1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
1K73Q 1W2BO 3CCVP 3CCJP 1S72P 2QA4P 1JJ2O 1VQ9P 1KQSO 3CCLP 1YJ9P 1VQLP 1VQPP 1VQ7P 1NJIQ 3CCUP 3CCQP 1KD1Q 3CCMP 1VQ4P 2OTJP 1VQ5P 1YITP 1K8AQ 3G6EP 3CPWO 3CCRP 1VQOP 3CC7P 2QEXP 3G71P 1VQNP 1KC8Q 3CMAP 3CCSP 3CMEP 3G4SP 1YIJP 1QVFO 1VQ8P 1VQKP 3I56P 2OTLP 3CXCO 1VQ6P 1M90Q 3OW2O 1M1KQ 1Q81Q 1K9MQ 3I55P 1Q86Q 1YI2P 1QVGO 3CC2P 1Q7YQ 1VQMP 1Q82Q 1N8RQ 3CCEP 1YHQP 1YJNP 1YJWP 3CC4P 3CD6P
chains in the Genus database with same CATH superfamily
5GTIE 1RE3C 4RJTA 1TU3F 1FOSF 1HJBA 5APVA 4C7NA 2E74C 1AJYA 1VQ8P 1AF8A 1AV1A 1ZOYC 2K9JB 3RK3B 1OVUA 3BCCD 4GIFA 2KG9A 3W68A 3TK1A 1PZQA 4JPZB 1VL2A 3KYQA 1Y47A 2J59M 1KILD 2E5TA 1GTWA 5B5EE 4IFFA 4NPEA 2FFDB 3L72J 2W90A 1KB9E 1H88A 1IFJA 2WSEJ 3HD7A 1SQXE 2K0DX 3AE5C 1X3OA 5AW4B 2Y0EA 3AE1C 1QGKB 3AEAC 2QJPB 3M0AA 2H88C 2KNCB 2MVVA 3CMEP 3IFMA 3L71J 3CXHE 5AW3B 4L76A 1HJ0A 3VMXA 2M8NA 1JY3N 3BCCJ 4IL6E 2KSJA 3H1JG 3CWBG 4WY4B 1NTZD 1PL5A 2O1JA 5KAFH 3DS3A 2H7HA 4JF7A 3DS5A 2E76C 2N1TB 1LT9B 3H1IE 2KGEA 3R2PA 2QG4A 1SVFA 1DH3A 1LWUB 1L4AA 2LTEA 4EI2A 2KI7B 2WPRA 4W80A 3S4RA 4ASVA 2KP8A 3H32A 2OQQA 1HVVA 1HBWA 4N78E 3CX5H 5APYA 3Q2YA 1RE4A 2M5AA 3G21A 2HLOA 1SQXG 1YITP 2N98A 2DNWA 4DT0A 3TGUD 3HD7C 2O1KA 1GL2A 1FZGA 1NTZK 2KOOA 3B8EB 1NTKD 1NTZJ 1FZCB 2XV5A 3S1KA 1HGZA 2MR7A 3H0DA 3PH0A 4Y28J 3AE9C 1XTGB 2IX7C 3M9QA 4JBZA 4QMAA 1PFIA 1VHNA 2H89C 3WUUA 3H1IG 1D7MA 2YO3A 2P10A 2L91A 1EZVD 1G2CB 2A06E 2RMZA 1SFCD 2OYHA 2RKLA 2CGQA 1N86A 1M1JB 3HZQA 1SQBE 4L75A 2BCCD 1VQ4P 1K8AQ 4H0LC 3FX0A 3WUTA 2KXPB 4IPYA 4PJ0H 1K04A 3NMDA 1NH4A 1M90Q 1KMIZ 4TT3H 1RE4C 1GMJA 3RL0C 2K9JA 1S4XA 4PH0A 3FGAD 5AW1B 2Y9ZA 2P9XA 4HJGH 1UJZA 1AVOA 3WU2E 4PV1D 1KILE 3MIWA 3SFDC 5M1BA 3H25A 1URQC 1DV5A 1H0TB 1EXJA 3BRTB 4D6TD 1QLED 4U0AA 1RF0A 2E75C 1G1JA 2ZXEB 1LTAC 2R5BA 4UB6E 2SPZA 1JCDA 5AW9B 1HWTC 2FFDA 1FU1A 3F89A 1Q82Q 2KZIA 3Q1MA 1KORA 3H1HE 2HFED 1J1DC 5C39A 2BCCJ 1ZMBA 2E5YA 3II6A 2LL8A 1T2KC 3GHGB 1BGYJ 1EXIA 5KKZC 4YPCA 2Z5HA 1PEOA 1EDKA 3Q5SA 2KNCA 2MF4A 5KLVE 2N5HA 1KFNA 1T6AA 2XNDH 3I55P 1A43A 1YJNP 3AE4C 3KPEA 3KZIH 4WY4A 3OA7A 1K73Q 2DW3A 2FACA 3VMZA 3BCCG 1HF9A 2P2UA 4XFXA 1KV4A 4Y99B 1LTJB 5KJ7A 5CBNA 3L73J 2N6YA 2N1TA 2M8LA 3B5IA 2ERHA 1LT9A 1LJ2A 1LWUA 2PGDA 4XFJA 3P8MC 1NU1K 1Y9BA 4WYMA 1OMIA 1SS1A 3KQGA 2AXTE 1PGOA 1NU1J 1HTLC 3V2QA 2R44A 1LGHB 4U7JA 1LTGC 1GXGA 3HRNA 3RK2D 3EJBA 4HKGA 4NPDA 3TGUE 1U7JA 1EQ7A 1SQVD 4JYBA 1NTKE 2M3EA 1L4AD 1S1CX 5GTHH 1L2PA 2YIUC 5AVYB 2CPSA 5L8RJ 2LMLA 1NTZG 3AECC 4RKUJ 3CPWO 2FQ1A 1JO5A 1NQ4A 4WBAA 1IUQA 1JY2P 2KODA 1K9MQ 1EZVI 4ZKPA 1HUCA 1GL2D 5KAIE 1S72P 4U0EA 1MV8A 3A0HH 3CCMP 2YKQA 2JGPA 3P32A 5APSA 1M7LA 4PWVB 1SQVK 2ZYGA 2ZYAA 1VF5C 1KZUB 1NHLA 1SQVJ 1IFDA 2E74B 5AVSB 3JC22 3CLQA 2V7QH 4B86A 2YKOA 3L70D 3RG6C 4H13C 5AW8B 1NTKG 1VQPP 2JYLA 1WMKA 3MD0A 2KS1A 1NOHA 2W6BA 4UB8E 2UWJE 1IFPA 4D6TE 1H0TA 4BPFA 2I8DA 3SWYA 1DEEG 4BPHA 4DOJA 2Q5UA 2N9YB 2GZIA 3TNUB 1EZVG 2JWAA 1VQ5P 3RK3D 2K88A 4PD4D 4XRQA 1OW6A 1YQ3C 1P84D 1AUMA 3TYYA 2BCCG 1CW5A 3VMYA 1BGYG 2IYPA 1G1IA 2NPSD 3L70J 1IO4A 3U59A 1YYCA 1MKMA 2E76B 1BCCE 3CWBD 3G71P 4AYCA 5TISE 5DJTB 2Z45A 1OWAA 2E43A 3M0DC 2GZFA 5APWA 2XZ1C 4WB4A 2JDIH 1GK6A 4D6TG 1Y8AA 5HGLA 3P8CD 2WITA 3JCUE 1JMBA 5JPAA 1N7SC 4K35A 3CCRP 2VSQA 2W27A 4WY4D 1KC8Q 2LIWA 2AF8A 5AVRB 3L75E 5I4TG 2Q7CA 5KJ7D 1IC2A 3HD7B 1Q81Q 1NAFA 3L74J 2N1TD 1M74A 1FZEA 1SQPD 2LOLA 3V4QA 2QVAA 2JBGA 1R5LA 2Z5IA 5B66E 4PXHB 1JUNA 1KQSO 3CX5I 4TLFA 2B87B 4OGQC 1PPJD 3V2RA 1UIIA 2LKMA 1FS0E 4L74A 1USDA 2ZT9C 3GW6A 3VRLC 4GOEA 3CCEP 3EWKA 2BEZF 2C9NY 2OARA 1MZ9A 2PEIA 4IFDK 1DNYA 1QRJA 4H0LB 2K5XA 2K37A 2FYNC 3RL0B 3H1KJ 1SQVG 1NTMD 1AA0A 4M0IA 3GZLA 2QIWA 5APUA 3RL0g 2YNYA 1JNMA 2WQYC 1URQB 4EYYQ 4CPGA 1M1KQ 1NAYA 1KTMA 4LGDE 4AQRD 2P58A 3KXDA 4H2XC 1AFOA 3SFEC 4EOTA 2OTJP 1J1DB 3RK3E 2FXPA 4PD4E 3TNUA 2FYZA 3DPHA 5KKZB 1P84I 2EHTA 3R4YA 1P84E 3L72D 1ZV8A 2YO2A 2HYNA 1IK9A 4I1LA 1NTMK 2Y0CA 4I6MC 4W7ZA 3PHLA 1NTMJ 4YXDC 2NZ2A 4H2YC 4U0CA 2KGAA 3O8ZA 2JP3A 1DD4A 1FC2C 1BXIA 2L5GB 3H1JE 2KG8A 3CWBE 3L70G 3L71D 1JCCA 2IYOA 2WTYA 3V5BA 2V7QJ 3ABVC 4GODA 1EDJA 3F5HA 4XFZA 2IPPA 1KD1Q 3P8CE 2XU6A 4Z1MH 4XA4A 2GYKA 1L0NK 2XKMA 3HUSC 1L0NJ 5AVWB 2P7JA 5AW0B 1SQPE 1JEKA 5F2OA 2YIUB 3L74G 1N73C 3A0BH 1PPJE 3NFQA 2B87A 4O9BA 1WRGA 4BRYB 1W2EA 2PEOA 3A7OA 2IBZI 1SQBJ 3VOPA 4GOFA 2L9FA 3RBZA 3V4WA 3GZMA 4U0FA 5BS2A 1L0IA 1QL2A 1GZLA 3G29A 1GU5A 2PP6A 1W5CE 2JU2A 3H1LJ 4MN4C 1VF5B 3DS4A 2KGCA 3BASA 1ACPA 2KR5A 3GKLC 3P05A 2IFNA 3CCUP 3GLMA 1KFMA 2XNXA 4H13B 3GG2A 4W7YA 1SQPG 1A02F 1F80D 3CXCO 2LXCB 1QX8A 4BPGA 4R0MA 1PPJG 5H2FH 1A02J 1BSHA 1BE3D 1URQA 2KLUA 2Z4EA 3L35A 2H43A 1PEMA 4I7ZC 2FADA 3OAKA 2JR8A 2E74D 2QSIA 2EG5A 2P67A 5BU5A 2POHA 3C1LA 4H44C 3H6PA 2QRXA 2KGDA 2FY8A 3L72E 1GPJA 2KYVA 1LT1A 3VMAA 2LPKA 3PJSK 3CCQP 4WVZA 1VQOP 1FZAA 1OVRA 3PLNA 3AE8C 1BGYD 1Z56A 2LIUA 1NTMG 4XFYA 1NVOA 4AUWA 5EJDA 1FJPA 2K0XA 1BE3J 3BCCE 2JB0A 3MGNA 1BAJA 2KS1B 2HPCA 2M3BA 3L73D 1N7SB 4EIJA 7CEIA 1KYOH 5CCHC 2WPSA 3MZWB 1S5LE 3VTPC 1VQMP 2GA1A 2E76D 1USEA 1NU1D 1X8YA 2J58A 2ZFCA 5BVZA 3L72G 1ZR2A 2QM8A 5BU8B 2MKVA 1M8OB 1NWQA 1SP4A 2ROQA 2QJKC 3D6ZA 2GUSA 4OGQB 3G1GA 3D71A 4DZOA 3JSVC 3NTEA 4HKZH 4YTPC 5GTIH 2ZT9B 1MFTA 4BRYA 1NTZE 3L71G 5CBOA 3WBHA 3G6EP 3HD7D 2ZAEB 5KP6B 3VP9A 3B5NC 4IOIH 4HH2A 1KILB 4GR6A 4A7PA 2FKWB 5HVCA 3G3ZA 2HG5D 2Q9IA 2ONTA 1IMQA 2FYNB 2M8RA 4GKGA 1RQUA 3CCLP 1MFZA 5B5EH 3G26A 5AVZB 1YIJP 4QKOA 1KB9H 1OW7A 1HGVA 2KLVA 2ZYDA 1FDIA 5E79E 1UNKA 1Q90D 1VPCA 1RQVA 3K5BA 1GW3A 3M91A 4OH8B 1VQLP 3CX5D 1YBKA 3AEGC 4H0LD 3CXHH 2WPQA 1M6NA 2QEXP 2GDWA 2CNRA 4IL6H 4OVNF 4L73A 4NPFX 1T8ZA 4I2LC 3RL0D 3P7KA 1PGQA 1J1EC 2NO8A 1S9KD 1EZVE 2AXCA 2XXMA 1H8AA 1BCCJ 1RO2A 1URQD 1SQQD 2BHVA 4K3AA 2CK3H 2Q1KA 2W6AA 3CL3D 1X9VA 2BCCE 2E75D 3S9OA 1BGYE 3SWFA 2YKPA 5AW7B 2MR8A 4C46A 1RY3A 1OZHA 5DJUB 3Q3DA 4N3YB 3G9RA 1BDDA 2QA4P 3M0DA 1T2KD 2FYUK 1HH0A 1BE3G 1T3JA 3MHVA 5AVQB 2FYUJ 1VQNP 4U3FJ 2XT1A 2G8YA 5HGOA 2CPBA 1LNQA 3L73E 2OYIC 1DX7A 1N7SA 3HUSB 1RF1C 5BS1A 3AEDC 1SQQK 5HGNA 1NU1E 1SQQJ 2BQ1E 1PV3A 2PENA 3E1RA 2K94A 1FBMA 2D2CC 2EFJA 1N73B 3CMAP 3G4SP 2R3SA 2KOGA 1DD3A 1KYOD 3VYIA 1Q86Q 3L74D 1CSBA 4M3LA 2J5UA 5CCGC 3CD6P 3CCVP 1L0LK 1BSNA 2BASA 3A2AA 2C9LY 1LP1A 1X79B 2YXRB 1L0LJ 5APTA 3GF3A 2HODB 2EHSA 3DS1A 4YXWH 1PGPA 1KILA 2W83C 3SWKA 3L73G 1PP9J 1ZR4A 3O6QB 2FVFA 3WU2H 1U7MA 5KAFE 4C7RA 3B4QA 3RBXA 3MUDC 2V4HA 1OVVA 3CC7P 1NU1G 4UB6H 2N9BA 1GU4A 3EJDA 3TF5A 3UIAA 1JMMA 2P1JA 1SQVE 3T97A 1ZXGA 1EOQA 1HQBA 2XZRA 3CC4P 2MJZA 2AVAA 3H1KD 1ZP0C 2LF4A 4I7ZB 1JY3P 3CX5E 1VF5D 2Y0DA 2Z44A 3VN0A 1KB9D 2JAZA 3HTKB 3M1MA 1CI6B 1X22A 2IBZD 4H44B 4COPA 1T3UA 2QJYC 4H13D 2A45H 5CJ4A 1IZNB 4COCA 1NJIQ 1S3JA 3H1JJ 2PRRA 2PFXA 1JB0J 3M9BA 1KILC 2JYGA 2R32A 4BXLA 3U1AA 4PH1A 1VKUA 2CG5B 3HE4B 2ZJSE 2AXTH 3E2DA 2JWDA 1PEUA 2YMKA 1DIPA 1AQ5A 1QVGO 2Q3EA 2K92A 1M6EX 1VDFA 1KQLA 2RN0A 2K0YA 1JY2N 4MRTC 3DTJA 2B9BA 1ZMEC 2QM7A 2GZJA 3L70E 1EC5A 2KIKA 2WSFH 1SQXK 2LKIA 3Q20A 1SQXJ 3CE7A 2O01N 4PJ0E 1Q7YQ 2AEMA 4N78D 2Y9YA 4UHPB 3HUSA 5AVVB 3TDKA 1E79H 2E42A 2WPTA 1GW4A 1D1DA 3BRVB 4RO0A 1E0HA 5APQA 2KSEA 2QJKB 1PIXA 1SQQG 1N73A 3E1IA 1KYOI 5KAIH 1ZN5A 1L0ND 2ZXXA 3G1IA 3GF7A 2NRGA 3L74E 1N7SD 3H1IJ 3A3YB 1NGMB 1LTTC 1AVYA 2QNWA 4IZ6A 1XTCC 3IR9A 3B5NB 4IL6X 4CA3A 2HODA 2DGYA 3U43A 2MY5A 3MGEA 2G3AA 1FZFA 3FXEA 2I1JA 2KOPA 1ZLLA 1SQBD 1E5WA 2M8PA 2ZVOB 4OGQD 2HPCB 1FZBA 1N2DC 3ITKA 3KZIE 1GXHA 3O6QA 4UB8H 1L0HA 1PP9G 2ZT9D 2WSCH 3EFFK 3H1LD 3WMM0 3FWNA 3A5TA 4DJGA 1AYIA 2FBWC 1SFCC 2M0BA 3H1KE 2OGUA 4OWFA 2NPSB 2R5DA 2JJLA 2FAEA 4QNBA 4R4LA 3AE3C 1RNIA 1H89A 2XZ0D 3I56P 1KB9I 2L4BA 2YXQB 1SQBK 2VLNA 2IBZE 3H1HD 1J1EB 3HTKA 3N7NA 1CI6A 3FWLA 2N50A 5GTHE 5TISH 2RH0A 2N5IA 3CXHI 5KLVD 4PV1C 3BVHA 3V6IA 3HE4A 2JEEA 3H47A 3DS0A 3JCUH 2Q6QA 4U0BA 2AEFA 3AEFC 1NTME 2WWWA 4LLHA 1AQTA 3A0HE 1IMPA 1YTZI 3H1KG 4XROA 2OYIB 1Q2NA 3G28A 2KOSA 5B66H 1N8RQ 3H1HJ 3RGUA 1FOSE 5F2KA 3W67A 1RF1B 5AW5B 1JJ2O 5CCHA 4WWIA 2FHSC 2WZ7A 2IBZG 5KLVK 1OFCX 3G0VA 5KLVJ 3CCSP 1OX3A 4R4MA 3HE5B 2D2CB 1S5LX 2PEQA 5HGMA 3DS2A 1L0NE 2L0QA 2KK7A 5CZDB 4H2WC 5F2NA 4JQ0D 1A8OA 4NEOA 2W8ZA 3GMAA 2I1KA 3RK2C 1M57D 1OW8A 1EDIA 3L71E 5KLIC 3HYBA 2FVAA 3B5NA 3AEBC 2VLPA 1X0TA 2Q3IA 3H4EA 1BDCA 1L4AC 5TJHA 2HR3A 2EIAA 1FE6A 3C8VA 3TGUJ 1NKNA 1NTKK 3LW5H 3C9IA 1VQKP 2C0WA 1NTKJ 1OXZA 2WSFJ 3IAOA 3M9HA 2E1MA 2W6JH 1RO0A 3H1LE 4XE5B 2XDJA 1GL2C 1QL1A 4PD4H 1L0NG 2QE7H 5EW5E 1WT6A 1P84H 2JO0A 2AFDA 2NPSA 3GJNA 4BWNA 1N7LA 2JO1A 2O01H 3CC2P 2BEQD 3E7KA 1YJWP 2Z46A 1LP1B 2QJYB 1EDLA 2A06G 3SSUA 3AEEC 1SQBG 2OYHC 4ZMDA 3VP8A 2WSSH 3KHUA 1FJKA 2AEJA 3PTZA 3NTNA 2A45I 3AE6C 3B71A 1BCCD 3Q5RA 3H1LG 4LC1A 4U0DA 2X2BA 4H44D 3RK3C 5CJ0A 2ZVNB 4D6TJ 1M56D 1K30A 2WSCJ 2YMYA 3T97B 2K9YA 1YI2P 2JKVA 1ZRTD 2VRSA 2OTKE 2OYIA 1BE3E 2LXBA 4F37A 1NO4A 1YJ9P 1RF0C 2NPSC 3QWOC 1K05A 1SLQA 1RF1A 4RESB 3L75D 2PNGA 3H1HG 2FFDC 2WPVB 2FYUD 3D6YA 3N4XA 2LR2A 4U3FD 1NYHA 3LMOA 5K5GB 2VLQA 3HE5A 2FQ0A 5KLVG 3AE2C 1FZCA 2QJPC 3LRYA 3MP7B 1RHZB 2A45G 5CCGA 5CCHD 4ZNCA 4WY4C 2IFMA 2KORA 1JTHB 2WT7B 3AE7C 1OIPA 5KJ7C 2GDXA 4GR2A 1G2CA 2N1TC 2XV6A 3PP5A 1LT9C 1VQ9P 2H8PD 1LWUC 5AVUB 3V2NA 3OJAB 1M1JA 2MD9A 3L75J 2WMMA 1L0LD 3M06A 2K2QA 1VQ6P 4KT0J 3MUDA 3TGUG 1R5SA 1FDOA 2IZ0A 1LTBC 1JOCA 1PP9D 3NXSA 1W2BO 2VLOA 1IJDB 4JYCA 1KN7A 3B5ND 1SFCB 2KB7P 2GDYA 2FXOA 1FZCC 1IK7A 2OYOA 1NKZB 4ASWA 2WSEH 2FXMA 4ZKUA 3FXDA 2CQ8A 3NY7B 3IN6A 5KP7B 1Z6MA 2GUVA 2L6EA 1J2JB 1PEQA 3LIEA 1JY2O 3L4FA 3GHGA 5CHXA 3A0BE 4KJMA 4PV1B 3KDPB 3MTUE 1GD2E 1M1JC 3CCJP 3Q5PA 1IFIA 1S2EA 2PEKA 2O3JA 4C7NB 3H1JD 3ZDMA 1EIAA 1LTJA 3LW5J 1S5LH 2PY8A 3OW2O 2KZJA 1KQFB 1FDMA 5APXA 5EFWB 1YHQP 1KQGB 2K3RA 1ZRTE 1LTSC 3USSA 5KP8B 1YQ4C 4IFMA 3EFGA 2JU1A 1U57A 2FVEA 2FYUE 5AW6B 2KUBA 4U3FE 2O01J 1SQXD 2KOQA 1HY8A 5H2FE 1S9KE 5DCKA 5HV8A 3RG2A 2L22A 1YTZT 3GHGC 1VQ7P 1IFNA 3EJEA 1LTIC 2R3CA 3CWBJ 4DCKA 4GT1A 1SQQE 3CXHD 4GDOA 1FAVA 1QVFO 2ITAA 4HYTB 2JQ4A 1BCCG 5AVXB 1QEXA 3IF4A 1MUUA 1T8KA 3RK2B 2IDBA 1PGJA 2B89A 3TSIA 2BUOA 5KLIB 1R8EA 3BATA 3I5CA 1JTHA 4Y99C 1LTJC 3CI9A 2WT7A 2AFEA 2PEMA 3L37A 2B88A 2PEJA 2D2CD 3H1ID 2KG6A 2M5RA 1L4AB 3QH9A 1UIXA 2KW2A 2KWLA 1KLPA 1RE3A 2GZGA 1L0LE 3H32B 2GM4A 5AVTB 2FQ2A 1EMVA 5E79H 4HB1A 5KTBA 1SQPK 1ZNVA 1OR5A 4N6JA 1SQPJ 3L75G 5CCGD 4DG9A 2FYUG 2C0XA 2M5AB 3WUVA 4EDFA 1CEIA 4U3FG 2N6ZA 1PP9E 3U1CA 2MVUA 2K93A 5AW2B 1GL2B 1ZW0A 3L36A 1RH5B 3LIDA 1SFCA 3PRJA 5CMZA 2OTLP 1GK4A 3V2PA 4KHXA 1MZ8A 2E75B 3EQ2A 3D70A 3B4SA 1KYOE 2GZEA 1JY3O 2WVRA 1DEBA 4PD4I 2K1AA 2IZ1A 1FR2A 1JM0A 1E6JP 2OYHB 2A06D 2CWOA 1CZQA 1L0LG 1IFMA 2PAJA 1GDTA
chains in the Genus database with same CATH topology
5F2NA 3DTJA 5HGLA 1W2BO 3CCVP 1S72P 4U0EA 4U0FA 5BS2A 1VQLP 1VQ7P 3G21A 2OTJP 1ZMBA 3CCMP 1BAJA 5JPAA 4U0DA 1YITP 3G29A 3CCRP 1M6NA 2QEXP 4QNBA 1A8OA 1RNIA 3DS1A 1KC8Q 1PEOA 1QVFO 5I4TG 3DPHA 1K30A 1VQ8P 3I56P 3Q20A 3DS4A 1Q81Q 3I55P 1YI2P 1A43A 3HYBA 1M74A 1Q7YQ 2BUOA 1VQMP 2XXMA 3H0DA 1YJNP 1K73Q 3H4EA 3RG6C 2PEMA 1KQSO 2PEJA 3P05A 4XFXA 4U0CA 1RO2A 2EIAA 1VQPP 1YJ9P 2JYLA 3CCUP 2BHVA 2L6EA 3CC7P 1D1DA 1PEQA 2M8LA 3B5IA 3G1GA 1VQKP 3CXCO 2E1MA 3NTEA 4WYMA 1RO0A 3VRLC 3G1IA 1EOQA 1PEMA 3CCEP 3H47A 3DS0A 4XFZA 3CC4P 4U0BA 3CCJP 2QA4P 3HZQA 2LF4A 2PEKA 3LRYA 2OARA 2PEIA 1KD1Q 3WBHA 1VQ4P 1VQ5P 1EIAA 1K8AQ 3G6EP 4XRQA 1VQNP 2EG5A 3CMEP 2XT1A 2Z44A 2JO0A 5HGOA 4IPYA 4GR6A 2M8NA 1QRJA 4XROA 2OTLP 1AUMA 2PY8A 2DGYA 3OW2O 1M90Q 3MGEA 3M1MA 3G28A 3CC2P 4COPA 5BS1A 1N8RQ 3DS3A 4PH0A 4GR2A 5F2KA 1YHQP 2ONTA 1YJWP 2Z46A 5F2OA 2XV6A 5HGNA 2M8PA 1JJ2O 1VQ9P 3DS5A 3CCLP 2P9XA 4M0IA 4COCA 1NJIQ 2PENA 2BQ1E 3CCQP 3G26A 3CPWO 1VQOP 3G71P 2EFJA 2JYGA 3G0VA 3CMAP 3CCSP 3G4SP 2Z45A 1YIJP 4PH1A 4XFYA 1E6JP 4U0AA 1IUQA 1VQ6P 3E2DA 2PEOA 1M1KQ 1PEUA 2KODA 1K9MQ 1Q86Q 2CWOA 1QVGO 2PEQA 5HGMA 3DS2A 1M6EX 1Q82Q 5DCKA 3CD6P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 Q;  1W2B O;  3CCV P;  3CCJ P;  1S72 P;  2QA4 P;  1JJ2 O;  1VQ9 P;  1KQS O;  3CCL P;  1YJ9 P;  1VQL P;  1VQP P;  1VQ7 P;  1NJI Q;  3CCU P;  3CCQ P;  1KD1 Q;  3CCM P;  1VQ4 P;  2OTJ P;  1VQ5 P;  1YIT P;  1K8A Q;  3G6E P;  3CPW O;  3CCR P;  1VQO P;  3CC7 P;  2QEX P;  3G71 P;  1VQN P;  1KC8 Q;  3CMA P;  3CCS P;  3CME P;  3G4S P;  1YIJ P;  1QVF O;  1VQ8 P;  1VQK P;  3I56 P;  2OTL P;  3CXC O;  1VQ6 P;  1M90 Q;  3OW2 O;  1M1K Q;  1Q81 Q;  1K9M Q;  3I55 P;  1Q86 Q;  1YI2 P;  1QVG O;  3CC2 P;  1Q7Y Q;  1VQM P;  1Q82 Q;  1N8R Q;  3CCE P;  1YHQ P;  1YJN P;  1YJW P;  3CC4 P;  3CD6 P; 
#chains in the Genus database with same CATH topology
 5GTI E;  1RE3 C;  4RJT A;  1TU3 F;  1FOS F;  1HJB A;  5APV A;  4C7N A;  2E74 C;  1AJY A;  1VQ8 P;  1AF8 A;  1AV1 A;  1ZOY C;  2K9J B;  3RK3 B;  1OVU A;  3BCC D;  4GIF A;  2KG9 A;  3W68 A;  3TK1 A;  1PZQ A;  4JPZ B;  1VL2 A;  3KYQ A;  1Y47 A;  2J59 M;  1KIL D;  2E5T A;  1GTW A;  5B5E E;  4IFF A;  4NPE A;  2FFD B;  3L72 J;  2W90 A;  1KB9 E;  1H88 A;  1IFJ A;  2WSE J;  3HD7 A;  1SQX E;  2K0D X;  3AE5 C;  1X3O A;  5AW4 B;  2Y0E A;  3AE1 C;  1QGK B;  3AEA C;  2QJP B;  3M0A A;  2H88 C;  2KNC B;  2MVV A;  3CME P;  3IFM A;  3L71 J;  3CXH E;  5AW3 B;  4L76 A;  1HJ0 A;  3VMX A;  2M8N A;  1JY3 N;  3BCC J;  4IL6 E;  2KSJ A;  3H1J G;  3CWB G;  4WY4 B;  1NTZ D;  1PL5 A;  2O1J A;  5KAF H;  3DS3 A;  2H7H A;  4JF7 A;  3DS5 A;  2E76 C;  2N1T B;  1LT9 B;  3H1I E;  2KGE A;  3R2P A;  2QG4 A;  1SVF A;  1DH3 A;  1LWU B;  1L4A A;  2LTE A;  4EI2 A;  2KI7 B;  2WPR A;  4W80 A;  3S4R A;  4ASV A;  2KP8 A;  3H32 A;  2OQQ A;  1HVV A;  1HBW A;  4N78 E;  3CX5 H;  5APY A;  3Q2Y A;  1RE4 A;  2M5A A;  3G21 A;  2HLO A;  1SQX G;  1YIT P;  2N98 A;  2DNW A;  4DT0 A;  3TGU D;  3HD7 C;  2O1K A;  1GL2 A;  1FZG A;  1NTZ K;  2KOO A;  3B8E B;  1NTK D;  1NTZ J;  1FZC B;  2XV5 A;  3S1K A;  1HGZ A;  2MR7 A;  3H0D A;  3PH0 A;  4Y28 J;  3AE9 C;  1XTG B;  2IX7 C;  3M9Q A;  4JBZ A;  4QMA A;  1PFI A;  1VHN A;  2H89 C;  3WUU A;  3H1I G;  1D7M A;  2YO3 A;  2P10 A;  2L91 A;  1EZV D;  1G2C B;  2A06 E;  2RMZ A;  1SFC D;  2OYH A;  2RKL A;  2CGQ A;  1N86 A;  1M1J B;  3HZQ A;  1SQB E;  4L75 A;  2BCC D;  1VQ4 P;  1K8A Q;  4H0L C;  3FX0 A;  3WUT A;  2KXP B;  4IPY A;  4PJ0 H;  1K04 A;  3NMD A;  1NH4 A;  1M90 Q;  1KMI Z;  4TT3 H;  1RE4 C;  1GMJ A;  3RL0 C;  2K9J A;  1S4X A;  4PH0 A;  3FGA D;  5AW1 B;  2Y9Z A;  2P9X A;  4HJG H;  1UJZ A;  1AVO A;  3WU2 E;  4PV1 D;  1KIL E;  3MIW A;  3SFD C;  5M1B A;  3H25 A;  1URQ C;  1DV5 A;  1H0T B;  1EXJ A;  3BRT B;  4D6T D;  1QLE D;  4U0A A;  1RF0 A;  2E75 C;  1G1J A;  2ZXE B;  1LTA C;  2R5B A;  4UB6 E;  2SPZ A;  1JCD A;  5AW9 B;  1HWT C;  2FFD A;  1FU1 A;  3F89 A;  1Q82 Q;  2KZI A;  3Q1M A;  1KOR A;  3H1H E;  2HFE D;  1J1D C;  5C39 A;  2BCC J;  1ZMB A;  2E5Y A;  3II6 A;  2LL8 A;  1T2K C;  3GHG B;  1BGY J;  1EXI A;  5KKZ C;  4YPC A;  2Z5H A;  1PEO A;  1EDK A;  3Q5S A;  2KNC A;  2MF4 A;  5KLV E;  2N5H A;  1KFN A;  1T6A A;  2XND H;  3I55 P;  1A43 A;  1YJN P;  3AE4 C;  3KPE A;  3KZI H;  4WY4 A;  3OA7 A;  1K73 Q;  2DW3 A;  2FAC A;  3VMZ A;  3BCC G;  1HF9 A;  2P2U A;  4XFX A;  1KV4 A;  4Y99 B;  1LTJ B;  5KJ7 A;  5CBN A;  3L73 J;  2N6Y A;  2N1T A;  2M8L A;  3B5I A;  2ERH A;  1LT9 A;  1LJ2 A;  1LWU A;  2PGD A;  4XFJ A;  3P8M C;  1NU1 K;  1Y9B A;  4WYM A;  1OMI A;  1SS1 A;  3KQG A;  2AXT E;  1PGO A;  1NU1 J;  1HTL C;  3V2Q A;  2R44 A;  1LGH B;  4U7J A;  1LTG C;  1GXG A;  3HRN A;  3RK2 D;  3EJB A;  4HKG A;  4NPD A;  3TGU E;  1U7J A;  1EQ7 A;  1SQV D;  4JYB A;  1NTK E;  2M3E A;  1L4A D;  1S1C X;  5GTH H;  1L2P A;  2YIU C;  5AVY B;  2CPS A;  5L8R J;  2LML A;  1NTZ G;  3AEC C;  4RKU J;  3CPW O;  2FQ1 A;  1JO5 A;  1NQ4 A;  4WBA A;  1IUQ A;  1JY2 P;  2KOD A;  1K9M Q;  1EZV I;  4ZKP A;  1HUC A;  1GL2 D;  5KAI E;  1S72 P;  4U0E A;  1MV8 A;  3A0H H;  3CCM P;  2YKQ A;  2JGP A;  3P32 A;  5APS A;  1M7L A;  4PWV B;  1SQV K;  2ZYG A;  2ZYA A;  1VF5 C;  1KZU B;  1NHL A;  1SQV J;  1IFD A;  2E74 B;  5AVS B;  3JC2 2;  3CLQ A;  2V7Q H;  4B86 A;  2YKO A;  3L70 D;  3RG6 C;  4H13 C;  5AW8 B;  1NTK G;  1VQP P;  2JYL A;  1WMK A;  3MD0 A;  2KS1 A;  1NOH A;  2W6B A;  4UB8 E;  2UWJ E;  1IFP A;  4D6T E;  1H0T A;  4BPF A;  2I8D A;  3SWY A;  1DEE G;  4BPH A;  4DOJ A;  2Q5U A;  2N9Y B;  2GZI A;  3TNU B;  1EZV G;  2JWA A;  1VQ5 P;  3RK3 D;  2K88 A;  4PD4 D;  4XRQ A;  1OW6 A;  1YQ3 C;  1P84 D;  1AUM A;  3TYY A;  2BCC G;  1CW5 A;  3VMY A;  1BGY G;  2IYP A;  1G1I A;  2NPS D;  3L70 J;  1IO4 A;  3U59 A;  1YYC A;  1MKM A;  2E76 B;  1BCC E;  3CWB D;  3G71 P;  4AYC A;  5TIS E;  5DJT B;  2Z45 A;  1OWA A;  2E43 A;  3M0D C;  2GZF A;  5APW A;  2XZ1 C;  4WB4 A;  2JDI H;  1GK6 A;  4D6T G;  1Y8A A;  5HGL A;  3P8C D;  2WIT A;  3JCU E;  1JMB A;  5JPA A;  1N7S C;  4K35 A;  3CCR P;  2VSQ A;  2W27 A;  4WY4 D;  1KC8 Q;  2LIW A;  2AF8 A;  5AVR B;  3L75 E;  5I4T G;  2Q7C A;  5KJ7 D;  1IC2 A;  3HD7 B;  1Q81 Q;  1NAF A;  3L74 J;  2N1T D;  1M74 A;  1FZE A;  1SQP D;  2LOL A;  3V4Q A;  2QVA A;  2JBG A;  1R5L A;  2Z5I A;  5B66 E;  4PXH B;  1JUN A;  1KQS O;  3CX5 I;  4TLF A;  2B87 B;  4OGQ C;  1PPJ D;  3V2R A;  1UII A;  2LKM A;  1FS0 E;  4L74 A;  1USD A;  2ZT9 C;  3GW6 A;  3VRL C;  4GOE A;  3CCE P;  3EWK A;  2BEZ F;  2C9N Y;  2OAR A;  1MZ9 A;  2PEI A;  4IFD K;  1DNY A;  1QRJ A;  4H0L B;  2K5X A;  2K37 A;  2FYN C;  3RL0 B;  3H1K J;  1SQV G;  1NTM D;  1AA0 A;  4M0I A;  3GZL A;  2QIW A;  5APU A;  3RL0 g;  2YNY A;  1JNM A;  2WQY C;  1URQ B;  4EYY Q;  4CPG A;  1M1K Q;  1NAY A;  1KTM A;  4LGD E;  4AQR D;  2P58 A;  3KXD A;  4H2X C;  1AFO A;  3SFE C;  4EOT A;  2OTJ P;  1J1D B;  3RK3 E;  2FXP A;  4PD4 E;  3TNU A;  2FYZ A;  3DPH A;  5KKZ B;  1P84 I;  2EHT A;  3R4Y A;  1P84 E;  3L72 D;  1ZV8 A;  2YO2 A;  2HYN A;  1IK9 A;  4I1L A;  1NTM K;  2Y0C A;  4I6M C;  4W7Z A;  3PHL A;  1NTM J;  4YXD C;  2NZ2 A;  4H2Y C;  4U0C A;  2KGA A;  3O8Z A;  2JP3 A;  1DD4 A;  1FC2 C;  1BXI A;  2L5G B;  3H1J E;  2KG8 A;  3CWB E;  3L70 G;  3L71 D;  1JCC A;  2IYO A;  2WTY A;  3V5B A;  2V7Q J;  3ABV C;  4GOD A;  1EDJ A;  3F5H A;  4XFZ A;  2IPP A;  1KD1 Q;  3P8C E;  2XU6 A;  4Z1M H;  4XA4 A;  2GYK A;  1L0N K;  2XKM A;  3HUS C;  1L0N J;  5AVW B;  2P7J A;  5AW0 B;  1SQP E;  1JEK A;  5F2O A;  2YIU B;  3L74 G;  1N73 C;  3A0B H;  1PPJ E;  3NFQ A;  2B87 A;  4O9B A;  1WRG A;  4BRY B;  1W2E A;  2PEO A;  3A7O A;  2IBZ I;  1SQB J;  3VOP A;  4GOF A;  2L9F A;  3RBZ A;  3V4W A;  3GZM A;  4U0F A;  5BS2 A;  1L0I A;  1QL2 A;  1GZL A;  3G29 A;  1GU5 A;  2PP6 A;  1W5C E;  2JU2 A;  3H1L J;  4MN4 C;  1VF5 B;  3DS4 A;  2KGC A;  3BAS A;  1ACP A;  2KR5 A;  3GKL C;  3P05 A;  2IFN A;  3CCU P;  3GLM A;  1KFM A;  2XNX A;  4H13 B;  3GG2 A;  4W7Y A;  1SQP G;  1A02 F;  1F80 D;  3CXC O;  2LXC B;  1QX8 A;  4BPG A;  4R0M A;  1PPJ G;  5H2F H;  1A02 J;  1BSH A;  1BE3 D;  1URQ A;  2KLU A;  2Z4E A;  3L35 A;  2H43 A;  1PEM A;  4I7Z C;  2FAD A;  3OAK A;  2JR8 A;  2E74 D;  2QSI A;  2EG5 A;  2P67 A;  5BU5 A;  2POH A;  3C1L A;  4H44 C;  3H6P A;  2QRX A;  2KGD A;  2FY8 A;  3L72 E;  1GPJ A;  2KYV A;  1LT1 A;  3VMA A;  2LPK A;  3PJS K;  3CCQ P;  4WVZ A;  1VQO P;  1FZA A;  1OVR A;  3PLN A;  3AE8 C;  1BGY D;  1Z56 A;  2LIU A;  1NTM G;  4XFY A;  1NVO A;  4AUW A;  5EJD A;  1FJP A;  2K0X A;  1BE3 J;  3BCC E;  2JB0 A;  3MGN A;  1BAJ A;  2KS1 B;  2HPC A;  2M3B A;  3L73 D;  1N7S B;  4EIJ A;  7CEI A;  1KYO H;  5CCH C;  2WPS A;  3MZW B;  1S5L E;  3VTP C;  1VQM P;  2GA1 A;  2E76 D;  1USE A;  1NU1 D;  1X8Y A;  2J58 A;  2ZFC A;  5BVZ A;  3L72 G;  1ZR2 A;  2QM8 A;  5BU8 B;  2MKV A;  1M8O B;  1NWQ A;  1SP4 A;  2ROQ A;  2QJK C;  3D6Z A;  2GUS A;  4OGQ B;  3G1G A;  3D71 A;  4DZO A;  3JSV C;  3NTE A;  4HKZ H;  4YTP C;  5GTI H;  2ZT9 B;  1MFT A;  4BRY A;  1NTZ E;  3L71 G;  5CBO A;  3WBH A;  3G6E P;  3HD7 D;  2ZAE B;  5KP6 B;  3VP9 A;  3B5N C;  4IOI H;  4HH2 A;  1KIL B;  4GR6 A;  4A7P A;  2FKW B;  5HVC A;  3G3Z A;  2HG5 D;  2Q9I A;  2ONT A;  1IMQ A;  2FYN B;  2M8R A;  4GKG A;  1RQU A;  3CCL P;  1MFZ A;  5B5E H;  3G26 A;  5AVZ B;  1YIJ P;  4QKO A;  1KB9 H;  1OW7 A;  1HGV A;  2KLV A;  2ZYD A;  1FDI A;  5E79 E;  1UNK A;  1Q90 D;  1VPC A;  1RQV A;  3K5B A;  1GW3 A;  3M91 A;  4OH8 B;  1VQL P;  3CX5 D;  1YBK A;  3AEG C;  4H0L D;  3CXH H;  2WPQ A;  1M6N A;  2QEX P;  2GDW A;  2CNR A;  4IL6 H;  4OVN F;  4L73 A;  4NPF X;  1T8Z A;  4I2L C;  3RL0 D;  3P7K A;  1PGQ A;  1J1E C;  2NO8 A;  1S9K D;  1EZV E;  2AXC A;  2XXM A;  1H8A A;  1BCC J;  1RO2 A;  1URQ D;  1SQQ D;  2BHV A;  4K3A A;  2CK3 H;  2Q1K A;  2W6A A;  3CL3 D;  1X9V A;  2BCC E;  2E75 D;  3S9O A;  1BGY E;  3SWF A;  2YKP A;  5AW7 B;  2MR8 A;  4C46 A;  1RY3 A;  1OZH A;  5DJU B;  3Q3D A;  4N3Y B;  3G9R A;  1BDD A;  2QA4 P;  3M0D A;  1T2K D;  2FYU K;  1HH0 A;  1BE3 G;  1T3J A;  3MHV A;  5AVQ B;  2FYU J;  1VQN P;  4U3F J;  2XT1 A;  2G8Y A;  5HGO A;  2CPB A;  1LNQ A;  3L73 E;  2OYI C;  1DX7 A;  1N7S A;  3HUS B;  1RF1 C;  5BS1 A;  3AED C;  1SQQ K;  5HGN A;  1NU1 E;  1SQQ J;  2BQ1 E;  1PV3 A;  2PEN A;  3E1R A;  2K94 A;  1FBM A;  2D2C C;  2EFJ A;  1N73 B;  3CMA P;  3G4S P;  2R3S A;  2KOG A;  1DD3 A;  1KYO D;  3VYI A;  1Q86 Q;  3L74 D;  1CSB A;  4M3L A;  2J5U A;  5CCG C;  3CD6 P;  3CCV P;  1L0L K;  1BSN A;  2BAS A;  3A2A A;  2C9L Y;  1LP1 A;  1X79 B;  2YXR B;  1L0L J;  5APT A;  3GF3 A;  2HOD B;  2EHS A;  3DS1 A;  4YXW H;  1PGP A;  1KIL A;  2W83 C;  3SWK A;  3L73 G;  1PP9 J;  1ZR4 A;  3O6Q B;  2FVF A;  3WU2 H;  1U7M A;  5KAF E;  4C7R A;  3B4Q A;  3RBX A;  3MUD C;  2V4H A;  1OVV A;  3CC7 P;  1NU1 G;  4UB6 H;  2N9B A;  1GU4 A;  3EJD A;  3TF5 A;  3UIA A;  1JMM A;  2P1J A;  1SQV E;  3T97 A;  1ZXG A;  1EOQ A;  1HQB A;  2XZR A;  3CC4 P;  2MJZ A;  2AVA A;  3H1K D;  1ZP0 C;  2LF4 A;  4I7Z B;  1JY3 P;  3CX5 E;  1VF5 D;  2Y0D A;  2Z44 A;  3VN0 A;  1KB9 D;  2JAZ A;  3HTK B;  3M1M A;  1CI6 B;  1X22 A;  2IBZ D;  4H44 B;  4COP A;  1T3U A;  2QJY C;  4H13 D;  2A45 H;  5CJ4 A;  1IZN B;  4COC A;  1NJI Q;  1S3J A;  3H1J J;  2PRR A;  2PFX A;  1JB0 J;  3M9B A;  1KIL C;  2JYG A;  2R32 A;  4BXL A;  3U1A A;  4PH1 A;  1VKU A;  2CG5 B;  3HE4 B;  2ZJS E;  2AXT H;  3E2D A;  2JWD A;  1PEU A;  2YMK A;  1DIP A;  1AQ5 A;  1QVG O;  2Q3E A;  2K92 A;  1M6E X;  1VDF A;  1KQL A;  2RN0 A;  2K0Y A;  1JY2 N;  4MRT C;  3DTJ A;  2B9B A;  1ZME C;  2QM7 A;  2GZJ A;  3L70 E;  1EC5 A;  2KIK A;  2WSF H;  1SQX K;  2LKI A;  3Q20 A;  1SQX J;  3CE7 A;  2O01 N;  4PJ0 E;  1Q7Y Q;  2AEM A;  4N78 D;  2Y9Y A;  4UHP B;  3HUS A;  5AVV B;  3TDK A;  1E79 H;  2E42 A;  2WPT A;  1GW4 A;  1D1D A;  3BRV B;  4RO0 A;  1E0H A;  5APQ A;  2KSE A;  2QJK B;  1PIX A;  1SQQ G;  1N73 A;  3E1I A;  1KYO I;  5KAI H;  1ZN5 A;  1L0N D;  2ZXX A;  3G1I A;  3GF7 A;  2NRG A;  3L74 E;  1N7S D;  3H1I J;  3A3Y B;  1NGM B;  1LTT C;  1AVY A;  2QNW A;  4IZ6 A;  1XTC C;  3IR9 A;  3B5N B;  4IL6 X;  4CA3 A;  2HOD A;  2DGY A;  3U43 A;  2MY5 A;  3MGE A;  2G3A A;  1FZF A;  3FXE A;  2I1J A;  2KOP A;  1ZLL A;  1SQB D;  1E5W A;  2M8P A;  2ZVO B;  4OGQ D;  2HPC B;  1FZB A;  1N2D C;  3ITK A;  3KZI E;  1GXH A;  3O6Q A;  4UB8 H;  1L0H A;  1PP9 G;  2ZT9 D;  2WSC H;  3EFF K;  3H1L D;  3WMM 0;  3FWN A;  3A5T A;  4DJG A;  1AYI A;  2FBW C;  1SFC C;  2M0B A;  3H1K E;  2OGU A;  4OWF A;  2NPS B;  2R5D A;  2JJL A;  2FAE A;  4QNB A;  4R4L A;  3AE3 C;  1RNI A;  1H89 A;  2XZ0 D;  3I56 P;  1KB9 I;  2L4B A;  2YXQ B;  1SQB K;  2VLN A;  2IBZ E;  3H1H D;  1J1E B;  3HTK A;  3N7N A;  1CI6 A;  3FWL A;  2N50 A;  5GTH E;  5TIS H;  2RH0 A;  2N5I A;  3CXH I;  5KLV D;  4PV1 C;  3BVH A;  3V6I A;  3HE4 A;  2JEE A;  3H47 A;  3DS0 A;  3JCU H;  2Q6Q A;  4U0B A;  2AEF A;  3AEF C;  1NTM E;  2WWW A;  4LLH A;  1AQT A;  3A0H E;  1IMP A;  1YTZ I;  3H1K G;  4XRO A;  2OYI B;  1Q2N A;  3G28 A;  2KOS A;  5B66 H;  1N8R Q;  3H1H J;  3RGU A;  1FOS E;  5F2K A;  3W67 A;  1RF1 B;  5AW5 B;  1JJ2 O;  5CCH A;  4WWI A;  2FHS C;  2WZ7 A;  2IBZ G;  5KLV K;  1OFC X;  3G0V A;  5KLV J;  3CCS P;  1OX3 A;  4R4M A;  3HE5 B;  2D2C B;  1S5L X;  2PEQ A;  5HGM A;  3DS2 A;  1L0N E;  2L0Q A;  2KK7 A;  5CZD B;  4H2W C;  5F2N A;  4JQ0 D;  1A8O A;  4NEO A;  2W8Z A;  3GMA A;  2I1K A;  3RK2 C;  1M57 D;  1OW8 A;  1EDI A;  3L71 E;  5KLI C;  3HYB A;  2FVA A;  3B5N A;  3AEB C;  2VLP A;  1X0T A;  2Q3I A;  3H4E A;  1BDC A;  1L4A C;  5TJH A;  2HR3 A;  2EIA A;  1FE6 A;  3C8V A;  3TGU J;  1NKN A;  1NTK K;  3LW5 H;  3C9I A;  1VQK P;  2C0W A;  1NTK J;  1OXZ A;  2WSF J;  3IAO A;  3M9H A;  2E1M A;  2W6J H;  1RO0 A;  3H1L E;  4XE5 B;  2XDJ A;  1GL2 C;  1QL1 A;  4PD4 H;  1L0N G;  2QE7 H;  5EW5 E;  1WT6 A;  1P84 H;  2JO0 A;  2AFD A;  2NPS A;  3GJN A;  4BWN A;  1N7L A;  2JO1 A;  2O01 H;  3CC2 P;  2BEQ D;  3E7K A;  1YJW P;  2Z46 A;  1LP1 B;  2QJY B;  1EDL A;  2A06 G;  3SSU A;  3AEE C;  1SQB G;  2OYH C;  4ZMD A;  3VP8 A;  2WSS H;  3KHU A;  1FJK A;  2AEJ A;  3PTZ A;  3NTN A;  2A45 I;  3AE6 C;  3B71 A;  1BCC D;  3Q5R A;  3H1L G;  4LC1 A;  4U0D A;  2X2B A;  4H44 D;  3RK3 C;  5CJ0 A;  2ZVN B;  4D6T J;  1M56 D;  1K30 A;  2WSC J;  2YMY A;  3T97 B;  2K9Y A;  1YI2 P;  2JKV A;  1ZRT D;  2VRS A;  2OTK E;  2OYI A;  1BE3 E;  2LXB A;  4F37 A;  1NO4 A;  1YJ9 P;  1RF0 C;  2NPS C;  3QWO C;  1K05 A;  1SLQ A;  1RF1 A;  4RES B;  3L75 D;  2PNG A;  3H1H G;  2FFD C;  2WPV B;  2FYU D;  3D6Y A;  3N4X A;  2LR2 A;  4U3F D;  1NYH A;  3LMO A;  5K5G B;  2VLQ A;  3HE5 A;  2FQ0 A;  5KLV G;  3AE2 C;  1FZC A;  2QJP C;  3LRY A;  3MP7 B;  1RHZ B;  2A45 G;  5CCG A;  5CCH D;  4ZNC A;  4WY4 C;  2IFM A;  2KOR A;  1JTH B;  2WT7 B;  3AE7 C;  1OIP A;  5KJ7 C;  2GDX A;  4GR2 A;  1G2C A;  2N1T C;  2XV6 A;  3PP5 A;  1LT9 C;  1VQ9 P;  2H8P D;  1LWU C;  5AVU B;  3V2N A;  3OJA B;  1M1J A;  2MD9 A;  3L75 J;  2WMM A;  1L0L D;  3M06 A;  2K2Q A;  1VQ6 P;  4KT0 J;  3MUD A;  3TGU G;  1R5S A;  1FDO A;  2IZ0 A;  1LTB C;  1JOC A;  1PP9 D;  3NXS A;  1W2B O;  2VLO A;  1IJD B;  4JYC A;  1KN7 A;  3B5N D;  1SFC B;  2KB7 P;  2GDY A;  2FXO A;  1FZC C;  1IK7 A;  2OYO A;  1NKZ B;  4ASW A;  2WSE H;  2FXM A;  4ZKU A;  3FXD A;  2CQ8 A;  3NY7 B;  3IN6 A;  5KP7 B;  1Z6M A;  2GUV A;  2L6E A;  1J2J B;  1PEQ A;  3LIE A;  1JY2 O;  3L4F A;  3GHG A;  5CHX A;  3A0B E;  4KJM A;  4PV1 B;  3KDP B;  3MTU E;  1GD2 E;  1M1J C;  3CCJ P;  3Q5P A;  1IFI A;  1S2E A;  2PEK A;  2O3J A;  4C7N B;  3H1J D;  3ZDM A;  1EIA A;  1LTJ A;  3LW5 J;  1S5L H;  2PY8 A;  3OW2 O;  2KZJ A;  1KQF B;  1FDM A;  5APX A;  5EFW B;  1YHQ P;  1KQG B;  2K3R A;  1ZRT E;  1LTS C;  3USS A;  5KP8 B;  1YQ4 C;  4IFM A;  3EFG A;  2JU1 A;  1U57 A;  2FVE A;  2FYU E;  5AW6 B;  2KUB A;  4U3F E;  2O01 J;  1SQX D;  2KOQ A;  1HY8 A;  5H2F E;  1S9K E;  5DCK A;  5HV8 A;  3RG2 A;  2L22 A;  1YTZ T;  3GHG C;  1VQ7 P;  1IFN A;  3EJE A;  1LTI C;  2R3C A;  3CWB J;  4DCK A;  4GT1 A;  1SQQ E;  3CXH D;  4GDO A;  1FAV A;  1QVF O;  2ITA A;  4HYT B;  2JQ4 A;  1BCC G;  5AVX B;  1QEX A;  3IF4 A;  1MUU A;  1T8K A;  3RK2 B;  2IDB A;  1PGJ A;  2B89 A;  3TSI A;  2BUO A;  5KLI B;  1R8E A;  3BAT A;  3I5C A;  1JTH A;  4Y99 C;  1LTJ C;  3CI9 A;  2WT7 A;  2AFE A;  2PEM A;  3L37 A;  2B88 A;  2PEJ A;  2D2C D;  3H1I D;  2KG6 A;  2M5R A;  1L4A B;  3QH9 A;  1UIX A;  2KW2 A;  2KWL A;  1KLP A;  1RE3 A;  2GZG A;  1L0L E;  3H32 B;  2GM4 A;  5AVT B;  2FQ2 A;  1EMV A;  5E79 H;  4HB1 A;  5KTB A;  1SQP K;  1ZNV A;  1OR5 A;  4N6J A;  1SQP J;  3L75 G;  5CCG D;  4DG9 A;  2FYU G;  2C0X A;  2M5A B;  3WUV A;  4EDF A;  1CEI A;  4U3F G;  2N6Z A;  1PP9 E;  3U1C A;  2MVU A;  2K93 A;  5AW2 B;  1GL2 B;  1ZW0 A;  3L36 A;  1RH5 B;  3LID A;  1SFC A;  3PRJ A;  5CMZ A;  2OTL P;  1GK4 A;  3V2P A;  4KHX A;  1MZ8 A;  2E75 B;  3EQ2 A;  3D70 A;  3B4S A;  1KYO E;  2GZE A;  1JY3 O;  2WVR A;  1DEB A;  4PD4 I;  2K1A A;  2IZ1 A;  1FR2 A;  1JM0 A;  1E6J P;  2OYH B;  2A06 D;  2CWO A;  1CZQ A;  1L0L G;  1IFM A;  2PAJ A;  1GDT A; 
#chains in the Genus database with same CATH homology
 5F2N A;  3DTJ A;  5HGL A;  1W2B O;  3CCV P;  1S72 P;  4U0E A;  4U0F A;  5BS2 A;  1VQL P;  1VQ7 P;  3G21 A;  2OTJ P;  1ZMB A;  3CCM P;  1BAJ A;  5JPA A;  4U0D A;  1YIT P;  3G29 A;  3CCR P;  1M6N A;  2QEX P;  4QNB A;  1A8O A;  1RNI A;  3DS1 A;  1KC8 Q;  1PEO A;  1QVF O;  5I4T G;  3DPH A;  1K30 A;  1VQ8 P;  3I56 P;  3Q20 A;  3DS4 A;  1Q81 Q;  3I55 P;  1YI2 P;  1A43 A;  3HYB A;  1M74 A;  1Q7Y Q;  2BUO A;  1VQM P;  2XXM A;  3H0D A;  1YJN P;  1K73 Q;  3H4E A;  3RG6 C;  2PEM A;  1KQS O;  2PEJ A;  3P05 A;  4XFX A;  4U0C A;  1RO2 A;  2EIA A;  1VQP P;  1YJ9 P;  2JYL A;  3CCU P;  2BHV A;  2L6E A;  3CC7 P;  1D1D A;  1PEQ A;  2M8L A;  3B5I A;  3G1G A;  1VQK P;  3CXC O;  2E1M A;  3NTE A;  4WYM A;  1RO0 A;  3VRL C;  3G1I A;  1EOQ A;  1PEM A;  3CCE P;  3H47 A;  3DS0 A;  4XFZ A;  3CC4 P;  4U0B A;  3CCJ P;  2QA4 P;  3HZQ A;  2LF4 A;  2PEK A;  3LRY A;  2OAR A;  2PEI A;  1KD1 Q;  3WBH A;  1VQ4 P;  1VQ5 P;  1EIA A;  1K8A Q;  3G6E P;  4XRQ A;  1VQN P;  2EG5 A;  3CME P;  2XT1 A;  2Z44 A;  2JO0 A;  5HGO A;  4IPY A;  4GR6 A;  2M8N A;  1QRJ A;  4XRO A;  2OTL P;  1AUM A;  2PY8 A;  2DGY A;  3OW2 O;  1M90 Q;  3MGE A;  3M1M A;  3G28 A;  3CC2 P;  4COP A;  5BS1 A;  1N8R Q;  3DS3 A;  4PH0 A;  4GR2 A;  5F2K A;  1YHQ P;  2ONT A;  1YJW P;  2Z46 A;  5F2O A;  2XV6 A;  5HGN A;  2M8P A;  1JJ2 O;  1VQ9 P;  3DS5 A;  3CCL P;  2P9X A;  4M0I A;  4COC A;  1NJI Q;  2PEN A;  2BQ1 E;  3CCQ P;  3G26 A;  3CPW O;  1VQO P;  3G71 P;  2EFJ A;  2JYG A;  3G0V A;  3CMA P;  3CCS P;  3G4S P;  2Z45 A;  1YIJ P;  4PH1 A;  4XFY A;  1E6J P;  4U0A A;  1IUQ A;  1VQ6 P;  3E2D A;  2PEO A;  1M1K Q;  1PEU A;  2KOD A;  1K9M Q;  1Q86 Q;  2CWO A;  1QVG O;  2PEQ A;  5HGM A;  3DS2 A;  1M6E X;  1Q82 Q;  5DCK A;  3CD6 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...