1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
1S72P 3CCVP 3CCMP 1W2BO 1Q86Q 1M1KQ 1YJWP 1Q82Q 1K73Q 1VQMP 1NJIQ 1N8RQ 1YHQP 1YIJP 1VQ7P 1K9MQ 1JJ2O 1VQNP 2OTLP 3CCLP 2QEXP 3I56P 1VQOP 3CCRP 1KD1Q 3CCEP 1VQ6P 3CC2P 1Q7YQ 1QVFO 3CCSP 3CCQP 3CMEP 2OTJP 1VQKP 2QA4P 3CPWO 3CMAP 1Q81Q 1KC8Q 1YJ9P 1M90Q 1YITP 1K8AQ 3CCUP 3CXCO 3OW2O 3G6EP 1VQ5P 1VQ4P 3CC4P 3CCJP 3CD6P 1YI2P 3I55P 1VQLP 1VQ8P 3G71P 3G4SP 1VQ9P 1QVGO 3CC7P 1VQPP 1KQSO 1YJNP
chains in the Genus database with same CATH superfamily
2NZ2A 2M3BA 5BU5A 3AEEC 2H43A 2A06G 1IFIA 1OWAA 2J58A 2K3RA 2YIUC 2JO1A 3OW2O 3CD6P 3A0HE 5KLIB 2KZIA 3M9HA 3CC7P 3L75J 1VQ9P 2QSIA 4ASVA 1HTLC 1J1DB 3AE2C 4U0AA 4AYCA 1KYOD 5DJUB 3JC22 1S1CX 1OX3A 3C8VA 1NTMJ 2QE7H 3BCCE 2GA1A 1A8OA 2KOGA 3KXDA 3H32B 1ZXGA 1LTIC 2UWJE 5APSA 3NTNA 3CXHI 2I1JA 1FZCB 1AVYA 2KS1A 3RK3C 3SWFA 5CCGC 2OTKE 1SQQJ 3N4XA 4H2WC 1LWUB 4DCKA 1M56D 3I56P 2I8DA 1UNKA 2FQ0A 2K0DX 3FXEA 2HODB 1T6AA 4PJ0E 1URQB 1N2DC 1P84D 3H1HD 5APTA 1PPJD 2IX7C 4PH1A 2ERHA 2KI7B 1SQBE 3L70J 1FE6A 4GT1A 3A7OA 3HUSA 3CE7A 2LR2A 2ZYAA 3TGUE 2XDJA 1RF1A 3H1KE 3VRLC 1PV3A 3VMXA 3E2DA 2SPZA 1BGYE 2WWWA 1UIIA 3MZWB 4WY4A 1OMIA 3H1LG 3M91A 1LTBC 4D6TG 2XXMA 5B5EH 4I6MC 3CWBG 1KB9D 2KSEA 4M0IA 2ZXEB 1VKUA 2E1MA 2HFED 1A43A 5KAIH 3RL0g 3P8MC 3PLNA 2KGAA 3EFFK 1FZFA 3EWKA 2N5HA 1NAYA 1JUNA 2GDYA 1SQXJ 3N7NA 1IMPA 3PH0A 1X79B 1K30A 3M06A 3CMEP 2FYUJ 1RE3A 4A7PA 5AW7B 3S4RA 2K92A 2DW3A 4GDOA 1HVVA 7CEIA 1KYOE 1YTZI 1G2CB 3OAKA 3KPEA 4PD4I 2CK3H 2E75D 1JCDA 1FAVA 2K88A 3MUDC 1NWQA 3VYIA 2CPBA 1GL2C 1HY8A 1GW3A 5B66H 2M0BA 5AVQB 2JJLA 1LT1A 2L4BA 1NTKD 1NTMK 5KKZB 1S5LX 1N73C 2M3EA 2D2CB 2XKMA 3P32A 1SQQK 4H13D 1JMBA 1SFCD 3HTKA 1FDOA 1UIXA 3HE5A 3BVHA 3O6QB 1QL1A 4TLFA 1EDJA 1PPJE 4JF7A 1S72P 1BCCD 2FVFA 4CPGA 2EFJA 1VF5B 5KJ7A 1FZCA 1QL2A 1HBWA 3RK2B 3P8CD 1ZRTD 2H7HA 3BRTB 2IFNA 3SWYA 1Q90D 5APYA 1M8OB 1BE3D 2IDBA 1KB9E 4LGDE 5AVVB 5TJHA 1SLQA 2D2CC 5APWA 4MRTC 3A5TA 3CXHH 1M57D 1IFJA 2KOPA 2Q9IA 4BXLA 2CQ8A 3HD7A 1L0ND 3AE8C 1KFMA 3L74E 1P84I 3O8ZA 2XZ1C 1EXJA 1LTJC 2ZFCA 1N86A 3FX0A 3W67A 1VF5C 1IK7A 3VP9A 3CCQP 2CWOA 3RK2C 5I4TG 1SQXK 4GR6A 3RG2A 1T2KD 3L71D 2IPPA 3BCCG 1EIAA 2N98A 2JYGA 3V2RA 2FYUK 2PEKA 3BRVB 3B5ND 2JWAA 1KILB 1JY2P 2Y0DA 4YTPC 1GZLA 4AUWA 1ZN5A 5JPAA 2WSSH 4IL6X 2W90A 3FGAD 5AVZB 2YXRB 1NU1J 2M5AA 2WSFH 2E5YA 3CMAP 1GPJA 2GZFA 2VSQA 5AW3B 2IBZI 1ZR2A 1NTKE 2B9BA 1LNQA 5AW4B 2OYHA 1GU4A 1MKMA 1QX8A 1M6EX 2VRSA 3M0DC 3NTEA 1M1JB 4OH8B 2PAJA 1SQBG 1L0LJ 2KG6A 3SFDC 3L4FA 3MGEA 1AUMA 1SQVJ 3VMZA 1DX7A 3CCJP 3TGUG 1LT9B 1BCCE 3H1KG 3EJEA 1HQBA 1FZGA 1AV1A 1JY2N 3LIEA 5H2FE 4GODA 1K73Q 2FYNB 4WY4D 2Z5IA 2RMZA 2Y0CA 1HUCA 1ZRTE 2QG4A 1GD2E 4L73A 4PV1C 4ZKPA 2K9JB 5KLVG 2P67A 2NO8A 2LKIA 4QMAA 5AW5B 4I2LC 1TU3F 3PTZA 1BE3E 3C9IA 3E1IA 2K5XA 2P1JA 2FVAA 4LLHA 1L0IA 4H2YC 2N6YA 4C7NA 4GKGA 2FQ2A 4PD4H 1QGKB 4XROA 2PEQA 4H44B 2WMMA 3HE4B 2Q6QA 2QJKB 2N9BA 2OTJP 3MHVA 1PP9J 3CX5D 1L0NE 2AEJA 1YI2P 1USDA 1HGZA 2KWLA 1N7SC 3GMAA 1EOQA 2YKOA 3RL0D 1RQUA 4U3FJ 3G3ZA 2ZVOB 4NPFX 1ZR4A 2P10A 2LIUA 3L71E 1OR5A 1M90Q 3RK3D 4EIJA 3EFGA 1IO4A 2IZ1A 2A45G 2KNCB 1FZAA 1ZP0C 2N5IA 2VLQA 3EJDA 3WUUA 1KQLA 1CEIA 3DPHA 2WT7A 5B5EE 3L72D 1JOCA 1H8AA 4H44C 2PEJA 5HVCA 3HZQA 4F37A 1NU1K 2W6BA 3H1HG 1PPJG 3L75D 3CCMP 2LKMA 1YIJP 4N6JA 1AYIA 1K9MQ 3A0BH 2Q5UA 5KJ7D 2JEEA 2JGPA 2LPKA 1HH0A 4RJTA 1P84H 1L0LK 1SVFA 2E76B 3SWKA 5KP6B 2P2UA 1JTHA 1FBMA 3Q2YA 1YJWP 2J5UA 2W8ZA 1Z56A 2AXTH 3WUVA 2O01N 3WU2E 1GDTA 3G1IA 3II6A 2E74C 5HGNA 4DG9A 2E42A 5TISH 2BEZF 1H0TA 1URQD 4RKUJ 4OGQB 2CG5B 5B66E 5CCHA 2O01J 2KG9A 3VOPA 1YJNP 2MY5A 1NJIQ 4NEOA 3L70D 2YKQA 1LT9A 3CX5E 2KP8A 3R4YA 3SSUA 1L4AC 5AW8B 2YIUB 1M74A 2YMKA 3G4SP 5APUA 2CGQA 2P9XA 1LTAC 2JU1A 3V4WA 1BGYD 4PWVB 2J59M 2OYIB 2N9YB 3AE3C 3V5BA 2BCCJ 2RKLA 2VLOA 3TSIA 3RK3E 2ZT9C 2Y0EA 4OGQC 2QRXA 2N6ZA 2XZ0D 3HUSC 4N78E 5E79E 1VQ8P 1NTKG 5GTHH 3H6PA 1W2BO 5DJTB 4XRQA 5EFWB 3CXHE 2FYUD 2XT1A 1EQ7A 2L9FA 3L75E 2MVVA 2EIAA 1BCCG 5CJ0A 2R32A 2XU6A 3W68A 2H8PD 1FOSF 2GUVA 4XE5B 4YPCA 2OYIC 3G21A 2O3JA 1KQFB 2Z46A 3H0DA 1NTME 3AE4C 4HKZH 2L6EA 1IC2A 2KZJA 3DTJA 1X3OA 2K2QA 1PZQA 1S5LH 3B5NA 3DS0A 2AEMA 4L76A 1DH3A 3PHLA 1W2EA 1KQSO 1BE3G 1SQQE 1BSNA 2NPSA 1M1KQ 2D2CD 2N1TB 1AQTA 3TNUB 4UB6H 5BU8B 2QA4P 2WSFJ 3DS1A 4H0LB 1L0NG 2K0YA 3MGNA 1VF5D 3L70E 1PL5A 4UB8E 3EJBA 2W6JH 2L0QA 3G9RA 3Q5RA 2QM7A 2FADA 3NMDA 3L71G 3GHGB 1H89A 1NTZJ 3Q1MA 3GF3A 1NHLA 4Y28J 4I7ZC 1VQPP 1A02J 4ZMDA 1RY3A 1Q82Q 3U1AA 3KDPB 2N1TC 1RF0A 4H2XC 3AE7C 1PEMA 2B87A 1YITP 1OFCX 4H0LC 1X22A 2GYKA 2V7QH 1GL2B 5APQA 4DOJA 1GXHA 1Q2NA 1SQXE 3CCVP 4BPHA 1BDDA 4QKOA 3L74D 2GZEA 2FXOA 2FYUE 1MV8A 4I1LA 1H88A 2W83C 1N73B 1Y9BA 3GHGC 1KILD 5KLVJ 2EG5A 1PIXA 4IL6H 3T97B 3H1JD 2MJZA 4YXWH 4B86A 2FAEA 3HD7C 1DIPA 2HG5D 1ZMEC 2GDXA 3CCEP 1JCCA 2K94A 1OZHA 1EZVD 2ONTA 1KFNA 4GOFA 4XFXA 5CCGA 3G6EP 3IAOA 3KHUA 2DGYA 2XV6A 2AXCA 2O01H 2POHA 3VTPC 5CCHD 3M9QA 2OYOA 5C39A 2R5BA 3HYBA 3GG2A 4U7JA 1SQVD 3JCUH 2YMYA 2K9YA 2KGDA 3TF5A 1SQPD 2JQ4A 1NYHA 1S3JA 3E1RA 4BPGA 3G1GA 1LTJB 3CCLP 3H32A 4HYTB 2HLOA 3H47A 2BASA 1KYOI 1OVUA 5KAFE 4XFYA 1JMMA 1MFZA 3D70A 1MUUA 1G1JA 3GZLA 3KYQA 3KZIE 1PFIA 1LWUA 2JBGA 3H1HJ 2A45I 1NTZK 3L73J 5HGOA 3L72G 1UJZA 5GTIE 2WPRA 4N3YB 2RN0A 3NY7B 2HODA 1QEXA 3CCSP 1URQA 2OGUA 4WYMA 1RNIA 2KYVA 3AE6C 2QJYC 2K93A 1PP9D 4JYBA 4WVZA 1SQBK 1R5LA 3GZMA 1A02F 1IFPA 2JYLA 3H1IJ 3L75G 2FVEA 2FACA 1SP4A 3WBHA 1RE4C 4XFZA 5KTBA 4R4LA 3F5HA 1KILE 3IF4A 3CC2P 1Q7YQ 5AVXB 4U0DA 1XTGB 1U7JA 3H1JE 4W7YA 1EDKA 3S9OA 1T3JA 2H88C 3A0HH 3USSA 2BQ1E 5AW1B 5KLVK 3I5CA 2C0XA 1VHNA 2GZJA 2NPSD 2WTYA 2IZ0A 3MUDA 1NU1E 1EZVE 1S9KE 2I1KA 2MKVA 3H25A 1ZV8A 1GU5A 1KB9I 4U0EA 1CI6B 1ZLLA 4OWFA 4PV1B 4R4MA 3VN0A 3G71P 1QVGO 3CC4P 1DD4A 1KLPA 3Q5PA 1N73A 4Z1MH 2WITA 3B4QA 4OVNF 3L70G 1L0LE 3E7KA 4JPZB 2QIWA 1SQVE 2E76D 2W27A 1IMQA 3U43A 1S2EA 1X9VA 2JO0A 4WB4A 5AW2B 2Q1KA 1SQPE 1LP1B 1G2CA 1NTKJ 1JEKA 2O1JA 4PJ0H 1N7SB 3DS4A 1PGJA 3P7KA 3D71A 1BGYG 2FHSC 4BWNA 4W7ZA 2PEMA 3JSVC 2K1AA 2A06E 2KGEA 2VLNA 3A2AA 5K5GB 1K8AQ 3VP8A 5AVWB 4LC1A 3P05A 4CA3A 3Q5SA 3L37A 4H13B 4NPDA 1BCCJ 4WBAA 5AVSB 1SFCB 3O6QA 3FXDA 3UIAA 1PP9E 2FYUG 1OIPA 1FZEA 1LTJA 2E75C 2FY8A 2G3AA 4U3FE 1BE3J 4EDFA 5AVRB 1R5SA 2Y9ZA 5APXA 1WRGA 2P7JA 4COPA 2BCCD 2FFDB 3AE9C 1OVRA 2PFXA 1MFTA 2R3CA 1L0NJ 2FKWB 5CCGD 4U0CA 3BASA 1PEOA 3Q3DA 4H13C 2AEFA 1DEEG 1ZOYC 1VPCA 2PGDA 2QNWA 1SFCC 1YQ3C 4N78D 1KYOH 1HF9A 2MVUA 2AFDA 1X8YA 2KSJA 2V4HA 5BS1A 2GM4A 4K3AA 2GDWA 3AEAC 2E74B 4HJGH 1AQ5A 3CXHD 2A45H 1GMJA 1JY3O 5KAIE 3OA7A 4KJMA 2LF4A 1YYCA 2V7QJ 3B5IA 3ZDMA 3CLQA 1R8EA 3H1LJ 4D6TJ 1FZBA 2FFDC 4O9BA 3CWBJ 2H89C 1KILA 3CPWO 3BATA 4GIFA 2KB7P 4IL6E 1NTMD 2KOOA 1L4AB 2N1TD 2XZRA 1WT6A 3G26A 1VQMP 1N8RQ 1NTKK 1IFMA 2O1KA 1SQQD 3ABVC 1BAJA 2ZT9B 3RBXA 1DD3A 3PJSK 4AQRD 4EI2A 5BVZA 1ZNVA 2EHTA 2R44A 1M1JA 3HUSB 1T2KC 3CI9A 1KV4A 4ZNCA 1RH5B 2Q3IA 3AEDC 1RF1B 2AF8A 3L74G 4KHXA 1KB9H 2Z5HA 1N7SA 1HJ0A 3H1JG 3CCUP 1NTZD 2PRRA 3VMAA 2KIKA 1IFDA 3V4QA 1OXZA 2KOQA 1OVVA 1W5CE 2BCCE 3D6ZA 2K9JA 2LTEA 1NU1G 1EZVG 1GL2D 1KTMA 2IYOA 3V2NA 1AF8A 5AW9B 1FJPA 3HE4A 2WSCH 2L22A 1LGHB 1KORA 1FJKA 4EOTA 2Z45A 1PGQA 1L0NK 1RF1C 5AW6B 4JBZA 1SQXD 4PD4D 1VQOP 1SQVG 4WY4C 1NQ4A 5F2NA 3AE5C 3CX5I 1RO2A 2WSEJ 1SQPG 3H4EA 2JP3A 4ZKUA 4QNBA 3AECC 3L72J 1XTCC 1Y8AA 2NRGA 2BEQD 4BRYB 1E5WA 4Y99C 2L91A 2GUSA 2KNCA 2GZIA 1YBKA 1EDLA 3MIWA 4U0FA 1OW8A 1KN7A 1YQ4C 1IFNA 3M1MA 2RH0A 4I7ZB 1NKNA 1IJDB 1RE3C 1RQVA 5H2FH 3HTKB 3HE5B 4YXDC 2GZGA 3RL0C 2B89A 2P58A 2M8PA 1EDIA 1PP9G 4JYCA 4IPYA 3MP7B 3U1CA 3BCCJ 5HGLA 1K04A 3HRNA 1VDFA 4U3FG 5HV8A 1OW6A 1PEQA 4IFDK 4DZOA 3RK2D 1VQNP 3DS3A 1L4AA 4R0MA 3LIDA 1NTZE 2YO3A 2QM8A 1EC5A 3RBZA 5KLIC 2LMLA 1VQLP 1J1DC 5L8RJ 2KUBA 3AEGC 3L73D 2C9NY 3HD7B 5CBNA 2MR7A 1VQ6P 3G29A 2ITAA 1SQBJ 1BSHA 4HH2A 1M7LA 3MTUE 2WPQA 2LXCB 1AA0A 2IYPA 2LL8A 2PENA 2JWDA 2YNYA 3TGUJ 5KJ7C 1FZCC 2VLPA 3H1KJ 4XA4A 3RG6C 1E79H 2KGCA 3H1ID 5EJDA 1BGYJ 2W6AA 4PD4E 1LWUC 1FC2C 1JJ2O 3CCRP 4HKGA 2L5GB 2IBZD 2ZAEB 4RO0A 5KLVE 3PP5A 2AVAA 3U59A 3R2PA 3TDKA 3CXCO 3AE1C 2OYIA 5EW5E 1URQC 2R5DA 2M5AB 4TT3H 4C7RA 1T8ZA 1S4XA 1ZMBA 5KP7B 2PP6A 2KORA 2KLVA 3L36A 2PNGA 2CPSA 2QEXP 2M8LA 4PV1D 1NH4A 4GOEA 4PH0A 3NFQA 2HR3A 2OYHB 1NU1D 2JKVA 1S9KD 3GLMA 1T3UA 3LW5H 4KT0J 2WVRA 1JO5A 1RO0A 1AFOA 3WU2H 2HPCB 1L0LD 1ZW0A 1N7SD 2IFMA 3V2QA 1GK6A 2QJYB 1VQ4P 5M1BA 2PEIA 4BPFA 4BRYA 2ZYDA 1J2JB 1J1EB 1EXIA 4ASWA 4UHPB 2BCCG 3DS5A 2XNDH 3A0BE 2WPTA 3CX5H 4C7NB 2OYHC 3FWNA 4L74A 2ZXXA 1P84E 2A06D 1LTGC 3H1HE 1NAFA 1JNMA 2N1TA 3L73E 3C1LA 3TNUA 1VQKP 4H44D 1Q86Q 4DJGA 2AXTE 2JDIH 2KG8A 1G1IA 5TISE 1KZUB 1OW7A 1JM0A 3GW6A 1K05A 2WPSA 2OQQA 5F2OA 3H1IE 2WSEH 5E79H 1X0TA 3GKLC 4GR2A 1J1EC 5AW0B 2Z44A 3GHGA 5KKZC 1GXGA 1NOHA 1AVOA 4U3FD 2C9LY 2IBZE 2Y9YA 2LXBA 3V2PA 3B8EB 2YO2A 2WT7B 2BUOA 1CW5A 1NTMG 1JY3P 3M0AA 2WZ7A 1D7MA 2Q7CA 2E74D 1KMIZ 3L74J 5CMZA 4PXHB 1SQQG 5AVYB 1BDCA 3SFEC 1GL2A 2G8YA 3Q20A 3H1JJ 3S1KA 1QLED 1VQ5P 1FU1A 5GTHE 3G0VA 1NO4A 1IK9A 2MR8A 3D6YA 2WSCJ 5HGMA 1DEBA 4IOIH 2KW2A 2ZJSE 3H1LD 1JTHB 4D6TD 1Y47A 3T97A 3LRYA 1L4AD 3GJNA 4WWIA 3CWBD 2JB0A 2R3SA 1NTZG 1JY3N 1NGMB 3WMM0 2EHSA 1DV5A 2E75B 1H0TB 2ZT9D 2FBWC 4UB8H 1QRJA 2KODA 4COCA 1MZ8A 2MF4A 2K0XA 4OGQD 3NXSA 4EYYQ 1HJBA 4M3LA 2LOLA 1EZVI 1S5LE 4IZ6A 2DNWA 3I55P 1KILC 1SQPJ 2HPCA 3IN6A 3K5BA 3MD0A 1LJ2A 4U0BA 2ROQA 1U57A 5BS2A 1SQXG 1L2PA 4UB6E 3P8CE 1IUQA 1KQGB 1KC8Q 4HB1A 2WPVB 1RE4A 3KQGA 1PEUA 2M8NA 1BXIA 3L35A 2XNXA 2KK7A 2Q3EA 1M1JC 5CCHC 2FYZA 1HWTC 3A3YB 1KD1Q 2B88A 1CZQA 3CL3D 4RESB 3IR9A 1YJ9P 1LT9C 3QH9A 2WQYC 2YXQB 1FDMA 4XFJA 3TYYA 1FOSE 1USEA 2FYNC 2KXPB 3EQ2A 3TK1A 1VQ7P 1N7LA 1PGOA 1LTSC 1FS0E 1WMKA 2CNRA 1RHZB 3LMOA 5DCKA 2PEOA 3L71J 2YKPA 4W80A 1F80D 3V6IA 3M0DA 1FDIA 2FQ1A 1LTTC 1M6NA 2X2BA 1MZ9A 3H1LE 1Z6MA 5AVTB 5KP8B 4JQ0D 4D6TE 1NVOA 2LIWA 4L75A 3B5NB 2QJKC 3CWBE 3GF7A 2KS1B 2M8RA 4MN4C 1FR2A 2QJPB 2NPSB 5CBOA 2XV5A 1HGVA 2JR8A 5CJ4A 4IFMA 1JY2O 3L73G 2KOSA 2FXPA 4K35A 1CI6A 2KLUA 2E43A 1GTWA 4H0LD 5KAFH 3KZIH 2Z4EA 1SQVK 2KR5A 1VL2A 3BCCD 3H1IG 3DS2A 3LW5J 3M9BA 1PGPA 2C0WA 3RGUA 2AFEA 2ZVNB 1CSBA 1SS1A 1YHQP 3B5NC 5GTIH 4IFFA 1SQPK 2QVAA 5CZDB 2BHVA 2IBZG 2E5TA 1LP1A 3B71A 2QJPC 1D1DA 2NPSC 4WY4B 3G28A 1Q81Q 3JCUE 3WUTA 1YTZT 1IZNB 1E0HA 3OJAB 3HD7D 3PRJA 3AEFC 2PY8A 2B87B 5F2KA 1L0HA 1GK4A 3QWOC 2OTLP 5CHXA 1GW4A 1SQBD 3F89A 4Y99B 5APVA 4DT0A 1E6JP 3B4SA 1SFCA 2E76C 2JAZA 5AVUB 3ITKA 3TGUD 3IFMA 3H1KD 1U7MA 1ACPA 1NKZB 2M5RA 1JB0J 3FWLA 3VMYA 4NPEA 3AEBC 2K37A 2ZYGA 1AJYA 2OARA 1L0LG 1QVFO 3RL0B 1T8KA 4C46A 2JU2A 2MD9A 2HYNA 1DNYA 1RF0C 5KLVD 2FXMA 1EMVA 3L72E 2FFDA 3RK3B 2N50A
chains in the Genus database with same CATH topology
1ZMBA 1S72P 2P9XA 4U0BA 4GR2A 2EFJA 2Z44A 3DPHA 1M6EX 5BS2A 2XXMA 3NTEA 4COPA 2QEXP 2M8LA 4PH0A 3HYBA 1IUQA 3MGEA 1AUMA 2M8PA 2PEJA 4M0IA 1KC8Q 4IPYA 2BUOA 4U0EA 3HZQA 3CCUP 3OW2O 3CD6P 3CCJP 2E1MA 1A43A 4U0CA 1PEOA 1VQ8P 3G71P 5HGLA 3DS2A 1QVGO 3CC7P 1VQPP 3CC4P 1PEUA 2M8NA 1VQ9P 3CCMP 1W2BO 1RO0A 1Q82Q 1K73Q 1PEQA 4XRQA 4U0AA 1YHQP 1YIJP 1K9MQ 1VQNP 3G1GA 5BS1A 3CCLP 3DS3A 3H47A 1KD1Q 2BHVA 1K30A 4XFYA 1D1DA 3CMEP 2JO0A 3G28A 1Q81Q 1PEMA 1YJ9P 1YITP 3Q20A 2XT1A 1A8OA 1VQ4P 1VQ5P 2PEIA 2LF4A 1VQLP 2EIAA 3G0VA 2PY8A 3DS4A 3B5IA 3CCVP 2Z45A 5F2KA 5HGMA 5HGOA 1YJWP 3G21A 1VQ7P 3DS5A 2OTLP 4XROA 2PEMA 2PEQA 2Z46A 3G1IA 3I56P 1VQOP 1VQ6P 3G29A 5HGNA 3LRYA 3H0DA 3CCSP 3CCQP 5DCKA 2CWOA 2OTJP 4WYMA 1RNIA 1E6JP 5I4TG 3CPWO 2L6EA 2PEOA 4GR6A 3DTJA 5F2NA 2EG5A 1K8AQ 1RO2A 2PENA 1EIAA 3P05A 2JYGA 1YI2P 3DS0A 2PEKA 3RG6C 2JYLA 1M6NA 3H4EA 1EOQA 1KQSO 1VQKP 1YJNP 1Q86Q 3WBHA 4QNBA 1M1KQ 3G26A 4PH1A 1VQMP 1NJIQ 1N8RQ 1QRJA 2KODA 4XFZA 1JJ2O 4COCA 5JPAA 3CCRP 3CCEP 2OARA 3CC2P 1Q7YQ 1QVFO 4U0DA 1BAJA 2QA4P 3CMAP 1M90Q 2ONTA 3DS1A 4XFXA 3CXCO 3G6EP 5F2OA 2DGYA 4U0FA 3VRLC 2XV6A 1M74A 3I55P 3E2DA 3G4SP 2BQ1E 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 P;  3CCV P;  3CCM P;  1W2B O;  1Q86 Q;  1M1K Q;  1YJW P;  1Q82 Q;  1K73 Q;  1VQM P;  1NJI Q;  1N8R Q;  1YHQ P;  1YIJ P;  1VQ7 P;  1K9M Q;  1JJ2 O;  1VQN P;  2OTL P;  3CCL P;  2QEX P;  3I56 P;  1VQO P;  3CCR P;  1KD1 Q;  3CCE P;  1VQ6 P;  3CC2 P;  1Q7Y Q;  1QVF O;  3CCS P;  3CCQ P;  3CME P;  2OTJ P;  1VQK P;  2QA4 P;  3CPW O;  3CMA P;  1Q81 Q;  1KC8 Q;  1YJ9 P;  1M90 Q;  1YIT P;  1K8A Q;  3CCU P;  3CXC O;  3OW2 O;  3G6E P;  1VQ5 P;  1VQ4 P;  3CC4 P;  3CCJ P;  3CD6 P;  1YI2 P;  3I55 P;  1VQL P;  1VQ8 P;  3G71 P;  3G4S P;  1VQ9 P;  1QVG O;  3CC7 P;  1VQP P;  1KQS O;  1YJN P; 
#chains in the Genus database with same CATH topology
 2NZ2 A;  2M3B A;  5BU5 A;  3AEE C;  2H43 A;  2A06 G;  1IFI A;  1OWA A;  2J58 A;  2K3R A;  2YIU C;  2JO1 A;  3OW2 O;  3CD6 P;  3A0H E;  5KLI B;  2KZI A;  3M9H A;  3CC7 P;  3L75 J;  1VQ9 P;  2QSI A;  4ASV A;  1HTL C;  1J1D B;  3AE2 C;  4U0A A;  4AYC A;  1KYO D;  5DJU B;  3JC2 2;  1S1C X;  1OX3 A;  3C8V A;  1NTM J;  2QE7 H;  3BCC E;  2GA1 A;  1A8O A;  2KOG A;  3KXD A;  3H32 B;  1ZXG A;  1LTI C;  2UWJ E;  5APS A;  3NTN A;  3CXH I;  2I1J A;  1FZC B;  1AVY A;  2KS1 A;  3RK3 C;  3SWF A;  5CCG C;  2OTK E;  1SQQ J;  3N4X A;  4H2W C;  1LWU B;  4DCK A;  1M56 D;  3I56 P;  2I8D A;  1UNK A;  2FQ0 A;  2K0D X;  3FXE A;  2HOD B;  1T6A A;  4PJ0 E;  1URQ B;  1N2D C;  1P84 D;  3H1H D;  5APT A;  1PPJ D;  2IX7 C;  4PH1 A;  2ERH A;  2KI7 B;  1SQB E;  3L70 J;  1FE6 A;  4GT1 A;  3A7O A;  3HUS A;  3CE7 A;  2LR2 A;  2ZYA A;  3TGU E;  2XDJ A;  1RF1 A;  3H1K E;  3VRL C;  1PV3 A;  3VMX A;  3E2D A;  2SPZ A;  1BGY E;  2WWW A;  1UII A;  3MZW B;  4WY4 A;  1OMI A;  3H1L G;  3M91 A;  1LTB C;  4D6T G;  2XXM A;  5B5E H;  4I6M C;  3CWB G;  1KB9 D;  2KSE A;  4M0I A;  2ZXE B;  1VKU A;  2E1M A;  2HFE D;  1A43 A;  5KAI H;  3RL0 g;  3P8M C;  3PLN A;  2KGA A;  3EFF K;  1FZF A;  3EWK A;  2N5H A;  1NAY A;  1JUN A;  2GDY A;  1SQX J;  3N7N A;  1IMP A;  3PH0 A;  1X79 B;  1K30 A;  3M06 A;  3CME P;  2FYU J;  1RE3 A;  4A7P A;  5AW7 B;  3S4R A;  2K92 A;  2DW3 A;  4GDO A;  1HVV A;  7CEI A;  1KYO E;  1YTZ I;  1G2C B;  3OAK A;  3KPE A;  4PD4 I;  2CK3 H;  2E75 D;  1JCD A;  1FAV A;  2K88 A;  3MUD C;  1NWQ A;  3VYI A;  2CPB A;  1GL2 C;  1HY8 A;  1GW3 A;  5B66 H;  2M0B A;  5AVQ B;  2JJL A;  1LT1 A;  2L4B A;  1NTK D;  1NTM K;  5KKZ B;  1S5L X;  1N73 C;  2M3E A;  2D2C B;  2XKM A;  3P32 A;  1SQQ K;  4H13 D;  1JMB A;  1SFC D;  3HTK A;  1FDO A;  1UIX A;  3HE5 A;  3BVH A;  3O6Q B;  1QL1 A;  4TLF A;  1EDJ A;  1PPJ E;  4JF7 A;  1S72 P;  1BCC D;  2FVF A;  4CPG A;  2EFJ A;  1VF5 B;  5KJ7 A;  1FZC A;  1QL2 A;  1HBW A;  3RK2 B;  3P8C D;  1ZRT D;  2H7H A;  3BRT B;  2IFN A;  3SWY A;  1Q90 D;  5APY A;  1M8O B;  1BE3 D;  2IDB A;  1KB9 E;  4LGD E;  5AVV B;  5TJH A;  1SLQ A;  2D2C C;  5APW A;  4MRT C;  3A5T A;  3CXH H;  1M57 D;  1IFJ A;  2KOP A;  2Q9I A;  4BXL A;  2CQ8 A;  3HD7 A;  1L0N D;  3AE8 C;  1KFM A;  3L74 E;  1P84 I;  3O8Z A;  2XZ1 C;  1EXJ A;  1LTJ C;  2ZFC A;  1N86 A;  3FX0 A;  3W67 A;  1VF5 C;  1IK7 A;  3VP9 A;  3CCQ P;  2CWO A;  3RK2 C;  5I4T G;  1SQX K;  4GR6 A;  3RG2 A;  1T2K D;  3L71 D;  2IPP A;  3BCC G;  1EIA A;  2N98 A;  2JYG A;  3V2R A;  2FYU K;  2PEK A;  3BRV B;  3B5N D;  2JWA A;  1KIL B;  1JY2 P;  2Y0D A;  4YTP C;  1GZL A;  4AUW A;  1ZN5 A;  5JPA A;  2WSS H;  4IL6 X;  2W90 A;  3FGA D;  5AVZ B;  2YXR B;  1NU1 J;  2M5A A;  2WSF H;  2E5Y A;  3CMA P;  1GPJ A;  2GZF A;  2VSQ A;  5AW3 B;  2IBZ I;  1ZR2 A;  1NTK E;  2B9B A;  1LNQ A;  5AW4 B;  2OYH A;  1GU4 A;  1MKM A;  1QX8 A;  1M6E X;  2VRS A;  3M0D C;  3NTE A;  1M1J B;  4OH8 B;  2PAJ A;  1SQB G;  1L0L J;  2KG6 A;  3SFD C;  3L4F A;  3MGE A;  1AUM A;  1SQV J;  3VMZ A;  1DX7 A;  3CCJ P;  3TGU G;  1LT9 B;  1BCC E;  3H1K G;  3EJE A;  1HQB A;  1FZG A;  1AV1 A;  1JY2 N;  3LIE A;  5H2F E;  4GOD A;  1K73 Q;  2FYN B;  4WY4 D;  2Z5I A;  2RMZ A;  2Y0C A;  1HUC A;  1ZRT E;  2QG4 A;  1GD2 E;  4L73 A;  4PV1 C;  4ZKP A;  2K9J B;  5KLV G;  2P67 A;  2NO8 A;  2LKI A;  4QMA A;  5AW5 B;  4I2L C;  1TU3 F;  3PTZ A;  1BE3 E;  3C9I A;  3E1I A;  2K5X A;  2P1J A;  2FVA A;  4LLH A;  1L0I A;  4H2Y C;  2N6Y A;  4C7N A;  4GKG A;  2FQ2 A;  4PD4 H;  1QGK B;  4XRO A;  2PEQ A;  4H44 B;  2WMM A;  3HE4 B;  2Q6Q A;  2QJK B;  2N9B A;  2OTJ P;  3MHV A;  1PP9 J;  3CX5 D;  1L0N E;  2AEJ A;  1YI2 P;  1USD A;  1HGZ A;  2KWL A;  1N7S C;  3GMA A;  1EOQ A;  2YKO A;  3RL0 D;  1RQU A;  4U3F J;  3G3Z A;  2ZVO B;  4NPF X;  1ZR4 A;  2P10 A;  2LIU A;  3L71 E;  1OR5 A;  1M90 Q;  3RK3 D;  4EIJ A;  3EFG A;  1IO4 A;  2IZ1 A;  2A45 G;  2KNC B;  1FZA A;  1ZP0 C;  2N5I A;  2VLQ A;  3EJD A;  3WUU A;  1KQL A;  1CEI A;  3DPH A;  2WT7 A;  5B5E E;  3L72 D;  1JOC A;  1H8A A;  4H44 C;  2PEJ A;  5HVC A;  3HZQ A;  4F37 A;  1NU1 K;  2W6B A;  3H1H G;  1PPJ G;  3L75 D;  3CCM P;  2LKM A;  1YIJ P;  4N6J A;  1AYI A;  1K9M Q;  3A0B H;  2Q5U A;  5KJ7 D;  2JEE A;  2JGP A;  2LPK A;  1HH0 A;  4RJT A;  1P84 H;  1L0L K;  1SVF A;  2E76 B;  3SWK A;  5KP6 B;  2P2U A;  1JTH A;  1FBM A;  3Q2Y A;  1YJW P;  2J5U A;  2W8Z A;  1Z56 A;  2AXT H;  3WUV A;  2O01 N;  3WU2 E;  1GDT A;  3G1I A;  3II6 A;  2E74 C;  5HGN A;  4DG9 A;  2E42 A;  5TIS H;  2BEZ F;  1H0T A;  1URQ D;  4RKU J;  4OGQ B;  2CG5 B;  5B66 E;  5CCH A;  2O01 J;  2KG9 A;  3VOP A;  1YJN P;  2MY5 A;  1NJI Q;  4NEO A;  3L70 D;  2YKQ A;  1LT9 A;  3CX5 E;  2KP8 A;  3R4Y A;  3SSU A;  1L4A C;  5AW8 B;  2YIU B;  1M74 A;  2YMK A;  3G4S P;  5APU A;  2CGQ A;  2P9X A;  1LTA C;  2JU1 A;  3V4W A;  1BGY D;  4PWV B;  2J59 M;  2OYI B;  2N9Y B;  3AE3 C;  3V5B A;  2BCC J;  2RKL A;  2VLO A;  3TSI A;  3RK3 E;  2ZT9 C;  2Y0E A;  4OGQ C;  2QRX A;  2N6Z A;  2XZ0 D;  3HUS C;  4N78 E;  5E79 E;  1VQ8 P;  1NTK G;  5GTH H;  3H6P A;  1W2B O;  5DJT B;  4XRQ A;  5EFW B;  3CXH E;  2FYU D;  2XT1 A;  1EQ7 A;  2L9F A;  3L75 E;  2MVV A;  2EIA A;  1BCC G;  5CJ0 A;  2R32 A;  2XU6 A;  3W68 A;  2H8P D;  1FOS F;  2GUV A;  4XE5 B;  4YPC A;  2OYI C;  3G21 A;  2O3J A;  1KQF B;  2Z46 A;  3H0D A;  1NTM E;  3AE4 C;  4HKZ H;  2L6E A;  1IC2 A;  2KZJ A;  3DTJ A;  1X3O A;  2K2Q A;  1PZQ A;  1S5L H;  3B5N A;  3DS0 A;  2AEM A;  4L76 A;  1DH3 A;  3PHL A;  1W2E A;  1KQS O;  1BE3 G;  1SQQ E;  1BSN A;  2NPS A;  1M1K Q;  2D2C D;  2N1T B;  1AQT A;  3TNU B;  4UB6 H;  5BU8 B;  2QA4 P;  2WSF J;  3DS1 A;  4H0L B;  1L0N G;  2K0Y A;  3MGN A;  1VF5 D;  3L70 E;  1PL5 A;  4UB8 E;  3EJB A;  2W6J H;  2L0Q A;  3G9R A;  3Q5R A;  2QM7 A;  2FAD A;  3NMD A;  3L71 G;  3GHG B;  1H89 A;  1NTZ J;  3Q1M A;  3GF3 A;  1NHL A;  4Y28 J;  4I7Z C;  1VQP P;  1A02 J;  4ZMD A;  1RY3 A;  1Q82 Q;  3U1A A;  3KDP B;  2N1T C;  1RF0 A;  4H2X C;  3AE7 C;  1PEM A;  2B87 A;  1YIT P;  1OFC X;  4H0L C;  1X22 A;  2GYK A;  2V7Q H;  1GL2 B;  5APQ A;  4DOJ A;  1GXH A;  1Q2N A;  1SQX E;  3CCV P;  4BPH A;  1BDD A;  4QKO A;  3L74 D;  2GZE A;  2FXO A;  2FYU E;  1MV8 A;  4I1L A;  1H88 A;  2W83 C;  1N73 B;  1Y9B A;  3GHG C;  1KIL D;  5KLV J;  2EG5 A;  1PIX A;  4IL6 H;  3T97 B;  3H1J D;  2MJZ A;  4YXW H;  4B86 A;  2FAE A;  3HD7 C;  1DIP A;  2HG5 D;  1ZME C;  2GDX A;  3CCE P;  1JCC A;  2K94 A;  1OZH A;  1EZV D;  2ONT A;  1KFN A;  4GOF A;  4XFX A;  5CCG A;  3G6E P;  3IAO A;  3KHU A;  2DGY A;  2XV6 A;  2AXC A;  2O01 H;  2POH A;  3VTP C;  5CCH D;  3M9Q A;  2OYO A;  5C39 A;  2R5B A;  3HYB A;  3GG2 A;  4U7J A;  1SQV D;  3JCU H;  2YMY A;  2K9Y A;  2KGD A;  3TF5 A;  1SQP D;  2JQ4 A;  1NYH A;  1S3J A;  3E1R A;  4BPG A;  3G1G A;  1LTJ B;  3CCL P;  3H32 A;  4HYT B;  2HLO A;  3H47 A;  2BAS A;  1KYO I;  1OVU A;  5KAF E;  4XFY A;  1JMM A;  1MFZ A;  3D70 A;  1MUU A;  1G1J A;  3GZL A;  3KYQ A;  3KZI E;  1PFI A;  1LWU A;  2JBG A;  3H1H J;  2A45 I;  1NTZ K;  3L73 J;  5HGO A;  3L72 G;  1UJZ A;  5GTI E;  2WPR A;  4N3Y B;  2RN0 A;  3NY7 B;  2HOD A;  1QEX A;  3CCS P;  1URQ A;  2OGU A;  4WYM A;  1RNI A;  2KYV A;  3AE6 C;  2QJY C;  2K93 A;  1PP9 D;  4JYB A;  4WVZ A;  1SQB K;  1R5L A;  3GZM A;  1A02 F;  1IFP A;  2JYL A;  3H1I J;  3L75 G;  2FVE A;  2FAC A;  1SP4 A;  3WBH A;  1RE4 C;  4XFZ A;  5KTB A;  4R4L A;  3F5H A;  1KIL E;  3IF4 A;  3CC2 P;  1Q7Y Q;  5AVX B;  4U0D A;  1XTG B;  1U7J A;  3H1J E;  4W7Y A;  1EDK A;  3S9O A;  1T3J A;  2H88 C;  3A0H H;  3USS A;  2BQ1 E;  5AW1 B;  5KLV K;  3I5C A;  2C0X A;  1VHN A;  2GZJ A;  2NPS D;  2WTY A;  2IZ0 A;  3MUD A;  1NU1 E;  1EZV E;  1S9K E;  2I1K A;  2MKV A;  3H25 A;  1ZV8 A;  1GU5 A;  1KB9 I;  4U0E A;  1CI6 B;  1ZLL A;  4OWF A;  4PV1 B;  4R4M A;  3VN0 A;  3G71 P;  1QVG O;  3CC4 P;  1DD4 A;  1KLP A;  3Q5P A;  1N73 A;  4Z1M H;  2WIT A;  3B4Q A;  4OVN F;  3L70 G;  1L0L E;  3E7K A;  4JPZ B;  2QIW A;  1SQV E;  2E76 D;  2W27 A;  1IMQ A;  3U43 A;  1S2E A;  1X9V A;  2JO0 A;  4WB4 A;  5AW2 B;  2Q1K A;  1SQP E;  1LP1 B;  1G2C A;  1NTK J;  1JEK A;  2O1J A;  4PJ0 H;  1N7S B;  3DS4 A;  1PGJ A;  3P7K A;  3D71 A;  1BGY G;  2FHS C;  4BWN A;  4W7Z A;  2PEM A;  3JSV C;  2K1A A;  2A06 E;  2KGE A;  2VLN A;  3A2A A;  5K5G B;  1K8A Q;  3VP8 A;  5AVW B;  4LC1 A;  3P05 A;  4CA3 A;  3Q5S A;  3L37 A;  4H13 B;  4NPD A;  1BCC J;  4WBA A;  5AVS B;  1SFC B;  3O6Q A;  3FXD A;  3UIA A;  1PP9 E;  2FYU G;  1OIP A;  1FZE A;  1LTJ A;  2E75 C;  2FY8 A;  2G3A A;  4U3F E;  1BE3 J;  4EDF A;  5AVR B;  1R5S A;  2Y9Z A;  5APX A;  1WRG A;  2P7J A;  4COP A;  2BCC D;  2FFD B;  3AE9 C;  1OVR A;  2PFX A;  1MFT A;  2R3C A;  1L0N J;  2FKW B;  5CCG D;  4U0C A;  3BAS A;  1PEO A;  3Q3D A;  4H13 C;  2AEF A;  1DEE G;  1ZOY C;  1VPC A;  2PGD A;  2QNW A;  1SFC C;  1YQ3 C;  4N78 D;  1KYO H;  1HF9 A;  2MVU A;  2AFD A;  1X8Y A;  2KSJ A;  2V4H A;  5BS1 A;  2GM4 A;  4K3A A;  2GDW A;  3AEA C;  2E74 B;  4HJG H;  1AQ5 A;  3CXH D;  2A45 H;  1GMJ A;  1JY3 O;  5KAI E;  3OA7 A;  4KJM A;  2LF4 A;  1YYC A;  2V7Q J;  3B5I A;  3ZDM A;  3CLQ A;  1R8E A;  3H1L J;  4D6T J;  1FZB A;  2FFD C;  4O9B A;  3CWB J;  2H89 C;  1KIL A;  3CPW O;  3BAT A;  4GIF A;  2KB7 P;  4IL6 E;  1NTM D;  2KOO A;  1L4A B;  2N1T D;  2XZR A;  1WT6 A;  3G26 A;  1VQM P;  1N8R Q;  1NTK K;  1IFM A;  2O1K A;  1SQQ D;  3ABV C;  1BAJ A;  2ZT9 B;  3RBX A;  1DD3 A;  3PJS K;  4AQR D;  4EI2 A;  5BVZ A;  1ZNV A;  2EHT A;  2R44 A;  1M1J A;  3HUS B;  1T2K C;  3CI9 A;  1KV4 A;  4ZNC A;  1RH5 B;  2Q3I A;  3AED C;  1RF1 B;  2AF8 A;  3L74 G;  4KHX A;  1KB9 H;  2Z5H A;  1N7S A;  1HJ0 A;  3H1J G;  3CCU P;  1NTZ D;  2PRR A;  3VMA A;  2KIK A;  1IFD A;  3V4Q A;  1OXZ A;  2KOQ A;  1OVV A;  1W5C E;  2BCC E;  3D6Z A;  2K9J A;  2LTE A;  1NU1 G;  1EZV G;  1GL2 D;  1KTM A;  2IYO A;  3V2N A;  1AF8 A;  5AW9 B;  1FJP A;  3HE4 A;  2WSC H;  2L22 A;  1LGH B;  1KOR A;  1FJK A;  4EOT A;  2Z45 A;  1PGQ A;  1L0N K;  1RF1 C;  5AW6 B;  4JBZ A;  1SQX D;  4PD4 D;  1VQO P;  1SQV G;  4WY4 C;  1NQ4 A;  5F2N A;  3AE5 C;  3CX5 I;  1RO2 A;  2WSE J;  1SQP G;  3H4E A;  2JP3 A;  4ZKU A;  4QNB A;  3AEC C;  3L72 J;  1XTC C;  1Y8A A;  2NRG A;  2BEQ D;  4BRY B;  1E5W A;  4Y99 C;  2L91 A;  2GUS A;  2KNC A;  2GZI A;  1YBK A;  1EDL A;  3MIW A;  4U0F A;  1OW8 A;  1KN7 A;  1YQ4 C;  1IFN A;  3M1M A;  2RH0 A;  4I7Z B;  1NKN A;  1IJD B;  1RE3 C;  1RQV A;  5H2F H;  3HTK B;  3HE5 B;  4YXD C;  2GZG A;  3RL0 C;  2B89 A;  2P58 A;  2M8P A;  1EDI A;  1PP9 G;  4JYC A;  4IPY A;  3MP7 B;  3U1C A;  3BCC J;  5HGL A;  1K04 A;  3HRN A;  1VDF A;  4U3F G;  5HV8 A;  1OW6 A;  1PEQ A;  4IFD K;  4DZO A;  3RK2 D;  1VQN P;  3DS3 A;  1L4A A;  4R0M A;  3LID A;  1NTZ E;  2YO3 A;  2QM8 A;  1EC5 A;  3RBZ A;  5KLI C;  2LML A;  1VQL P;  1J1D C;  5L8R J;  2KUB A;  3AEG C;  3L73 D;  2C9N Y;  3HD7 B;  5CBN A;  2MR7 A;  1VQ6 P;  3G29 A;  2ITA A;  1SQB J;  1BSH A;  4HH2 A;  1M7L A;  3MTU E;  2WPQ A;  2LXC B;  1AA0 A;  2IYP A;  2LL8 A;  2PEN A;  2JWD A;  2YNY A;  3TGU J;  5KJ7 C;  1FZC C;  2VLP A;  3H1K J;  4XA4 A;  3RG6 C;  1E79 H;  2KGC A;  3H1I D;  5EJD A;  1BGY J;  2W6A A;  4PD4 E;  1LWU C;  1FC2 C;  1JJ2 O;  3CCR P;  4HKG A;  2L5G B;  2IBZ D;  2ZAE B;  4RO0 A;  5KLV E;  3PP5 A;  2AVA A;  3U59 A;  3R2P A;  3TDK A;  3CXC O;  3AE1 C;  2OYI A;  5EW5 E;  1URQ C;  2R5D A;  2M5A B;  4TT3 H;  4C7R A;  1T8Z A;  1S4X A;  1ZMB A;  5KP7 B;  2PP6 A;  2KOR A;  2KLV A;  3L36 A;  2PNG A;  2CPS A;  2QEX P;  2M8L A;  4PV1 D;  1NH4 A;  4GOE A;  4PH0 A;  3NFQ A;  2HR3 A;  2OYH B;  1NU1 D;  2JKV A;  1S9K D;  3GLM A;  1T3U A;  3LW5 H;  4KT0 J;  2WVR A;  1JO5 A;  1RO0 A;  1AFO A;  3WU2 H;  2HPC B;  1L0L D;  1ZW0 A;  1N7S D;  2IFM A;  3V2Q A;  1GK6 A;  2QJY B;  1VQ4 P;  5M1B A;  2PEI A;  4BPF A;  4BRY A;  2ZYD A;  1J2J B;  1J1E B;  1EXI A;  4ASW A;  4UHP B;  2BCC G;  3DS5 A;  2XND H;  3A0B E;  2WPT A;  3CX5 H;  4C7N B;  2OYH C;  3FWN A;  4L74 A;  2ZXX A;  1P84 E;  2A06 D;  1LTG C;  3H1H E;  1NAF A;  1JNM A;  2N1T A;  3L73 E;  3C1L A;  3TNU A;  1VQK P;  4H44 D;  1Q86 Q;  4DJG A;  2AXT E;  2JDI H;  2KG8 A;  1G1I A;  5TIS E;  1KZU B;  1OW7 A;  1JM0 A;  3GW6 A;  1K05 A;  2WPS A;  2OQQ A;  5F2O A;  3H1I E;  2WSE H;  5E79 H;  1X0T A;  3GKL C;  4GR2 A;  1J1E C;  5AW0 B;  2Z44 A;  3GHG A;  5KKZ C;  1GXG A;  1NOH A;  1AVO A;  4U3F D;  2C9L Y;  2IBZ E;  2Y9Y A;  2LXB A;  3V2P A;  3B8E B;  2YO2 A;  2WT7 B;  2BUO A;  1CW5 A;  1NTM G;  1JY3 P;  3M0A A;  2WZ7 A;  1D7M A;  2Q7C A;  2E74 D;  1KMI Z;  3L74 J;  5CMZ A;  4PXH B;  1SQQ G;  5AVY B;  1BDC A;  3SFE C;  1GL2 A;  2G8Y A;  3Q20 A;  3H1J J;  3S1K A;  1QLE D;  1VQ5 P;  1FU1 A;  5GTH E;  3G0V A;  1NO4 A;  1IK9 A;  2MR8 A;  3D6Y A;  2WSC J;  5HGM A;  1DEB A;  4IOI H;  2KW2 A;  2ZJS E;  3H1L D;  1JTH B;  4D6T D;  1Y47 A;  3T97 A;  3LRY A;  1L4A D;  3GJN A;  4WWI A;  3CWB D;  2JB0 A;  2R3S A;  1NTZ G;  1JY3 N;  1NGM B;  3WMM 0;  2EHS A;  1DV5 A;  2E75 B;  1H0T B;  2ZT9 D;  2FBW C;  4UB8 H;  1QRJ A;  2KOD A;  4COC A;  1MZ8 A;  2MF4 A;  2K0X A;  4OGQ D;  3NXS A;  4EYY Q;  1HJB A;  4M3L A;  2LOL A;  1EZV I;  1S5L E;  4IZ6 A;  2DNW A;  3I55 P;  1KIL C;  1SQP J;  2HPC A;  3IN6 A;  3K5B A;  3MD0 A;  1LJ2 A;  4U0B A;  2ROQ A;  1U57 A;  5BS2 A;  1SQX G;  1L2P A;  4UB6 E;  3P8C E;  1IUQ A;  1KQG B;  1KC8 Q;  4HB1 A;  2WPV B;  1RE4 A;  3KQG A;  1PEU A;  2M8N A;  1BXI A;  3L35 A;  2XNX A;  2KK7 A;  2Q3E A;  1M1J C;  5CCH C;  2FYZ A;  1HWT C;  3A3Y B;  1KD1 Q;  2B88 A;  1CZQ A;  3CL3 D;  4RES B;  3IR9 A;  1YJ9 P;  1LT9 C;  3QH9 A;  2WQY C;  2YXQ B;  1FDM A;  4XFJ A;  3TYY A;  1FOS E;  1USE A;  2FYN C;  2KXP B;  3EQ2 A;  3TK1 A;  1VQ7 P;  1N7L A;  1PGO A;  1LTS C;  1FS0 E;  1WMK A;  2CNR A;  1RHZ B;  3LMO A;  5DCK A;  2PEO A;  3L71 J;  2YKP A;  4W80 A;  1F80 D;  3V6I A;  3M0D A;  1FDI A;  2FQ1 A;  1LTT C;  1M6N A;  2X2B A;  1MZ9 A;  3H1L E;  1Z6M A;  5AVT B;  5KP8 B;  4JQ0 D;  4D6T E;  1NVO A;  2LIW A;  4L75 A;  3B5N B;  2QJK C;  3CWB E;  3GF7 A;  2KS1 B;  2M8R A;  4MN4 C;  1FR2 A;  2QJP B;  2NPS B;  5CBO A;  2XV5 A;  1HGV A;  2JR8 A;  5CJ4 A;  4IFM A;  1JY2 O;  3L73 G;  2KOS A;  2FXP A;  4K35 A;  1CI6 A;  2KLU A;  2E43 A;  1GTW A;  4H0L D;  5KAF H;  3KZI H;  2Z4E A;  1SQV K;  2KR5 A;  1VL2 A;  3BCC D;  3H1I G;  3DS2 A;  3LW5 J;  3M9B A;  1PGP A;  2C0W A;  3RGU A;  2AFE A;  2ZVN B;  1CSB A;  1SS1 A;  1YHQ P;  3B5N C;  5GTI H;  4IFF A;  1SQP K;  2QVA A;  5CZD B;  2BHV A;  2IBZ G;  2E5T A;  1LP1 A;  3B71 A;  2QJP C;  1D1D A;  2NPS C;  4WY4 B;  3G28 A;  1Q81 Q;  3JCU E;  3WUT A;  1YTZ T;  1IZN B;  1E0H A;  3OJA B;  3HD7 D;  3PRJ A;  3AEF C;  2PY8 A;  2B87 B;  5F2K A;  1L0H A;  1GK4 A;  3QWO C;  2OTL P;  5CHX A;  1GW4 A;  1SQB D;  3F89 A;  4Y99 B;  5APV A;  4DT0 A;  1E6J P;  3B4S A;  1SFC A;  2E76 C;  2JAZ A;  5AVU B;  3ITK A;  3TGU D;  3IFM A;  3H1K D;  1U7M A;  1ACP A;  1NKZ B;  2M5R A;  1JB0 J;  3FWL A;  3VMY A;  4NPE A;  3AEB C;  2K37 A;  2ZYG A;  1AJY A;  2OAR A;  1L0L G;  1QVF O;  3RL0 B;  1T8K A;  4C46 A;  2JU2 A;  2MD9 A;  2HYN A;  1DNY A;  1RF0 C;  5KLV D;  2FXM A;  1EMV A;  3L72 E;  2FFD A;  3RK3 B;  2N50 A; 
#chains in the Genus database with same CATH homology
 1ZMB A;  1S72 P;  2P9X A;  4U0B A;  4GR2 A;  2EFJ A;  2Z44 A;  3DPH A;  1M6E X;  5BS2 A;  2XXM A;  3NTE A;  4COP A;  2QEX P;  2M8L A;  4PH0 A;  3HYB A;  1IUQ A;  3MGE A;  1AUM A;  2M8P A;  2PEJ A;  4M0I A;  1KC8 Q;  4IPY A;  2BUO A;  4U0E A;  3HZQ A;  3CCU P;  3OW2 O;  3CD6 P;  3CCJ P;  2E1M A;  1A43 A;  4U0C A;  1PEO A;  1VQ8 P;  3G71 P;  5HGL A;  3DS2 A;  1QVG O;  3CC7 P;  1VQP P;  3CC4 P;  1PEU A;  2M8N A;  1VQ9 P;  3CCM P;  1W2B O;  1RO0 A;  1Q82 Q;  1K73 Q;  1PEQ A;  4XRQ A;  4U0A A;  1YHQ P;  1YIJ P;  1K9M Q;  1VQN P;  3G1G A;  5BS1 A;  3CCL P;  3DS3 A;  3H47 A;  1KD1 Q;  2BHV A;  1K30 A;  4XFY A;  1D1D A;  3CME P;  2JO0 A;  3G28 A;  1Q81 Q;  1PEM A;  1YJ9 P;  1YIT P;  3Q20 A;  2XT1 A;  1A8O A;  1VQ4 P;  1VQ5 P;  2PEI A;  2LF4 A;  1VQL P;  2EIA A;  3G0V A;  2PY8 A;  3DS4 A;  3B5I A;  3CCV P;  2Z45 A;  5F2K A;  5HGM A;  5HGO A;  1YJW P;  3G21 A;  1VQ7 P;  3DS5 A;  2OTL P;  4XRO A;  2PEM A;  2PEQ A;  2Z46 A;  3G1I A;  3I56 P;  1VQO P;  1VQ6 P;  3G29 A;  5HGN A;  3LRY A;  3H0D A;  3CCS P;  3CCQ P;  5DCK A;  2CWO A;  2OTJ P;  4WYM A;  1RNI A;  1E6J P;  5I4T G;  3CPW O;  2L6E A;  2PEO A;  4GR6 A;  3DTJ A;  5F2N A;  2EG5 A;  1K8A Q;  1RO2 A;  2PEN A;  1EIA A;  3P05 A;  2JYG A;  1YI2 P;  3DS0 A;  2PEK A;  3RG6 C;  2JYL A;  1M6N A;  3H4E A;  1EOQ A;  1KQS O;  1VQK P;  1YJN P;  1Q86 Q;  3WBH A;  4QNB A;  1M1K Q;  3G26 A;  4PH1 A;  1VQM P;  1NJI Q;  1N8R Q;  1QRJ A;  2KOD A;  4XFZ A;  1JJ2 O;  4COC A;  5JPA A;  3CCR P;  3CCE P;  2OAR A;  3CC2 P;  1Q7Y Q;  1QVF O;  4U0D A;  1BAJ A;  2QA4 P;  3CMA P;  1M90 Q;  2ONT A;  3DS1 A;  4XFX A;  3CXC O;  3G6E P;  5F2O A;  2DGY A;  4U0F A;  3VRL C;  2XV6 A;  1M74 A;  3I55 P;  3E2D A;  3G4S P;  2BQ1 E;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...