1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
1N8RQ 1YJ9P 1KC8Q 1K8AQ 1VQ4P 2QEXP 1VQNP 1YHQP 3CCJP 3CCVP 1YITP 1K73Q 1W2BO 1K9MQ 3I55P 3CXCO 1KQSO 1YJNP 1KD1Q 1S72P 1VQ9P 3G4SP 3CCQP 3G71P 3G6EP 1QVFO 1Q86Q 1Q81Q 3CC7P 3CCSP 1VQ7P 1YI2P 1YIJP 3CCRP 2OTLP 1Q7YQ 1M1KQ 3OW2O 1QVGO 3CCLP 1VQ6P 1M90Q 1VQMP 1Q82Q 3CCEP 1VQKP 3CPWO 3CCUP 1VQ5P 2QA4P 1VQPP 1YJWP 3CD6P 3CC2P 1VQLP 1JJ2O 3CC4P 2OTJP 1VQOP 1NJIQ 3CCMP 1VQ8P 3CMAP 3CMEP 3I56P
chains in the Genus database with same CATH superfamily
1VQ4P 1JCCA 1GW4A 2FFDC 1NTMD 1OVVA 3P8CD 1BE3G 2GZIA 1IFJA 1RE4A 3CWBE 1OMIA 4I7ZB 3K5BA 3PRJA 2YNYA 2FADA 3MUDA 5EFWB 1NTKJ 3L74D 2Q9IA 3EQ2A 2JYGA 5GTIE 2JJLA 1JM0A 1YJ9P 2BHVA 3G29A 2CWOA 2Q6QA 1DX7A 2KW2A 1AQ5A 2HPCA 1HF9A 1L0IA 1JB0J 4L76A 3RK3D 2MJZA 1FZAA 3I5CA 3GHGB 4EI2A 3VTPC 3A0BH 2O01H 5HVCA 4GODA 2JGPA 1QGKB 2MVUA 1XTGB 2E75B 2RN0A 4CPGA 4U3FG 1KD1Q 5AVSB 2PEJA 1PP9J 1JEKA 2QVAA 1EZVI 2JU1A 1ZRTD 1VQ5P 2OYOA 1KQLA 1FU1A 2AVAA 3VRLC 1M56D 2CK3H 3RBXA 4A7PA 3FWNA 1KFMA 3L35A 2N9BA 5B5EH 1DIPA 1SFCD 1EDLA 4F37A 3P05A 4R0MA 4YPCA 5AVQB 2MKVA 2EHSA 1R5SA 2P58A 2KGAA 2KNCB 3V5BA 1FZGA 1VDFA 1NTZD 3MHVA 3CXHI 4U3FD 1N7SC 1FS0E 4PXHB 4XFXA 2M8RA 3H0DA 2L0QA 3MIWA 1S5LX 2FFDA 1BGYG 1PEOA 3II6A 4RJTA 2PEIA 3H1KE 3CXHE 3A0HE 2JO1A 3KZIH 2LKIA 1BCCJ 5M1BA 4C46A 2K0YA 3L70D 3D6ZA 2WPSA 1PEQA 1NWQA 1NYHA 2PP6A 2WPRA 5CCHC 1L0LK 2W8ZA 1NTMK 4D6TE 1GZLA 3L72J 1KILC 4WWIA 1AF8A 1CW5A 3GJNA 2V7QH 2Y9ZA 1IZNB 1PIXA 4XFZA 4GDOA 3Q2YA 1L0LE 3OAKA 1F80D 1JMBA 1G2CA 1LTJB 3A3YB 2HYNA 3L75G 1NTME 2A06G 2Y0EA 4LGDE 1SQPG 1DD3A 1S2EA 2FYNC 4XROA 3Q5RA 1EDJA 1FJKA 2H7HA 1NKNA 1W5CE 2DGYA 3KHUA 4OGQD 4Y99B 1YYCA 2G8YA 3IF4A 3CC4P 3ZDMA 3CMEP 5AVUB 2XU6A 2KSJA 2NPSD 3V2QA 1GD2E 1JOCA 3C8VA 4H13D 2AEMA 3HE4A 2KG8A 5KP6B 1SQVG 3WUVA 3CCRP 2E5YA 3H1LE 3CCUP 1M74A 1S4XA 2WITA 3AEGC 3G0VA 3NXSA 3LW5H 2N1TB 2WZ7A 4EDFA 3GZMA 1GDTA 2KP8A 2A06D 1BE3E 2GUVA 1E5WA 1NAYA 3HYBA 2M5AB 1N7SA 2QJPC 3F89A 4ZKUA 1VF5D 2ZAEB 3HE5B 4WY4D 4IZ6A 2KG6A 4K35A 2WSSH 2K88A 1QVFO 4TT3H 2XZRA 3L75J 2B9BA 1SQPJ 2YKQA 3G9RA 4IFMA 1SQQD 5F2OA 1L0ND 2GDWA 1VQOP 2BCCJ 5CCHA 1URQD 3BCCJ 1DH3A 3H47A 2E43A 2GZFA 1ZNVA 3AE2C 3H1IG 4U3FE 1KILA 2WPTA 3Q1MA 3AE7C 2KGCA 2A45H 3NFQA 3PJSK 2L4BA 3QWOC 1PL5A 3LRYA 5KP8B 2WQYC 3RK2C 1LTGC 3E2DA 1FE6A 3G28A 4DOJA 1YQ3C 2KWLA 1YITP 3LIDA 4OVNF 4COPA 2LR2A 1IMPA 1M1JC 1QVGO 2HLOA 1Q82Q 5KTBA 2E75D 1XTCC 1KN7A 4I6MC 3CD6P 3D70A 2P67A 1EC5A 1X3OA 5HGOA 4IFFA 3CX5E 5BU8B 2YMYA 4UHPB 4XE5B 3VP8A 2RKLA 2D2CC 2YIUC 5EJDA 3H1ID 5APYA 1KQFB 1AJYA 3TK1A 1ZP0C 1UNKA 1YI2P 3Q3DA 2OYIC 2V4HA 1USDA 1BGYE 2O01N 3H1JG 3VOPA 1GTWA 4H2XC 2L5GB 2XDJA 3L73J 4UB6H 3U43A 4DJGA 4IOIH 3H32B 3AEDC 1OVUA 2E42A 3MP7B 3HD7D 2VLPA 3GMAA 4JBZA 1QEXA 3ITKA 3BRVB 2Q3EA 1L4AC 2N98A 4DG9A 2KOPA 3TNUA 2Z5HA 4UB8H 2OYHB 1PV3A 2E76C 2K3RA 1HBWA 2YO3A 2OTKE 1SQPK 1KYOH 1S5LH 3M9QA 1HJBA 4JF7A 2XV5A 3L75E 2H89C 3H6PA 2A06E 2MR7A 1SQPE 3WUUA 3B4QA 2LMLA 5HGNA 2O1KA 1RO2A 1SFCB 2ZYDA 2FXMA 1KC8Q 1SQVK 2JBGA 2XNXA 3CWBD 3A7OA 5DJUB 5KP7B 1S72P 2VLOA 2IZ0A 1L0NK 1YIJP 2P9XA 3HRNA 2C0XA 2C0WA 1SQVE 1EXIA 3A0BE 4H0LD 1KB9H 3SWKA 3T97A 1CZQA 2B87A 3G26A 3V2PA 3H1JJ 4RO0A 3L71G 1M1JA 2E74C 2A45G 3B5ND 3L4FA 1N8RQ 1QX8A 3CLQA 2JAZA 5KJ7D 1GU4A 4EIJA 1K73Q 1PGPA 1M8OB 1RO0A 1VQ7P 1LTSC 3CI9A 3PH0A 1LWUA 4WBAA 4BRYA 1RE4C 1JY2P 4U0EA 5B5EE 2KSEA 1IFIA 2OYIA 1GK4A 4C7RA 3N7NA 5KKZB 3M9HA 4YTPC 2XXMA 2PEQA 3AEBC 1RHZB 2EG5A 2XKMA 1EDIA 1M6NA 2PY8A 2N1TD 3MGNA 5CCGD 1USEA 3TGUJ 4GOFA 1GL2B 4R4LA 1PPJG 2KK7A 2R44A 2WTYA 4DZOA 2W6BA 1L4AA 2POHA 3L71D 1VL2A 5AVWB 2K9YA 4PJ0H 1K30A 4I2LC 2BEZF 2VRSA 1LP1B 3G6EP 5HV8A 2IX7C 1BAJA 3H1IE 1NTKG 4L75A 2R3SA 3KZIE 5K5GB 1YJWP 1JY3P 4H13B 1NO4A 1NQ4A 1S9KE 4H44C 2FYUJ 4GOEA 1K9MQ 3MD0A 4IL6X 5DJTB 2M3EA 2IBZG 4N6JA 3LMOA 2AXCA 3H1KD 3CXHD 3RL0C 2KZIA 2K94A 2KIKA 1X22A 1QL2A 2FVFA 2N50A 1NKZB 1G1JA 1AUMA 1DD4A 3B71A 1QL1A 3RG2A 1VF5B 3JCUH 3O6QB 1PP9G 3W68A 4YXDC 3E1RA 1VQ9P 5KLIB 3V2RA 5AW7B 1IJDB 1NTKD 2KORA 4D6TD 3VMXA 3DS0A 2PENA 3U1CA 1N7SD 3NY7B 1ZLLA 3H1JE 5L8RJ 4NEOA 1BXIA 1LTJC 1L0LD 2L9FA 2DNWA 1VQNP 2KG9A 1BSHA 2Q1KA 2IBZD 4JYBA 1SQBG 2WMMA 1FZCB 1KYOD 1RF1B 1URQB 4Y99C 1NVOA 2K92A 2K0XA 2GYKA 2M8LA 2IFMA 1PP9D 2N9YB 5AW4B 2LXBA 1AVOA 3H1LD 1M90Q 3M06A 3HZQA 1J1DB 4PD4H 1AFOA 5KAFH 2QJYB 5AW0B 1BCCG 2RH0A 2FACA 2KNCA 2OARA 2B88A 1BE3D 2XV6A 3G71P 1ZV8A 4JPZB 2A45I 2FBWC 1Y8AA 1QRJA 3L74J 2WPQA 3L72G 1SQXJ 3F5HA 1IFMA 2OTJP 2W6JH 4W7YA 3KQGA 2ZT9C 3AEFC 3L71E 4KHXA 5TJHA 2JWAA 4U0DA 5BVZA 2KB7P 1U57A 2M0BA 1LT9C 2BUOA 1SQBJ 3HD7B 1JMMA 1CI6B 2WT7B 7CEIA 1AVYA 2XNDH 1VKUA 4KT0J 2CQ8A 2HPCB 2W83C 4TLFA 1LTJA 5BS1A 2FQ0A 1KLPA 2WWWA 3L72D 2LF4A 2Q7CA 1PPJE 4XFYA 1NTKK 3Q5PA 3KYQA 3ABVC 1YTZT 1LJ2A 5EW5E 3TDKA 1Q86Q 5C39A 4GKGA 4UB6E 1IFNA 1NTKE 2FVAA 3TF5A 1LTAC 1N7LA 2J59M 3AEEC 3R4YA 2GZGA 1JTHB 1A43A 3CX5D 3QH9A 1ZXGA 2IBZI 2Y0CA 3HUSB 1KYOI 2KGDA 1GL2D 3GF3A 4H0LB 2P7JA 4UB8E 1HGVA 5BS2A 3B5NB 1BSNA 2IDBA 2IBZE 1BGYD 1FZFA 1KYOE 2M5AA 1S5LE 2HR3A 1WRGA 2YO2A 3D71A 1WT6A 2BCCG 4B86A 3RK3C 1E0HA 1GXHA 3BCCG 1T8ZA 3HE5A 3H1HJ 4AYCA 2KS1B 1JNMA 1PP9E 1TU3F 2GDXA 2OYHC 2PRRA 1L0HA 3DS1A 1HGZA 2H88C 2RMZA 5AW2B 1KILE 1KB9I 2AF8A 4IL6H 2D2CD 2KOOA 2B89A 1LT9A 1YHQP 1T2KC 1NH4A 3L75D 2VLNA 1KB9E 1SQPD 3AEAC 2K1AA 3N4XA 1SFCC 3C9IA 1NOHA 1SQBE 1AQTA 2KLUA 2BCCD 4AUWA 3NTEA 1A02F 2J5UA 1ACPA 1SLQA 3B4SA 4L73A 1MZ8A 2LIWA 1H8AA 2K9JB 3AE8C 1SQVD 1OXZA 3L73G 1D1DA 1Z6MA 1J2JB 1G1IA 1BCCE 1J1EC 3CCJP 5E79E 4NPDA 3M0AA 3AE3C 3V2NA 4BWNA 3HTKA 1JY2O 1OIPA 2N5IA 2LKMA 2N5HA 1X8YA 4PJ0E 1AYIA 4W7ZA 4IPYA 1IFDA 1U7MA 3L72E 5CJ4A 2HODB 1EQ7A 1LT1A 3M0DC 2P1JA 4ZNCA 4COCA 4R4MA 1N7SB 1FZBA 3CX5I 1E79H 5KAIH 1Q7YQ 1N73C 3IR9A 4W80A 4WYMA 2E74D 1CSBA 1SQQJ 2WSCJ 1H89A 2OYHA 3CCMP 4OGQC 4N3YB 1YBKA 2MD9A 1JO5A 1EOQA 5AW1B 1NAFA 1DEBA 1X9VA 1ZN5A 4IFDK 5AVXB 2NPSC 1JY3O 1LWUC 3AE9C 5KLVG 5APXA 4H13C 3IFMA 4LC1A 1H88A 1NU1G 2BASA 5APQA 4PV1C 3JCUE 1X79B 4BPFA 1SFCA 1S9KD 1JUNA 3VP9A 4H2YC 5APUA 2KI7B 3C1LA 2G3AA 3GKLC 2FYNB 3CC2P 1QLED 2J58A 2EIAA 4XA4A 2WSEH 3EJBA 3SFDC 1PEMA 4HH2A 3EFFK 4WY4C 4GR2A 3TGUG 1KFNA 3CCEP 3IN6A 3WBHA 2XZ0D 1PGQA 3H1JD 3USSA 4H44D 2L22A 2BCCE 3I56P 3V6IA 3BCCE 2QJKB 4I7ZC 1K05A 4CA3A 3GZLA 1FZCC 3RL0D 4PD4E 3CCSP 2K37A 2OTLP 5KAFE 3M0DA 4RESB 5KLVJ 1T8KA 4HJGH 2YKPA 2KOSA 2H43A 3KPEA 2QJPB 4RKUJ 1NU1J 1T6AA 1N73A 4WVZA 2N6ZA 2FYUG 3GF7A 5AW3B 1H0TB 2MY5A 4WB4A 1HY8A 1M57D 2C9LY 3DS5A 1J1DC 1E6JP 1LP1A 3TGUD 3VMZA 1FC2C 4L74A 3OW2O 4N78E 1ZMEC 2KODA 3RG6C 1GXGA 2QJYC 3GHGC 3L36A 4C7NB 1FJPA 2NPSA 1JJ2O 3P7KA 2E75C 1FR2A 1EZVG 2E5TA 2FHSC 1OW8A 4O9BA 1GW3A 2LOLA 3SFEC 3G1IA 1HH0A 5E79H 3KXDA 3FXDA 3RL0g 3BVHA 1FAVA 1JY2N 3SSUA 3L73E 4BPGA 1UJZA 2M5RA 1P84H 2ZYGA 2AFEA 2JQ4A 2JEEA 1RF0C 2R32A 3BATA 3AE5C 1KTMA 2DW3A 1PGOA 4GT1A 4EOTA 1BDDA 3O6QA 3GLMA 3DS3A 2IFNA 5HGMA 3DS2A 4WY4A 2W27A 2Q5UA 1S3JA 3FXEA 3FWLA 4XFJA 1A8OA 3D6YA 3R2PA 3H4EA 5GTHH 5AVRB 2QG4A 5AW8B 2D2CB 2YIUB 2EFJA 1RE3C 3CE7A 4BRYB 1JY3N 2AXTH 1FZCA 2ZFCA 1URQA 1PPJD 2OGUA 3FGAD 1N86A 4M0IA 3TYYA 4Y28J 5KLVK 1RH5B 5APVA 1OW7A 4OH8B 3PTZA 1VQ6P 3L74G 1OW6A 1VQMP 5KLVE 4MRTC 1SQXG 1KMIZ 1NU1E 1UIIA 2M3BA 4U0CA 5BU5A 1VQ8P 1L2PA 1YTZI 2M8PA 1GK6A 4M3LA 3GHGA 1FOSF 3M91A 3B5NC 4U0BA 5KJ7C 2MR8A 3P32A 4IL6E 3H1KJ 4JQ0D 3NMDA 3U1AA 2PEMA 2CG5B 2C9NY 5TISH 3TSIA 2K5XA 1FDMA 1KQSO 5CCHD 5CJ0A 2FY8A 5DCKA 3IAOA 1RF0A 1KILD 1SQXD 2WSEJ 3TGUE 4D6TJ 1VQKP 2N1TC 2PEKA 4U0FA 5CCGC 3HD7A 2FXOA 3E1IA 1CI6A 1CEIA 2WT7A 1OX3A 1L0LJ 3H25A 2E74B 4HYTB 2EHTA 4LLHA 2ZVNB 1NTMJ 1YJNP 1KB9D 2K2QA 2NRGA 1OR5A 1PZQA 2JU2A 1SQBD 2FYUK 5CBOA 1BDCA 4GR6A 1RE3A 1RY3A 2N6YA 1ZOYC 1NTZG 2JYLA 3NTNA 2ZXXA 2WSCH 2FYUE 2LIUA 2PAJA 3OJAB 4MN4C 5B66E 2XZ1C 5F2NA 3S1KA 1OWAA 3H1LJ 1HUCA 1DNYA 1T2KD 1BCCD 1JTHA 3L70G 3H1HG 1EZVE 5KAIE 1BE3J 3HUSA 3S9OA 1FDIA 3G4SP 4Z1MH 1KZUB 3CC7P 3DS4A 2Z44A 3CCLP 1P84D 4HKZH 2KOQA 2QA4P 3B5NA 1NGMB 1JCDA 5KJ7A 5CBNA 2CPBA 1PFIA 3VMAA 3CMAP 5H2FH 1RQUA 4ASWA 2GDYA 1W2BO 1U7JA 3DTJA 2AEJA 4H44B 3CL3D 1W2EA 3JC22 1M1KQ 2KS1A 3E7KA 2ZXEB 1VQPP 2JB0A 4DCKA 2Q3IA 3RL0B 3Q5SA 2R5BA 1HTLC 2IYOA 3EJDA 2JP3A 1EMVA 3H1HD 4HB1A 1NTZJ 2HFED 2N1TA 5CCGA 3I55P 2L6EA 4U3FJ 5JPAA 3RK2D 1M6EX 3V4WA 3OA7A 2PEOA 4YXWH 1EXJA 2GZJA 3PP5A 2FAEA 2GA1A 4ZKPA 1VPCA 1LTBC 3WUTA 2KR5A 3CCVP 1IFPA 4QKOA 1SQXK 3L70J 3P8CE 3O8ZA 2K93A 3GW6A 2FFDB 2K9JA 2FQ2A 2O3JA 3L74E 2ZYAA 1SQXE 5AVZB 5I4TG 1SQBK 2Y9YA 2PGDA 1LTTC 5AW9B 4PV1D 2QM8A 4ASVA 2ROQA 2P10A 1BGYJ 1GPJA 1HJ0A 1MFTA 1SQQG 1FDOA 1L0NG 3RK3E 2QJKC 3BCCD 3AE6C 2FVEA 1G2CB 2OQQA 5GTIH 1L4AD 2FYZA 2HODA 4PD4D 2KGEA 1UIXA 5HGLA 2QE7H 1EDKA 2O1JA 2E76D 3Q20A 3WU2E 2MVVA 2WVRA 4PH0A 1D7MA 1SP4A 1ZRTE 1R5LA 2ZJSE 3AE1C 1P84I 3HE4B 2ZT9B 1Q81Q 4N78D 3SWFA 1M7LA 1NTZK 2KOGA 1P84E 2JKVA 1LT9B 5B66H 1IK7A 1MUUA 2Z4EA 5APWA 1ZW0A 5KKZC 4ZMDA 3KDPB 2BQ1E 3W67A 2WPVB 1NTZE 2YXQB 3H32A 1MKMA 1GL2C 4KJMA 2NO8A 1NHLA 1SQVJ 4U0AA 2O01J 2IPPA 3CPWO 3L73D 1OZHA 5CHXA 5GTHE 2KLVA 4K3AA 1L0NJ 2W90A 2R3CA 4EYYQ 1KV4A 2YKOA 3L70E 2JDIH 3H1HE 2GM4A 1Y9BA 2CPSA 1YQ4C 2KZJA 2Y0DA 2AFDA 2AXTE 2XT1A 1RNIA 1DV5A 2FKWB 4HKGA 3EJEA 1WMKA 5APTA 1T3UA 1HQBA 2W6AA 3CXHH 2PFXA 3A0HH 3SWYA 2WSFH 1KILB 3HTKB 3VYIA 1MFZA 1R8EA 1HWTC 1MV8A 3M1MA 4OWFA 3UIAA 1EIAA 1SS1A 1FZEA 2I1KA 2ZVOB 1ZMBA 1IMQA 5APSA 1RQVA 1ZR4A 3VMYA 3A2AA 1VF5C 1SVFA 1X0TA 1S1CX 2NZ2A 3RK3B 3CWBG 5KLIC 3RBZA 2LXCB 2HG5D 5AW6B 4BPHA 3H1IJ 1H0TA 2SPZA 2LPKA 2KXPB 5KLVD 2QRXA 2QM7A 1K04A 1GMJA 4QNBA 1NU1D 1VHNA 5TISE 3GG2A 4PD4I 1VQLP 1DEEG 3JSVC 4C7NA 2E1MA 3S4RA 5F2KA 1KORA 1K8AQ 2QEXP 2LL8A 2K0DX 4PWVB 3CXCO 1RF1C 1URQC 3EFGA 3BASA 1Z56A 1IC2A 2V7QJ 2KYVA 3MTUE 2VLQA 1GL2A 1LNQA 2JO0A 2JWDA 5CMZA 2CNRA 2VSQA 4BXLA 4H2WC 2X2BA 1SQQK 1IUQA 2CGQA 4AQRD 3MZWB 3PHLA 3WMM0 3TNUB 1LGHB 1AA0A 3B5IA 2PNGA 1IK9A 1MZ9A 2R5DA 2P2UA 3DPHA 1FOSE 1SQQE 3WU2H 2I1JA 1L0NE 2IZ1A 2BEQD 1ZR2A 5AVTB 1LTIC 2I8DA 2L91A 3MGEA 1AV1A 1J1EB 3CWBJ 2H8PD 2M8NA 4XRQA 3LW5J 2YMKA 3AE4C 1PGJA 3RGUA 1OVRA 5AW5B 3RK2B 2ONTA 2QIWA 3MUDC 2FYUD 1Q2NA 3LIEA 3PLNA 2JR8A 1IO4A 1OFCX 2GUSA 2LTEA 5AVVB 3HD7C 2ITAA 3T97B 2UWJE 2MF4A 3G1GA 2B87B 3H1KG 2ERHA 3P8MC 3VN0A 2IYPA 1N73B 5H2FE 4I1LA 1M1JB 2FXPA 1KQGB 3AECC 1NJIQ 3FX0A 1EZVD 2AEFA 4OGQB 4NPFX 2Z46A 2NPSB 1LWUB 2QNWA 1FBMA 4D6TG 4PH1A 5AVYB 2OYIB 2ZT9D 1RF1A 1L0LG 3A5TA 3L71J 4PV1B 1Q90D 3V4QA 1NTMG 1N2DC 2Z45A 1GU5A 4DT0A 3CCQP 3CX5H 1NU1K 3L37A 4NPEA 4U7JA 3B8EB 1T3JA 1L4AB 1A02J 4QMAA 3G3ZA 2QSIA 3HUSC 2E76B 2YXRB 4H0LC 1PEUA 4JYCA 3M9BA 2Z5IA 2FQ1A 4GIFA 3EWKA 3BRTB 3H1LG 4WY4B 1HVVA 3G21A 2GZEA 2KUBA 2WSFJ 3U59A 1Y47A 5CZDB
chains in the Genus database with same CATH topology
1N8RQ 1VQ4P 1AUMA 4U0DA 1K73Q 3I55P 2L6EA 1YJNP 4COCA 1VQ9P 5JPAA 1Q81Q 4XFXA 1RO0A 3H0DA 2EFJA 3CCSP 1VQ7P 1M6EX 1YI2P 3HYBA 2OTLP 1Q7YQ 3G1GA 3DS1A 2PEOA 1PEOA 2BUOA 4WYMA 3DS0A 2PENA 2PEIA 4QNBA 1VQLP 4M0IA 2JYGA 4U0EA 1NJIQ 4GR6A 3CCMP 2E1MA 5F2KA 3I56P 1YJ9P 1K8AQ 2JYLA 2BQ1E 2QEXP 1EOQA 2BHVA 1YHQP 1VQNP 3G29A 3CCVP 1PEQA 2CWOA 2XXMA 2PEQA 3CXCO 1QVFO 2EG5A 3DS5A 1M6NA 1E6JP 2PY8A 2Z46A 5F2NA 3OW2O 1VQ6P 4U0AA 4PH1A 2KODA 1VQMP 3RG6C 5BS1A 3CPWO 2LF4A 5F2OA 1JJ2O 1VQOP 3NTEA 4XFYA 4U0CA 2JO0A 1VQ8P 2M8PA 2M8LA 3H47A 4XFZA 5I4TG 1K30A 2Z45A 1KD1Q 1IUQA 2PEJA 3G4SP 3CCQP 4U0BA 3G6EP 1Q86Q 3CC7P 3G1IA 1BAJA 3DS4A 2Z44A 3B5IA 4XROA 3CCLP 1M90Q 2XT1A 1RNIA 3HZQA 3LRYA 5HGNA 1VQ5P 2QA4P 1YJWP 1D1DA 3CC2P 2DGYA 3E2DA 1RO2A 3VRLC 3CC4P 3DPHA 3G28A 1A43A 2EIAA 2PEMA 3CMAP 3CMEP 1KC8Q 1PEUA 2OARA 3CCJP 3MGEA 2XV6A 1YITP 1W2BO 1K9MQ 1KQSO 1PEMA 3DTJA 1S72P 5HGLA 3G71P 4COPA 3M1MA 4GR2A 2M8NA 3DS3A 4XRQA 5DCKA 3P05A 3Q20A 5BS2A 3CCRP 2P9XA 1YIJP 1M1KQ 1QVGO 1EIAA 1QRJA 1Q82Q 3CCEP 5HGMA 3G21A 3DS2A 3CCUP 1VQKP 1M74A 3WBHA 4PH0A 1VQPP 3CD6P 2PEKA 4U0FA 2OTJP 3G26A 1ZMBA 3G0VA 4IPYA 5HGOA 1A8OA 2ONTA 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R Q;  1YJ9 P;  1KC8 Q;  1K8A Q;  1VQ4 P;  2QEX P;  1VQN P;  1YHQ P;  3CCJ P;  3CCV P;  1YIT P;  1K73 Q;  1W2B O;  1K9M Q;  3I55 P;  3CXC O;  1KQS O;  1YJN P;  1KD1 Q;  1S72 P;  1VQ9 P;  3G4S P;  3CCQ P;  3G71 P;  3G6E P;  1QVF O;  1Q86 Q;  1Q81 Q;  3CC7 P;  3CCS P;  1VQ7 P;  1YI2 P;  1YIJ P;  3CCR P;  2OTL P;  1Q7Y Q;  1M1K Q;  3OW2 O;  1QVG O;  3CCL P;  1VQ6 P;  1M90 Q;  1VQM P;  1Q82 Q;  3CCE P;  1VQK P;  3CPW O;  3CCU P;  1VQ5 P;  2QA4 P;  1VQP P;  1YJW P;  3CD6 P;  3CC2 P;  1VQL P;  1JJ2 O;  3CC4 P;  2OTJ P;  1VQO P;  1NJI Q;  3CCM P;  1VQ8 P;  3CMA P;  3CME P;  3I56 P; 
#chains in the Genus database with same CATH topology
 1VQ4 P;  1JCC A;  1GW4 A;  2FFD C;  1NTM D;  1OVV A;  3P8C D;  1BE3 G;  2GZI A;  1IFJ A;  1RE4 A;  3CWB E;  1OMI A;  4I7Z B;  3K5B A;  3PRJ A;  2YNY A;  2FAD A;  3MUD A;  5EFW B;  1NTK J;  3L74 D;  2Q9I A;  3EQ2 A;  2JYG A;  5GTI E;  2JJL A;  1JM0 A;  1YJ9 P;  2BHV A;  3G29 A;  2CWO A;  2Q6Q A;  1DX7 A;  2KW2 A;  1AQ5 A;  2HPC A;  1HF9 A;  1L0I A;  1JB0 J;  4L76 A;  3RK3 D;  2MJZ A;  1FZA A;  3I5C A;  3GHG B;  4EI2 A;  3VTP C;  3A0B H;  2O01 H;  5HVC A;  4GOD A;  2JGP A;  1QGK B;  2MVU A;  1XTG B;  2E75 B;  2RN0 A;  4CPG A;  4U3F G;  1KD1 Q;  5AVS B;  2PEJ A;  1PP9 J;  1JEK A;  2QVA A;  1EZV I;  2JU1 A;  1ZRT D;  1VQ5 P;  2OYO A;  1KQL A;  1FU1 A;  2AVA A;  3VRL C;  1M56 D;  2CK3 H;  3RBX A;  4A7P A;  3FWN A;  1KFM A;  3L35 A;  2N9B A;  5B5E H;  1DIP A;  1SFC D;  1EDL A;  4F37 A;  3P05 A;  4R0M A;  4YPC A;  5AVQ B;  2MKV A;  2EHS A;  1R5S A;  2P58 A;  2KGA A;  2KNC B;  3V5B A;  1FZG A;  1VDF A;  1NTZ D;  3MHV A;  3CXH I;  4U3F D;  1N7S C;  1FS0 E;  4PXH B;  4XFX A;  2M8R A;  3H0D A;  2L0Q A;  3MIW A;  1S5L X;  2FFD A;  1BGY G;  1PEO A;  3II6 A;  4RJT A;  2PEI A;  3H1K E;  3CXH E;  3A0H E;  2JO1 A;  3KZI H;  2LKI A;  1BCC J;  5M1B A;  4C46 A;  2K0Y A;  3L70 D;  3D6Z A;  2WPS A;  1PEQ A;  1NWQ A;  1NYH A;  2PP6 A;  2WPR A;  5CCH C;  1L0L K;  2W8Z A;  1NTM K;  4D6T E;  1GZL A;  3L72 J;  1KIL C;  4WWI A;  1AF8 A;  1CW5 A;  3GJN A;  2V7Q H;  2Y9Z A;  1IZN B;  1PIX A;  4XFZ A;  4GDO A;  3Q2Y A;  1L0L E;  3OAK A;  1F80 D;  1JMB A;  1G2C A;  1LTJ B;  3A3Y B;  2HYN A;  3L75 G;  1NTM E;  2A06 G;  2Y0E A;  4LGD E;  1SQP G;  1DD3 A;  1S2E A;  2FYN C;  4XRO A;  3Q5R A;  1EDJ A;  1FJK A;  2H7H A;  1NKN A;  1W5C E;  2DGY A;  3KHU A;  4OGQ D;  4Y99 B;  1YYC A;  2G8Y A;  3IF4 A;  3CC4 P;  3ZDM A;  3CME P;  5AVU B;  2XU6 A;  2KSJ A;  2NPS D;  3V2Q A;  1GD2 E;  1JOC A;  3C8V A;  4H13 D;  2AEM A;  3HE4 A;  2KG8 A;  5KP6 B;  1SQV G;  3WUV A;  3CCR P;  2E5Y A;  3H1L E;  3CCU P;  1M74 A;  1S4X A;  2WIT A;  3AEG C;  3G0V A;  3NXS A;  3LW5 H;  2N1T B;  2WZ7 A;  4EDF A;  3GZM A;  1GDT A;  2KP8 A;  2A06 D;  1BE3 E;  2GUV A;  1E5W A;  1NAY A;  3HYB A;  2M5A B;  1N7S A;  2QJP C;  3F89 A;  4ZKU A;  1VF5 D;  2ZAE B;  3HE5 B;  4WY4 D;  4IZ6 A;  2KG6 A;  4K35 A;  2WSS H;  2K88 A;  1QVF O;  4TT3 H;  2XZR A;  3L75 J;  2B9B A;  1SQP J;  2YKQ A;  3G9R A;  4IFM A;  1SQQ D;  5F2O A;  1L0N D;  2GDW A;  1VQO P;  2BCC J;  5CCH A;  1URQ D;  3BCC J;  1DH3 A;  3H47 A;  2E43 A;  2GZF A;  1ZNV A;  3AE2 C;  3H1I G;  4U3F E;  1KIL A;  2WPT A;  3Q1M A;  3AE7 C;  2KGC A;  2A45 H;  3NFQ A;  3PJS K;  2L4B A;  3QWO C;  1PL5 A;  3LRY A;  5KP8 B;  2WQY C;  3RK2 C;  1LTG C;  3E2D A;  1FE6 A;  3G28 A;  4DOJ A;  1YQ3 C;  2KWL A;  1YIT P;  3LID A;  4OVN F;  4COP A;  2LR2 A;  1IMP A;  1M1J C;  1QVG O;  2HLO A;  1Q82 Q;  5KTB A;  2E75 D;  1XTC C;  1KN7 A;  4I6M C;  3CD6 P;  3D70 A;  2P67 A;  1EC5 A;  1X3O A;  5HGO A;  4IFF A;  3CX5 E;  5BU8 B;  2YMY A;  4UHP B;  4XE5 B;  3VP8 A;  2RKL A;  2D2C C;  2YIU C;  5EJD A;  3H1I D;  5APY A;  1KQF B;  1AJY A;  3TK1 A;  1ZP0 C;  1UNK A;  1YI2 P;  3Q3D A;  2OYI C;  2V4H A;  1USD A;  1BGY E;  2O01 N;  3H1J G;  3VOP A;  1GTW A;  4H2X C;  2L5G B;  2XDJ A;  3L73 J;  4UB6 H;  3U43 A;  4DJG A;  4IOI H;  3H32 B;  3AED C;  1OVU A;  2E42 A;  3MP7 B;  3HD7 D;  2VLP A;  3GMA A;  4JBZ A;  1QEX A;  3ITK A;  3BRV B;  2Q3E A;  1L4A C;  2N98 A;  4DG9 A;  2KOP A;  3TNU A;  2Z5H A;  4UB8 H;  2OYH B;  1PV3 A;  2E76 C;  2K3R A;  1HBW A;  2YO3 A;  2OTK E;  1SQP K;  1KYO H;  1S5L H;  3M9Q A;  1HJB A;  4JF7 A;  2XV5 A;  3L75 E;  2H89 C;  3H6P A;  2A06 E;  2MR7 A;  1SQP E;  3WUU A;  3B4Q A;  2LML A;  5HGN A;  2O1K A;  1RO2 A;  1SFC B;  2ZYD A;  2FXM A;  1KC8 Q;  1SQV K;  2JBG A;  2XNX A;  3CWB D;  3A7O A;  5DJU B;  5KP7 B;  1S72 P;  2VLO A;  2IZ0 A;  1L0N K;  1YIJ P;  2P9X A;  3HRN A;  2C0X A;  2C0W A;  1SQV E;  1EXI A;  3A0B E;  4H0L D;  1KB9 H;  3SWK A;  3T97 A;  1CZQ A;  2B87 A;  3G26 A;  3V2P A;  3H1J J;  4RO0 A;  3L71 G;  1M1J A;  2E74 C;  2A45 G;  3B5N D;  3L4F A;  1N8R Q;  1QX8 A;  3CLQ A;  2JAZ A;  5KJ7 D;  1GU4 A;  4EIJ A;  1K73 Q;  1PGP A;  1M8O B;  1RO0 A;  1VQ7 P;  1LTS C;  3CI9 A;  3PH0 A;  1LWU A;  4WBA A;  4BRY A;  1RE4 C;  1JY2 P;  4U0E A;  5B5E E;  2KSE A;  1IFI A;  2OYI A;  1GK4 A;  4C7R A;  3N7N A;  5KKZ B;  3M9H A;  4YTP C;  2XXM A;  2PEQ A;  3AEB C;  1RHZ B;  2EG5 A;  2XKM A;  1EDI A;  1M6N A;  2PY8 A;  2N1T D;  3MGN A;  5CCG D;  1USE A;  3TGU J;  4GOF A;  1GL2 B;  4R4L A;  1PPJ G;  2KK7 A;  2R44 A;  2WTY A;  4DZO A;  2W6B A;  1L4A A;  2POH A;  3L71 D;  1VL2 A;  5AVW B;  2K9Y A;  4PJ0 H;  1K30 A;  4I2L C;  2BEZ F;  2VRS A;  1LP1 B;  3G6E P;  5HV8 A;  2IX7 C;  1BAJ A;  3H1I E;  1NTK G;  4L75 A;  2R3S A;  3KZI E;  5K5G B;  1YJW P;  1JY3 P;  4H13 B;  1NO4 A;  1NQ4 A;  1S9K E;  4H44 C;  2FYU J;  4GOE A;  1K9M Q;  3MD0 A;  4IL6 X;  5DJT B;  2M3E A;  2IBZ G;  4N6J A;  3LMO A;  2AXC A;  3H1K D;  3CXH D;  3RL0 C;  2KZI A;  2K94 A;  2KIK A;  1X22 A;  1QL2 A;  2FVF A;  2N50 A;  1NKZ B;  1G1J A;  1AUM A;  1DD4 A;  3B71 A;  1QL1 A;  3RG2 A;  1VF5 B;  3JCU H;  3O6Q B;  1PP9 G;  3W68 A;  4YXD C;  3E1R A;  1VQ9 P;  5KLI B;  3V2R A;  5AW7 B;  1IJD B;  1NTK D;  2KOR A;  4D6T D;  3VMX A;  3DS0 A;  2PEN A;  3U1C A;  1N7S D;  3NY7 B;  1ZLL A;  3H1J E;  5L8R J;  4NEO A;  1BXI A;  1LTJ C;  1L0L D;  2L9F A;  2DNW A;  1VQN P;  2KG9 A;  1BSH A;  2Q1K A;  2IBZ D;  4JYB A;  1SQB G;  2WMM A;  1FZC B;  1KYO D;  1RF1 B;  1URQ B;  4Y99 C;  1NVO A;  2K92 A;  2K0X A;  2GYK A;  2M8L A;  2IFM A;  1PP9 D;  2N9Y B;  5AW4 B;  2LXB A;  1AVO A;  3H1L D;  1M90 Q;  3M06 A;  3HZQ A;  1J1D B;  4PD4 H;  1AFO A;  5KAF H;  2QJY B;  5AW0 B;  1BCC G;  2RH0 A;  2FAC A;  2KNC A;  2OAR A;  2B88 A;  1BE3 D;  2XV6 A;  3G71 P;  1ZV8 A;  4JPZ B;  2A45 I;  2FBW C;  1Y8A A;  1QRJ A;  3L74 J;  2WPQ A;  3L72 G;  1SQX J;  3F5H A;  1IFM A;  2OTJ P;  2W6J H;  4W7Y A;  3KQG A;  2ZT9 C;  3AEF C;  3L71 E;  4KHX A;  5TJH A;  2JWA A;  4U0D A;  5BVZ A;  2KB7 P;  1U57 A;  2M0B A;  1LT9 C;  2BUO A;  1SQB J;  3HD7 B;  1JMM A;  1CI6 B;  2WT7 B;  7CEI A;  1AVY A;  2XND H;  1VKU A;  4KT0 J;  2CQ8 A;  2HPC B;  2W83 C;  4TLF A;  1LTJ A;  5BS1 A;  2FQ0 A;  1KLP A;  2WWW A;  3L72 D;  2LF4 A;  2Q7C A;  1PPJ E;  4XFY A;  1NTK K;  3Q5P A;  3KYQ A;  3ABV C;  1YTZ T;  1LJ2 A;  5EW5 E;  3TDK A;  1Q86 Q;  5C39 A;  4GKG A;  4UB6 E;  1IFN A;  1NTK E;  2FVA A;  3TF5 A;  1LTA C;  1N7L A;  2J59 M;  3AEE C;  3R4Y A;  2GZG A;  1JTH B;  1A43 A;  3CX5 D;  3QH9 A;  1ZXG A;  2IBZ I;  2Y0C A;  3HUS B;  1KYO I;  2KGD A;  1GL2 D;  3GF3 A;  4H0L B;  2P7J A;  4UB8 E;  1HGV A;  5BS2 A;  3B5N B;  1BSN A;  2IDB A;  2IBZ E;  1BGY D;  1FZF A;  1KYO E;  2M5A A;  1S5L E;  2HR3 A;  1WRG A;  2YO2 A;  3D71 A;  1WT6 A;  2BCC G;  4B86 A;  3RK3 C;  1E0H A;  1GXH A;  3BCC G;  1T8Z A;  3HE5 A;  3H1H J;  4AYC A;  2KS1 B;  1JNM A;  1PP9 E;  1TU3 F;  2GDX A;  2OYH C;  2PRR A;  1L0H A;  3DS1 A;  1HGZ A;  2H88 C;  2RMZ A;  5AW2 B;  1KIL E;  1KB9 I;  2AF8 A;  4IL6 H;  2D2C D;  2KOO A;  2B89 A;  1LT9 A;  1YHQ P;  1T2K C;  1NH4 A;  3L75 D;  2VLN A;  1KB9 E;  1SQP D;  3AEA C;  2K1A A;  3N4X A;  1SFC C;  3C9I A;  1NOH A;  1SQB E;  1AQT A;  2KLU A;  2BCC D;  4AUW A;  3NTE A;  1A02 F;  2J5U A;  1ACP A;  1SLQ A;  3B4S A;  4L73 A;  1MZ8 A;  2LIW A;  1H8A A;  2K9J B;  3AE8 C;  1SQV D;  1OXZ A;  3L73 G;  1D1D A;  1Z6M A;  1J2J B;  1G1I A;  1BCC E;  1J1E C;  3CCJ P;  5E79 E;  4NPD A;  3M0A A;  3AE3 C;  3V2N A;  4BWN A;  3HTK A;  1JY2 O;  1OIP A;  2N5I A;  2LKM A;  2N5H A;  1X8Y A;  4PJ0 E;  1AYI A;  4W7Z A;  4IPY A;  1IFD A;  1U7M A;  3L72 E;  5CJ4 A;  2HOD B;  1EQ7 A;  1LT1 A;  3M0D C;  2P1J A;  4ZNC A;  4COC A;  4R4M A;  1N7S B;  1FZB A;  3CX5 I;  1E79 H;  5KAI H;  1Q7Y Q;  1N73 C;  3IR9 A;  4W80 A;  4WYM A;  2E74 D;  1CSB A;  1SQQ J;  2WSC J;  1H89 A;  2OYH A;  3CCM P;  4OGQ C;  4N3Y B;  1YBK A;  2MD9 A;  1JO5 A;  1EOQ A;  5AW1 B;  1NAF A;  1DEB A;  1X9V A;  1ZN5 A;  4IFD K;  5AVX B;  2NPS C;  1JY3 O;  1LWU C;  3AE9 C;  5KLV G;  5APX A;  4H13 C;  3IFM A;  4LC1 A;  1H88 A;  1NU1 G;  2BAS A;  5APQ A;  4PV1 C;  3JCU E;  1X79 B;  4BPF A;  1SFC A;  1S9K D;  1JUN A;  3VP9 A;  4H2Y C;  5APU A;  2KI7 B;  3C1L A;  2G3A A;  3GKL C;  2FYN B;  3CC2 P;  1QLE D;  2J58 A;  2EIA A;  4XA4 A;  2WSE H;  3EJB A;  3SFD C;  1PEM A;  4HH2 A;  3EFF K;  4WY4 C;  4GR2 A;  3TGU G;  1KFN A;  3CCE P;  3IN6 A;  3WBH A;  2XZ0 D;  1PGQ A;  3H1J D;  3USS A;  4H44 D;  2L22 A;  2BCC E;  3I56 P;  3V6I A;  3BCC E;  2QJK B;  4I7Z C;  1K05 A;  4CA3 A;  3GZL A;  1FZC C;  3RL0 D;  4PD4 E;  3CCS P;  2K37 A;  2OTL P;  5KAF E;  3M0D A;  4RES B;  5KLV J;  1T8K A;  4HJG H;  2YKP A;  2KOS A;  2H43 A;  3KPE A;  2QJP B;  4RKU J;  1NU1 J;  1T6A A;  1N73 A;  4WVZ A;  2N6Z A;  2FYU G;  3GF7 A;  5AW3 B;  1H0T B;  2MY5 A;  4WB4 A;  1HY8 A;  1M57 D;  2C9L Y;  3DS5 A;  1J1D C;  1E6J P;  1LP1 A;  3TGU D;  3VMZ A;  1FC2 C;  4L74 A;  3OW2 O;  4N78 E;  1ZME C;  2KOD A;  3RG6 C;  1GXG A;  2QJY C;  3GHG C;  3L36 A;  4C7N B;  1FJP A;  2NPS A;  1JJ2 O;  3P7K A;  2E75 C;  1FR2 A;  1EZV G;  2E5T A;  2FHS C;  1OW8 A;  4O9B A;  1GW3 A;  2LOL A;  3SFE C;  3G1I A;  1HH0 A;  5E79 H;  3KXD A;  3FXD A;  3RL0 g;  3BVH A;  1FAV A;  1JY2 N;  3SSU A;  3L73 E;  4BPG A;  1UJZ A;  2M5R A;  1P84 H;  2ZYG A;  2AFE A;  2JQ4 A;  2JEE A;  1RF0 C;  2R32 A;  3BAT A;  3AE5 C;  1KTM A;  2DW3 A;  1PGO A;  4GT1 A;  4EOT A;  1BDD A;  3O6Q A;  3GLM A;  3DS3 A;  2IFN A;  5HGM A;  3DS2 A;  4WY4 A;  2W27 A;  2Q5U A;  1S3J A;  3FXE A;  3FWL A;  4XFJ A;  1A8O A;  3D6Y A;  3R2P A;  3H4E A;  5GTH H;  5AVR B;  2QG4 A;  5AW8 B;  2D2C B;  2YIU B;  2EFJ A;  1RE3 C;  3CE7 A;  4BRY B;  1JY3 N;  2AXT H;  1FZC A;  2ZFC A;  1URQ A;  1PPJ D;  2OGU A;  3FGA D;  1N86 A;  4M0I A;  3TYY A;  4Y28 J;  5KLV K;  1RH5 B;  5APV A;  1OW7 A;  4OH8 B;  3PTZ A;  1VQ6 P;  3L74 G;  1OW6 A;  1VQM P;  5KLV E;  4MRT C;  1SQX G;  1KMI Z;  1NU1 E;  1UII A;  2M3B A;  4U0C A;  5BU5 A;  1VQ8 P;  1L2P A;  1YTZ I;  2M8P A;  1GK6 A;  4M3L A;  3GHG A;  1FOS F;  3M91 A;  3B5N C;  4U0B A;  5KJ7 C;  2MR8 A;  3P32 A;  4IL6 E;  3H1K J;  4JQ0 D;  3NMD A;  3U1A A;  2PEM A;  2CG5 B;  2C9N Y;  5TIS H;  3TSI A;  2K5X A;  1FDM A;  1KQS O;  5CCH D;  5CJ0 A;  2FY8 A;  5DCK A;  3IAO A;  1RF0 A;  1KIL D;  1SQX D;  2WSE J;  3TGU E;  4D6T J;  1VQK P;  2N1T C;  2PEK A;  4U0F A;  5CCG C;  3HD7 A;  2FXO A;  3E1I A;  1CI6 A;  1CEI A;  2WT7 A;  1OX3 A;  1L0L J;  3H25 A;  2E74 B;  4HYT B;  2EHT A;  4LLH A;  2ZVN B;  1NTM J;  1YJN P;  1KB9 D;  2K2Q A;  2NRG A;  1OR5 A;  1PZQ A;  2JU2 A;  1SQB D;  2FYU K;  5CBO A;  1BDC A;  4GR6 A;  1RE3 A;  1RY3 A;  2N6Y A;  1ZOY C;  1NTZ G;  2JYL A;  3NTN A;  2ZXX A;  2WSC H;  2FYU E;  2LIU A;  2PAJ A;  3OJA B;  4MN4 C;  5B66 E;  2XZ1 C;  5F2N A;  3S1K A;  1OWA A;  3H1L J;  1HUC A;  1DNY A;  1T2K D;  1BCC D;  1JTH A;  3L70 G;  3H1H G;  1EZV E;  5KAI E;  1BE3 J;  3HUS A;  3S9O A;  1FDI A;  3G4S P;  4Z1M H;  1KZU B;  3CC7 P;  3DS4 A;  2Z44 A;  3CCL P;  1P84 D;  4HKZ H;  2KOQ A;  2QA4 P;  3B5N A;  1NGM B;  1JCD A;  5KJ7 A;  5CBN A;  2CPB A;  1PFI A;  3VMA A;  3CMA P;  5H2F H;  1RQU A;  4ASW A;  2GDY A;  1W2B O;  1U7J A;  3DTJ A;  2AEJ A;  4H44 B;  3CL3 D;  1W2E A;  3JC2 2;  1M1K Q;  2KS1 A;  3E7K A;  2ZXE B;  1VQP P;  2JB0 A;  4DCK A;  2Q3I A;  3RL0 B;  3Q5S A;  2R5B A;  1HTL C;  2IYO A;  3EJD A;  2JP3 A;  1EMV A;  3H1H D;  4HB1 A;  1NTZ J;  2HFE D;  2N1T A;  5CCG A;  3I55 P;  2L6E A;  4U3F J;  5JPA A;  3RK2 D;  1M6E X;  3V4W A;  3OA7 A;  2PEO A;  4YXW H;  1EXJ A;  2GZJ A;  3PP5 A;  2FAE A;  2GA1 A;  4ZKP A;  1VPC A;  1LTB C;  3WUT A;  2KR5 A;  3CCV P;  1IFP A;  4QKO A;  1SQX K;  3L70 J;  3P8C E;  3O8Z A;  2K93 A;  3GW6 A;  2FFD B;  2K9J A;  2FQ2 A;  2O3J A;  3L74 E;  2ZYA A;  1SQX E;  5AVZ B;  5I4T G;  1SQB K;  2Y9Y A;  2PGD A;  1LTT C;  5AW9 B;  4PV1 D;  2QM8 A;  4ASV A;  2ROQ A;  2P10 A;  1BGY J;  1GPJ A;  1HJ0 A;  1MFT A;  1SQQ G;  1FDO A;  1L0N G;  3RK3 E;  2QJK C;  3BCC D;  3AE6 C;  2FVE A;  1G2C B;  2OQQ A;  5GTI H;  1L4A D;  2FYZ A;  2HOD A;  4PD4 D;  2KGE A;  1UIX A;  5HGL A;  2QE7 H;  1EDK A;  2O1J A;  2E76 D;  3Q20 A;  3WU2 E;  2MVV A;  2WVR A;  4PH0 A;  1D7M A;  1SP4 A;  1ZRT E;  1R5L A;  2ZJS E;  3AE1 C;  1P84 I;  3HE4 B;  2ZT9 B;  1Q81 Q;  4N78 D;  3SWF A;  1M7L A;  1NTZ K;  2KOG A;  1P84 E;  2JKV A;  1LT9 B;  5B66 H;  1IK7 A;  1MUU A;  2Z4E A;  5APW A;  1ZW0 A;  5KKZ C;  4ZMD A;  3KDP B;  2BQ1 E;  3W67 A;  2WPV B;  1NTZ E;  2YXQ B;  3H32 A;  1MKM A;  1GL2 C;  4KJM A;  2NO8 A;  1NHL A;  1SQV J;  4U0A A;  2O01 J;  2IPP A;  3CPW O;  3L73 D;  1OZH A;  5CHX A;  5GTH E;  2KLV A;  4K3A A;  1L0N J;  2W90 A;  2R3C A;  4EYY Q;  1KV4 A;  2YKO A;  3L70 E;  2JDI H;  3H1H E;  2GM4 A;  1Y9B A;  2CPS A;  1YQ4 C;  2KZJ A;  2Y0D A;  2AFD A;  2AXT E;  2XT1 A;  1RNI A;  1DV5 A;  2FKW B;  4HKG A;  3EJE A;  1WMK A;  5APT A;  1T3U A;  1HQB A;  2W6A A;  3CXH H;  2PFX A;  3A0H H;  3SWY A;  2WSF H;  1KIL B;  3HTK B;  3VYI A;  1MFZ A;  1R8E A;  1HWT C;  1MV8 A;  3M1M A;  4OWF A;  3UIA A;  1EIA A;  1SS1 A;  1FZE A;  2I1K A;  2ZVO B;  1ZMB A;  1IMQ A;  5APS A;  1RQV A;  1ZR4 A;  3VMY A;  3A2A A;  1VF5 C;  1SVF A;  1X0T A;  1S1C X;  2NZ2 A;  3RK3 B;  3CWB G;  5KLI C;  3RBZ A;  2LXC B;  2HG5 D;  5AW6 B;  4BPH A;  3H1I J;  1H0T A;  2SPZ A;  2LPK A;  2KXP B;  5KLV D;  2QRX A;  2QM7 A;  1K04 A;  1GMJ A;  4QNB A;  1NU1 D;  1VHN A;  5TIS E;  3GG2 A;  4PD4 I;  1VQL P;  1DEE G;  3JSV C;  4C7N A;  2E1M A;  3S4R A;  5F2K A;  1KOR A;  1K8A Q;  2QEX P;  2LL8 A;  2K0D X;  4PWV B;  3CXC O;  1RF1 C;  1URQ C;  3EFG A;  3BAS A;  1Z56 A;  1IC2 A;  2V7Q J;  2KYV A;  3MTU E;  2VLQ A;  1GL2 A;  1LNQ A;  2JO0 A;  2JWD A;  5CMZ A;  2CNR A;  2VSQ A;  4BXL A;  4H2W C;  2X2B A;  1SQQ K;  1IUQ A;  2CGQ A;  4AQR D;  3MZW B;  3PHL A;  3WMM 0;  3TNU B;  1LGH B;  1AA0 A;  3B5I A;  2PNG A;  1IK9 A;  1MZ9 A;  2R5D A;  2P2U A;  3DPH A;  1FOS E;  1SQQ E;  3WU2 H;  2I1J A;  1L0N E;  2IZ1 A;  2BEQ D;  1ZR2 A;  5AVT B;  1LTI C;  2I8D A;  2L91 A;  3MGE A;  1AV1 A;  1J1E B;  3CWB J;  2H8P D;  2M8N A;  4XRQ A;  3LW5 J;  2YMK A;  3AE4 C;  1PGJ A;  3RGU A;  1OVR A;  5AW5 B;  3RK2 B;  2ONT A;  2QIW A;  3MUD C;  2FYU D;  1Q2N A;  3LIE A;  3PLN A;  2JR8 A;  1IO4 A;  1OFC X;  2GUS A;  2LTE A;  5AVV B;  3HD7 C;  2ITA A;  3T97 B;  2UWJ E;  2MF4 A;  3G1G A;  2B87 B;  3H1K G;  2ERH A;  3P8M C;  3VN0 A;  2IYP A;  1N73 B;  5H2F E;  4I1L A;  1M1J B;  2FXP A;  1KQG B;  3AEC C;  1NJI Q;  3FX0 A;  1EZV D;  2AEF A;  4OGQ B;  4NPF X;  2Z46 A;  2NPS B;  1LWU B;  2QNW A;  1FBM A;  4D6T G;  4PH1 A;  5AVY B;  2OYI B;  2ZT9 D;  1RF1 A;  1L0L G;  3A5T A;  3L71 J;  4PV1 B;  1Q90 D;  3V4Q A;  1NTM G;  1N2D C;  2Z45 A;  1GU5 A;  4DT0 A;  3CCQ P;  3CX5 H;  1NU1 K;  3L37 A;  4NPE A;  4U7J A;  3B8E B;  1T3J A;  1L4A B;  1A02 J;  4QMA A;  3G3Z A;  2QSI A;  3HUS C;  2E76 B;  2YXR B;  4H0L C;  1PEU A;  4JYC A;  3M9B A;  2Z5I A;  2FQ1 A;  4GIF A;  3EWK A;  3BRT B;  3H1L G;  4WY4 B;  1HVV A;  3G21 A;  2GZE A;  2KUB A;  2WSF J;  3U59 A;  1Y47 A;  5CZD B; 
#chains in the Genus database with same CATH homology
 1N8R Q;  1VQ4 P;  1AUM A;  4U0D A;  1K73 Q;  3I55 P;  2L6E A;  1YJN P;  4COC A;  1VQ9 P;  5JPA A;  1Q81 Q;  4XFX A;  1RO0 A;  3H0D A;  2EFJ A;  3CCS P;  1VQ7 P;  1M6E X;  1YI2 P;  3HYB A;  2OTL P;  1Q7Y Q;  3G1G A;  3DS1 A;  2PEO A;  1PEO A;  2BUO A;  4WYM A;  3DS0 A;  2PEN A;  2PEI A;  4QNB A;  1VQL P;  4M0I A;  2JYG A;  4U0E A;  1NJI Q;  4GR6 A;  3CCM P;  2E1M A;  5F2K A;  3I56 P;  1YJ9 P;  1K8A Q;  2JYL A;  2BQ1 E;  2QEX P;  1EOQ A;  2BHV A;  1YHQ P;  1VQN P;  3G29 A;  3CCV P;  1PEQ A;  2CWO A;  2XXM A;  2PEQ A;  3CXC O;  1QVF O;  2EG5 A;  3DS5 A;  1M6N A;  1E6J P;  2PY8 A;  2Z46 A;  5F2N A;  3OW2 O;  1VQ6 P;  4U0A A;  4PH1 A;  2KOD A;  1VQM P;  3RG6 C;  5BS1 A;  3CPW O;  2LF4 A;  5F2O A;  1JJ2 O;  1VQO P;  3NTE A;  4XFY A;  4U0C A;  2JO0 A;  1VQ8 P;  2M8P A;  2M8L A;  3H47 A;  4XFZ A;  5I4T G;  1K30 A;  2Z45 A;  1KD1 Q;  1IUQ A;  2PEJ A;  3G4S P;  3CCQ P;  4U0B A;  3G6E P;  1Q86 Q;  3CC7 P;  3G1I A;  1BAJ A;  3DS4 A;  2Z44 A;  3B5I A;  4XRO A;  3CCL P;  1M90 Q;  2XT1 A;  1RNI A;  3HZQ A;  3LRY A;  5HGN A;  1VQ5 P;  2QA4 P;  1YJW P;  1D1D A;  3CC2 P;  2DGY A;  3E2D A;  1RO2 A;  3VRL C;  3CC4 P;  3DPH A;  3G28 A;  1A43 A;  2EIA A;  2PEM A;  3CMA P;  3CME P;  1KC8 Q;  1PEU A;  2OAR A;  3CCJ P;  3MGE A;  2XV6 A;  1YIT P;  1W2B O;  1K9M Q;  1KQS O;  1PEM A;  3DTJ A;  1S72 P;  5HGL A;  3G71 P;  4COP A;  3M1M A;  4GR2 A;  2M8N A;  3DS3 A;  4XRQ A;  5DCK A;  3P05 A;  3Q20 A;  5BS2 A;  3CCR P;  2P9X A;  1YIJ P;  1M1K Q;  1QVG O;  1EIA A;  1QRJ A;  1Q82 Q;  3CCE P;  5HGM A;  3G21 A;  3DS2 A;  3CCU P;  1VQK P;  1M74 A;  3WBH A;  4PH0 A;  1VQP P;  3CD6 P;  2PEK A;  4U0F A;  2OTJ P;  3G26 A;  1ZMB A;  3G0V A;  4IPY A;  5HGO A;  1A8O A;  2ONT A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...