 2VYND 1VMKA 1WEHA 1V8FA 2RGNA 3AESA 3JW8A 4N7MA 5GZ3A 2V3WA 2I2WA 3CONA 3BFXA 4BWYA 2ONZA 4IDCA 4K6FA 4G0QA 4KNWA 2PYDA 1HE4A 3G79A 2GN9A 4D9IA 1RI4A 4YRCA 1GVHA 2PZGA 3M7IA 3TW8B 1VLZA 2B1QA 2VAWA 2FU5C 1GGFA 2DUNA 3GAAA 4PHCA 1YZNA 2COEA 3OI7A 4F86A 3H9CA 4EDFA 2CG5B 3TW8A 3CISA 3HCPA 4X61A 3U4DA 1AQNA 2ZITA 1XLVA 3D3JA 4BMXA 4C2AA 3HLYA 3V3KA 3AVXA 2QUZA 1R0BA 2G40A 1SCIA 4A73A 2OBBA 1PJCA 3M9WA 4Z7JA 3R9XB 3P32A 4QUEA 3E9MA 4YAWA 4PC3A 4E1VA 1U3FA 2WIBA 3L4JA 5EKXA 5HTOA 2WIGA 1GU1A 4OTZA 4LWOA 3CXCO 4US0R 2IEDA 5GJWC 1HPLA 4RLFA 2Y6VA 4DXHA 4UHBA 1UJ2A 2JBAB 5KINB 1V8PA 3HA5A 5BR8B 1GTSA 1H2XA 3OZEA 5JYEA 1QIDA 1V4BA 2O3QA 3GF4A 1SIBE 3PCTA 4PWYA 2JBAA 1C2YA 1UXIA 1ZWKA 2OXEA 3H9EO 4MGHA 4YRMA 4NCKA 3KPUA 1SQFA 2X86A 3CIOA 3WIBA 5BT8A 2DJ5A 2NZXA 2QN2A 2GPNA 1XZKA 1IULA 2CFSA 1JEQB 4MW7A 5LP1A 2XV1A 4ER5A 3D4IA 1N8TA 4EQ6B 2AVAA 2FPPB 4IX1A 2ZSJA 3ZVKA 3A11A 1JEQA 1YZKA 4U0EA 3KFXA 1C7IA 4WY2A 1D2EA 3AUXA 3DVSX 3JQ9A 3PLAE 3R9XA 4OSPA 4G25A 2FPPA 2GK7A 4H3SA 2OFWA 5K3CA 1CDDA 1Z6GA 3R6GA 4F3CA 4GM4A 2AXPA 1AXRA 2Y1FA 3DNMA 3GRPA 4G9EA 5G1OA 3Q8MA 4HEJA 1UKBA 1R37A 1P72A 1R4NB 1K9VF 4NBKA 1L8AA 4R83A 2JARA 1YO6A 2FQQA 4COOA 3C48A 1IOVA 3TBHA 3AUSA 5KTNA 2ZCVA 1R4NA 4ZOLB 5CD9A 1MX5A 3RSOA 1SUWA 1J23A 3C5EA 3K5HA 4LXXA 1R6UA 5FBWB 1ACPA 1Q2XA 2J3QA 2M8LA 2VZLA 1R8YA 2XYPA 4GRIA 4I55F 4YDHB 4DIFA 2IHZA 3R1IA 2Z8YM 4UE2A 1DAHA 3WO1A 4B9EA 4DMHA 1G6HA 1RYMA 1W30A 3KLMX 1D2GA 3FGPA 4M88A 4ZI2A 2I6GA 1QH9A 4FNGA 5AKXA 4ARAA 2HBRA 3G28A 3RE1A 2WDZA 1OZHA 1PHPA 4IP0A 3ROQA 1DC3A 1E4EB 1KVQA 2QIPA 4WZ6A 2CVFA 2RH8A 5JAMA 3TPFA 4WOPA 1E5VA 4E4YA 1GT6A 1E4EA 3SLRA 1DBRA 4UM5A 1EBUA 4WGFA 2VP4A 4L8GA 3N2NA 4PHTA 4YMVA 1R0ZA 1D4FA 3HVKA 1XP5A 5LZ4A 3RLIA 1RYBA 1QH8A 2GM4A 1L6RA 1ISMA 5KNDA 4GZ5A 3GEIA 2C07A 3N3BC 3VKHA 3HDVA 1KQGA 3E9DA 1QZXA 1K68A 4Y2YA 3FWYA 1KJ9A 1C1XB 1R8XA 1XA0A 4P7JA 4MQEB 1NBEA 1J42A 3FOWA 5ALQA 1E1QA 1DI0A 5EHZA 3THSA 5H4HA 3T54A 1TECE 2ZSBA 1QRUA 1C1XA 3JAKB 4MQEA 2LPKA 4RH1A 4YRRA 3F3YA 3RG6C 3BD6A 3PDIB 4MARA 1PLJA 5TSDA 4IIEA 3TRFA 4TZ6A 3KQYA 2IWHA 4YP5A 3RJ9A 3ZQJA 5ILGA 4BO9A 3R7LA 3O38A 1EZZA 2HMTA 1EMDA 3PDIA 4HGRA 2ZR0A 3UWOA 4ECAA 3IO3A 5AXBA 3IX7A 4ITRC 5AK0A 1CYDA 1QVFO 2CD9A 4TVBA 3AG6A 5BURA 5JDCA 3MHTA 3EG9B 4X91A 2GLUA 1OLXA 3P9KA 3UUGA 4N5DA 2ZRDA 2AMFA 3K92A 3RUHA 4KQCA 1FFWA 4H1TA 3AVWA 3EG9A 1DDOA 2Q5JA 3IUNA 4R1QA 2LF4A 4RJIA 2C8KA 1RE0A 2W43A 4HATA 2HMWA 4NNPA 3REGA 1A5BB 1X1QA 1XTUA 1WXWA 3G17A 1DKPA 4MK4A 5EWJB 1ZNXA 4EI9A 5KQLA 2EP8A 2P6MA 5AK6A 2REBA 1MQ8B 1CEXA 3TRIA 4FZ3A 1J9GA 2AK2A 1PVDA 2WAMA 5EWJA 2PS9A 5JZ9A 4ND7A 3TDKA 5M5BA 2A5YB 1P2TA 2CGEA 1OWOA 5JD4A 3RTAA 3BEOA 3A6FA 1NYLA 3A3YA 4Q7EA 1EH5A 2PX3A 2P2NA 2XE4A 2CV2A 1QVRA 3QWHA 2MOKA 1O8CA 3A9CA 1XZCA 2NU8A 2FKNA 1W5TA 1ZJWA 1J5PA 1Q1QA 2Y0PA 2G7MC 4FR5A 4WCVA 1L5MA 3IUEA 4DIDA 3FOFC 1EFVB 1MU0A 4ALNA 4LNUB 3JY6A 3A0RB 4MI6A 4X3OA 4E12A 5FFMA 5K8LA 2QGFA 3V8RA 4HV4A 5AKZA 1M9NA 1S3FA 1V3VA 3FPCA 1J9EA 1EFVA 3DHYA 3JATB 1OI3A 4KBFA 1DKQA 1XRSB 1ZH2A 1E9SA 3BN3A 4LNUA 2VDQB 1U2PA 3WJ7A 3V4RA 4FMDB 3HJFA 1BMTA 2VSFA 1Z18A 2AMYA 2WUWE 3U60B 2O8DA 4HDAA 3JATA 2OV2A 4MKFA 4RZXA 3WHKA 4C4YA 3AYXB 1F06A 2HUPA 4RA6A 4OXYA 3RK1A 1FVOA 1KTVA 4QUHA 3GZJA 5ICCA 4J0QA 4KO3S 2GVZC 3IAFA 3S68A 3F78A 1RP1A 2P2YA 4KUGA 3WK4A 4UHCA 1ZU4A 5FWYA 3IERA 3IUSA 3P4XA 2M6KA 2O1SA 3OE7D 3MG9A 1TKAA 2HU8A 4JC8A 3FI0A 1GTVA 3C3XA 3KTAA 5ICFA 4AYWA 2CDBA 4IWYA 2HX1A 5JMOA 1ESEA 1N1DA 2R7KA 2Z1DA 3GZ4A 3I45A 2BTOA 4IJMA 3V42A 3EMBA 2WMOB 1ZGJA 2JGKA 4KMRA 2HEGA 2O8BB 4GICA 2XEDA 5KP7B 1RM0A 2HWWA 1SBHA 2X8BA 2ZIUB 13PKA 3H0KA 1DG9A 3H9QA 1ADCA 1DKLA 4D3XA 1IJFA 1G2QA 3KZOA 1A4IA 1RSZA 2O8BA 4CMKA 5BMVA 4RS4A 1ECBA 1KMNA 1VP3A 2N9UA 5SYNA 3M1MA 1X77A 1RE1A 4R3UC 1A2KC 1YD7A 2X8AA 1EX1A 3K1AB 4L15A 5F4BA 3TTTA 1RWWA 1PJBA 1LX6A 3K2EA 1DT5A 1U9IA 2VPQA 3GFGA 3P8ZA 5F9MA 2IH4A 4YRFA 3K1AA 1HRKA 3WZLA 5B1DA 1Y5LA 4DG8A 2LMLA 1F2UA 1LTKA 3HYTA 1DDGA 1XXLA 1LGYA 2H7CA 1H1LB 2PLFA 3LFUA 3BHJA 1FJHA 5JQWA 3GV0A 2NVOA 3ZH9B 2DPMA 3WKAA 5K01A 3O47A 2BMJA 2FAXA 3B3QA 1H1LA 3L8FA 1J90A 3KDAA 4ZV9A 4RTJA 2WZQA 2ZBRA 5EGSA 3SOZA 1XX6A 4PH0A 3VH2A 4M1WA 4CEIB 4RQBA 1F20A 3VKWA 2VXYA 2OD2A 3ZHVA 4ENUA 1OYWA 5CBPA 4CEIA 1SUIA 3MZ0A 1GKLA 3NGMA 4EMUA 3AEUB 4HKGA 3I9V6 4OX9Y 3H1AA 4CODB 5I5GA 9MHTA 4HSEA 4TTRA 1MJFA 2VJMB 3ETGA 4P58A 3S40A 3OCUA 3ZUGA 4DCVA 3PXDA 1DRUA 1XQXA 4LDZA 1VQ6P 3ECAA 2VJMA 1JDVA 1BMDA 1XMVA 5KTPA 2XRZA 4OSEA 4BQEA 3SNKA 4XWYA 1NN3A 2MSLA 4GP7A 3ADKA 3ZD7A 2O0MA 1RHQA 4PLTA 1TVKB 2Z6VA 1D2RA 2BP7B 2W2VA 4IV0A 1JG3A 1XGKA 3E0QA 5DBFA 3T94A 1NVTA 5F2KA 2IDMA 3JYPA 5BQFA 1PJSA 3LHDA 4IKEA 3GGDA 1TVKA 2H4HA 2Y67A 3GO4A 2BP7A 5K3AA 3WJ2A 4B79A 1ZIPA 1SUAA 3FKSD 2XA9A 4J7XA 3R7AA 4LFAB 5FLYA 1C4KA 5CM2Z 2WR8A 4JR2A 2VQ6A 1MZ8A 4OJYA 3WLEA 1KFEB 1U2SA 2A88A 3CRZA 3ZD8A 2VPWA 1JB9A 1PDWA 2FFQA 2J67A 2GKSA 1U28A 3PHIA 4HN4B 3USES 4AT1A 2YTZA 1K92A 1XBTA 1Y5NA 4MIKA 2Q1SA 4K28A 4Y30A 4D02A 2P3LA 3N2YA 4YDQA 4UM9D 3VPCA 2PU7A 4I9NA 2AZDA 2VRWA 4PNPA 1R16A 1C0LA 1AB5A 4ZCMA 1L0BA 4RV4A 4CKWA 2YZKA 3EWSA 2FSVC 2QE7A 3A6HA 3I76A 4NYJR 5SZKB 2J3EA 1ORRA 2F8SA 1PT8A 3WYDA 2FRXA 1FYWA 4O3MA 2ZRJA 4E1BA 3C3CA 3VR0A 2EG5A 1PR2A 2JHAA 2C42A 3T7DA 3CCRP 1XZMA 3HXLA 4Q1AA 2LXNA 1RO0A 2AOXA 2AUTA 4JDUA 4UUBA 3UO8B 2YINC 5KYXB 1KAOA 4O02B 1P4AA 4W9MC 1VKJA 3ZK8A 1C8BA 2F2TA 4KSBA 5KYXA 1XDSA 2FTKE 3MCZA 2G0AA 2OTCA 4KQGA 5GV7A 3U49A 4DNQA 2B5WA 2PRYA 2G3YA 1DCKA 2IQIA 2Z5FA 3O92A 4LRYA 4FEYA 1Z4KA 2BOVA 4ZQGA 4LF7B 2I2BA 3RUFA 5E9WA 4JENA 2VXBA 3QW2A 5EXTA 4TXJA 1N6OA 3BAFA 3L4KA 1HC7A 1TO1E 3H5RA 4Y6GB 1AK9A 5K0NA 3C74A 5IVKA 4UNPA 3LKZA 2PEJA 1AK1A 1KOJA 2O0HA 1ZD3A 4IRMA 4EKGA 4C2TA 5KSYA 2YRFA 1GCGA 3FZYA 3PGA1 4JFAA 5HQJA 3RKRA 5LFAA 1G41A 2SBTA 1LRJA 1S2DA 2GX6A 4W6QA 3UK0A 4C21A 2GCPA 5JI3E 1TGVA 1KIMA 1QFMA 2E9SA 4D6YA 1SVOA 4KYUA 4EW2A 2QYTA 2W98A 4R5HA 4B5LA 1P6QA 3GGGA 3A6LA 2WJIA 3TTWA 1X7WB 2EVWX 4B6SA 3VOSA 1U3TA 1CY0A 1E8MA 1TQ6A 3GEEA 5SYMA 2JFPA 2JIZD 4KR0A 3E48A 1X7WA 2TS1A 4GLJA 5FFFA 2DT8A 2YXPX 4DJEC 1WHSB 1ZP6A 2G25A 1XEFA 2IYQA 3GJXC 4KLZA 2VYVD 1JL3A 1HTBA 4XVRA 2WWFA 4KEAA 1PUXA 2UKDA 3AMVA 2YCBA 3T7KA 4BLSA 1PBTA 2PGAA 4RK5A 1C8VB 1FVHA 1WHSA 1O94D 1P0PA 2CYCA 2V7PA 3F9RA 3HUFA 3ISVA 3MD9A 3PHCA 4UJ3A 1VL1A 5F5LA 1QYDA 1SBZA 3QVVA 1Z7YA 4OHPA 3GA5A 2GWHA 4WHMA 5TGZA 4JYZA 5A2QA 4RMJA 2IV3A 4YMTA 2FWIA 4IGFA 2DBVO 5ENZA 2LCQA 1N8NA 3F7TA 3E82A 4FFSA 4OBWA 1W36C 2ZBUA 2HA0A 5D51S 2OYSA 3S2GA 4K1XA 2GZDA 2ZR8A 4JLSA 4EG7A 2HT1A 4MMXB 4B74A 1SUDA 4O4HF 4KR3A 2VHUA 3VR4D 2X3FA 2B2CA 2FN3A 5CAEB 4Q03A 2PKXA 3D64A 1I10A 3ERCA 3KSRA 4DXAA 1NYQA 1KI9A 5AJHA 1P62B 4GW3A 1X7HA 1MABB 2PKRA 2PH3A 4WUTA 5KOJA 1AHPA 4B73A 3FSGD 3HKDA 3AERA 3N5KA 1NOIA 2OCIA 3CRVA 1PWHA 1MABA 4D57A 2V5AA 3LJKA 4DV1B 1NZDA 1UMBB 4JOCA 2VJBA 4JI2B 5DLDA 2HRQA 4B2PA 3SSOA 1YI0A 1UODA 3LOUA 5EPOA 4RVUA 3NEAA 3A3KA 1UMBA 3FIJA 3IVRA 4WRRA 4MGIR 5CR9A 3RS8A 4B40A 4REOA 1V5EA 3CLUC 3CVYA 1Z35A 2OPBA 1D04A 1T5SA 1JT2A 3E9CA 5DYNA 1N9ZA 2EZUA 4HBGA 4HSGA 1E94E 4E4RA 1ETUA 3CIFA 4N6GA 2XOKA 3HJNA 1GG2A 1H2FA 1ZBQA 1WZUA 2BE7A 3D6AA 3KKPA 4GMKA 4DDKA 3DV9A 4KRYA 2EOAA 2LP4Y 1IHXA 1E4YA 3WXBA 1NQUA 3T1TA 1NXWA 3EIUA 3IQEA 3RC1A 3TFWA 5BN3B 2ZBQA 1BU5A 2NXNA 2JEZA 4RTOA 5LP6B 4PG6A 2L19A 2VPXA 4HDSB 5BN3A 1Z33A 2HO5A 4K9LA 5LP6A 2IYLD 2HW8A 3CZMA 4HDSA 2OENG 3N8IA 1RPTA 5JTTA 2RGYA 1XZEA 4CXMA 4BU1A 1TEZA 4TL8A 2OHHA 4WQMA 2W70A 4OI0A 2O50A 2FEKA 2QG6A 1XMSA 3GPLA 4DAOA 1BGWA 1Z2AA 2QVLA 2R86A 1RXEA 1V9CA 1IOWA 5LNK6 4ABTA 1YR8A 1P60A 3KP1A 2FY8A 3OM8A 5G0SA 4KNVA 4YRDA 5COBA 1W44A 2I7VA 1WKVA 4RJTA 4KC0A 3UAGA 1OHHA 1P4HA 5B6JA 2GSWA 2PL5A 3BMCB 3DZCA 4GGOA 3MCAA 2WWWA 5E95A 1XPRA 1Y8QB 4MQ6A 3SQLA 2HI0A 3BH7A 3AB3A 2IF0A 3AHJA 3GMIA 3BMCA 3WB2A 2ECFA 3I6BA 4YS6A 1Y8QA 2P90A 4TLCA 1E2BA 1JKIA 4F7WA 2QX6A 3OWXA 5FNVB 3OE4A 4F06A 2J3KA 3VDRA 4LVUA 4OAPA 4X7BA 3K71B 1AH2A 5C9ZA 2WSIA 2BMEA 3KTFA 3L8EA 2PS0A 3B78A 3PC8A 4GI7A 4QYIB 3E05A 1C7QA 3PQFA 2JF0A 5AM0A 1IWBB 4ZAWA 4A9AA 4PX5A 4EYOA 1JF8A 4HH3C 4IJ5A 3CN9A 4Q02A 4QYIA 2E18A 3IODA 3OKCA 5HMMA 4MVJH 2P91A 2P3SA 4CQMD 3A0UA 1GQQA 1T91A 2G82A 3OFNA 2FPUA 1SIWA 5G1PA 3RFCA 3TVTA 4NY1A 3JQBA 2V4UA 4NU0A 1QO7A 1AUPA 2AJCA 4V0RA 3CZPA 2AI3A 2ODWA 3ETEA 2AYYA 1W4AA 4IEIA 3IXLA 4V1CB 5ARBA 4P0TA 1G7SA 2R8RA 4DLPA 4FYYA 2F4VB 3SQOA 1L4MA 3FWZA 1Y63A 3ESZA 1BD3A 1PTKA 3WGZA 1UKYA 4V0QA 5D1HA 4M53A 6REQB 3D2BA 2P78A 5BWBA 4AWXA 1TPYA 4LDPA 2A1TS 4PSVA 3EOZA 1MBZA 2PANA 2OV6A 5EKUA 1K7SN 3S2IA 6REQA 1NR7A 2GZIA 4K05A 2VRCA 3HNOA 4PXAA 5FI5A 1D2HA 4MQMA 3NHKA 4B75A 2XODA 4EKIA 4I0WB 1GCAA 2PKEA 2V1XA 4MA0A 1UBMS 4MPJA 4P3KA 5EKDA 4DL9A 1NVMB 4EGJA 1ILEA 2GDYA 1IXZA 4B2IA 4O4JB 5EMNA 1LX7A 5EA2A 2Q3HA 3UG6A 2FJUA 2J9FB 4H2DA 4YRKA 3O7MA 1V5FA 2Q3MA 1Z4JA 3L82B 5EKTA 3UJHA 4UTRA 2J9FA 4A8JC 4I7EA 5IXYA 3DBVO 4NP6A 4B6EA 2WSSD 3JZIA 1ZI9A 1UPFA 3UUEA 3CT4A 1FP4B 1JA9A 1QYCA 1CJKC 2ZTSA 3QE4A 2OPHA 4EPXA 5A9TA 5BMOA 3UQYS 4U6NA 4WCFC 3UUWA 2ZSIA 4RULA 2Z8ZA 4WLEA 3NVAA 1FP4A 2X13A 4YHBA 5J5AA 3U5TA 5EERA 2EKDA 5IVPA 3IBFA 3HG7A 3CJTA 3K6SB 3S4YA 4F72A 2I2DA 3DTNA 3PNOA 2AWNA 1Y8ZA 4MI3A 4R54A 3K6SA 3VR1A 3K5IA 4FLMA 2AQIA 4G67A 5F51A 5IBRA 3TLCA 1U9YA 3EIOA 4IJKA 1VQ1A 2VI5A 3RPEA 5JSHA 4XCXA 3U81A 1LUAA 4D56A 4LYFA 1ZNQO 1J2JA 3PBKA 3TTUA 4BNNA 2CE7A 2IY9A 2R5FA 3PWSA 1JIUA 5BNTA 5FBKA 2HLDD 4BQPA 1QJ4A 3PQDA 2OY0A 2HDNB 3QX7A 4LE0A 3ZWYA 4NCAA 4W5JA 1TCBA 3RABA 3VH1A 5JJLA 1E6JP 1T0PA 1JQ5A 2H2WA 2O8NA 2GN2A 1QX3A 3G9TA 1E9EA 3OZFA 5IK2A 4JI0B 2TMDA 4RH3A 1RRFA 2AXEA 2ZZMA 3IIEA 1I9CA 2Z3WA 3OJOA 2VLPA 4DREA 4NXMB 3FW1A 3K3PA 3PZBA 1IXKA 1GKKA 2NSYA 4IH1A 2VDMB 3BE8A 1PE0A 2NM0A 4V3BA 4K9SA 4ZVVA 1ZRNA 4C3OB 1RKVA 2UUCB 1JG7A 2AI1A 3CEPB 4X90A 3C3BA 3QKSB 2LIVA 4UMVA 1JHMA 1OFTA 1YS6A 3KB1A 1YB7A 5A1TA 4PPGA 4Q4LA 1DAOA 4P4SA 3VNSA 3VYUB 3AHEA 4IOLA 3K0SA 3QKSA 3GT3A 4C1NA 4DABA 5KYUA 4JFRA 2BFEB 4IVRA 4Q9NA 4EATA 3U44B 2YY5A 3W2HA 1H4QA 5CLFA 2RJ3A 1FFAA 4J4TA 3V1YA 3KUXA 4RETA 3I1FA 3OPYI 2OG2A 4S1PA 1MH9A 1JHQA 2BFEA 2FEWB 2WHRA 1HY3A 2ECQA 2QGNA 3OZIA 4FCVA 4DPLA 2JIOA 2CVHA 1DXQA 1VI5A 1Z4MA 2CBZA 3MAJA 4TTJA 2NZJA 5EHQA 3OKAA 1L8XA 4XYEA 3R5KA 1JQKA 3R5SA 2ZT8A 3RF7A 7MDHA 1YL7A 1JR3A 2H57A 4D3FA 5KAMA 3DWFA 4DJAA 4RTKA 4R8SA 3CB4A 4BATA 4MGZR 4GMDA 4DILA 1KFCB 5FTMA 2HMSA 5KCZA 1QGAA 4NI5A 3R3HA 4N4AA 4I36A 1YBFA 1PR1A 2IRWA 5J2UF 4JK3A 4UZEA 3F5SA 4Z4IA 3GRYA 4HUQB 3LT2A 3C6YA 1PYGA 2C5AA 3WL3A 3RS4A 2VF2A 1L5OA 1R10A 3R6LA 4AIIA 4ZI7B 3UT5A 2BBSA 2OD7A 3QPVA 2JHGA 1Y5MA 3QFSA 1RXIA 1GQRA 3FLAA 4R2IA 3AI1A 3P0HA 2GBLC 2R62A 3MUNA 2CJYA 5ALSA 1R9JA 1PDVA 4LQCA 4LYDA 4IJ6A 4S24A 3WJ1A 5EAIA 3V5NA 2C2XA 1SOWA 3FUUA 4BRWA 4AY4A 5BUCA 1LK7A 5DTIA 2A7QA 4IR7A 4ZU6X 2AF3C 2FSVA 3PDWA 4TMXA 3OT5A 4ONEA 5BN4B 2PR2A 4U6SA 3RU3A 3UV3A 3VC3A 3BWVA 1RRPA 1BH2A 3GZTB 4PLHA 3K15A 5H83A 4F6LA 2UUBB 2V74B 3IPRA 2XQVA 5BN4A 2B20A 1RKQA 1KR5A 5AQ1A 2JGFA 4YRPA 4ZU1X 3MCWA 3JR7A 3PEYA 2DX7A 1MA3A 4OQPA 1U99A 3RV4A 5KIAA 5DDIP 5D5PA 5DM70 4GXTA 4YDRA 2HIAA 4RENA 4EWLA 2BM1A 4HQOA 1SG9A 4MV5A 1G6Q1 1Z12A 1RC8A 4BVHA 2XYHA 4V0LA 4KG7A 4GR5A 1OYYA 3CRW1 1PL8A 3S6JA 1X1BA 4YAJA 3TQTA 1C1YA 1UMDB 5IT0A 1N5JA 1VCIA 3BILA 5FO1A 3ZWQA 1G4HA 2F55A 1M6YA 3QMVA 1NN1A 2QGZA 1I24A 3MT8A 3R23A 1PI3A 2XCQA 4FFDA 4L4SA 4DLSA 2GZGA 3GRAA 3KLOA 1FFSA 4MLPA 2GI4A 4EPYA 1GTL1 4QOJA 5B2FA 4MULA 1XCJA 2EQBA 4YEDA 3SYTA 1PNTA 1DV1A 3R20A 3A2KA 2XUFA 3A4YA 1R4MB 4QUKA 3FKQA 3JQAD 4RW0A 3RGGA