1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
1Q7YQ 1YHQP 1VQ6P 1KQSO 3CCSP 1YI2P 1VQKP 1M1KQ 3G71P 3I55P 3OW2O 1YIJP 1QVFO 1K9MQ 2OTJP 2QA4P 3G4SP 1VQ8P 1YJNP 1VQ9P 3CC7P 3CD6P 3CC4P 3CPWO 2QEXP 3CCRP 1KC8Q 1VQ4P 3CMEP 3I56P 1YJ9P 1N8RQ 1VQMP 1S72P 3CC2P 3CCEP 3CCLP 1VQOP 1YITP 1VQNP 3CCUP 1Q81Q 1Q86Q 1VQPP 1Q82Q 1JJ2O 1W2BO 1VQ7P 1QVGO 2OTLP 1VQ5P 1NJIQ 1K8AQ 3CCJP 3CCMP 3CCQP 1YJWP 3CMAP 1K73Q 3G6EP 1KD1Q 1VQLP 3CCVP 3CXCO 1M90Q
chains in the Genus database with same CATH superfamily
1CI6B 2QJKB 1NKZB 2AEFA 2MR7A 3FWNA 3L75G 4YXDC 3VTPC 2E5YA 3K5BA 2FFDC 4PD4E 2VSQA 1RE3A 2AFDA 1IFPA 3USSA 2XV6A 1D1DA 5CBOA 1R8EA 2N5IA 1PP9D 4OH8B 4XFXA 4JYBA 1AQ5A 1H89A 4GOEA 1GL2B 1QGKB 2KYVA 1EXIA 1RQVA 3T97B 4C7NB 1EZVD 2Z4EA 4N78D 3V4WA 1A02J 5E79E 4WVZA 2M3EA 1XTCC 1GU4A 3TGUJ 3AEBC 2JDIH 3KYQA 1E5WA 5BU5A 2BEZF 3GHGC 1BGYE 2N9BA 2K9YA 2G3AA 2K5XA 2EIAA 2YIUC 3V2NA 2GM4A 2ZFCA 5AVQB 2GZGA 2EFJA 3RK2C 2FQ1A 3DS2A 3H1HE 4PV1B 5DJTB 3CXHI 2LKMA 1VHNA 4U0AA 3GF7A 2LOLA 1SQVE 1G1IA 2A06E 4I1LA 1FDIA 2KSJA 3WU2E 4GR6A 2Y0EA 1XTGB 2NO8A 5APSA 2FXMA 3CPWO 4PV1D 2PEOA 1S72P 4H0LC 3BASA 1OZHA 3WUUA 3MIWA 1H8AA 3P8CD 2PY8A 2GDWA 1MFZA 1HUCA 4NPDA 3AE7C 2Q3EA 3R4YA 2B9BA 3CMAP 4DJGA 2VLQA 3A7OA 1WMKA 2WMMA 4W7YA 3EFFK 1LWUB 1MZ8A 2FBWC 2VLPA 2K1AA 3HUSC 3AE5C 2K9JB 1L2PA 2KG6A 1JUNA 4EDFA 5F2KA 1HH0A 3DS3A 3L75D 2FHSC 2L9FA 1PEUA 1VF5B 3F89A 1SFCA 1X9VA 5F2NA 1ZNVA 2FXPA 2QJYB 1H88A 2GZEA 2GA1A 3JCUH 1KILA 4PWVB 2KOOA 2JWDA 2OYIB 4KJMA 1Z56A 1NTZD 4TLFA 2KNCB 2N1TC 2WZ7A 1VF5D 1PPJG 4L76A 2M5AA 5KP6B 2QVAA 4PH1A 3W68A 3TYYA 2QE7H 4UB8E 4OVNF 3KHUA 4U0CA 3PLNA 4PV1C 3WBHA 5KJ7C 3AEFC 3L71D 3GLMA 2ZXEB 1X79B 1JCDA 2FKWB 5GTIE 3Q5SA 1FS0E 3BVHA 2FYUG 4ZKPA 3V2PA 4JBZA 1U7JA 3L73G 4ASWA 1X3OA 1L0IA 1MFTA 1YQ3C 2ZVNB 1BE3J 2JQ4A 2AXTE 5CMZA 5HVCA 1SQBE 1HTLC 2H43A 4Y99B 2EHSA 1RE4C 2N6YA 2R32A 2DW3A 7CEIA 1U57A 3FX0A 3MD0A 4PXHB 5KLVE 3B71A 3L72E 1UJZA 4U3FG 3CCQP 2L91A 3AEDC 1EIAA 1VQLP 1OMIA 1H0TB 3EWKA 3Q1MA 2O01J 1S5LX 3M0AA 3M0DA 3CXHH 2O1KA 3H47A 1BGYJ 2WTYA 1DEEG 3HD7B 1W5CE 2KOSA 3WUVA 1X22A 2Q5UA 2JB0A 1OIPA 4C46A 2P58A 3H1HJ 2YO2A 1KYOI 5GTHH 1ZR2A 1MUUA 1SQVJ 3H0DA 1N2DC 3FWLA 1EC5A 1X8YA 4I7ZB 1RH5B 3B4QA 3G0VA 1GW3A 4RKUJ 1KYOE 3CCEP 1IJDB 1KQGB 4DZOA 1KB9D 1Q86Q 1NTMD 5TISH 5CJ0A 3D70A 3VMZA 1GPJA 2GUVA 3CI9A 2P1JA 2E75C 1GK6A 2FFDA 3MGEA 1VQ9P 3P7KA 5HGLA 2Z44A 2KP8A 2ZYGA 3BCCE 1BXIA 2AF8A 2YXQB 1LTJC 1AVOA 2K2QA 3U59A 3FXDA 3TK1A 1ZOYC 1SFCB 1FZAA 3PTZA 4UB6E 1KILB 5KLIC 5AW3B 1CZQA 4IOIH 5KKZC 4H2XC 1CEIA 5KP8B 4EYYQ 1SQPG 4K35A 1UIIA 1SFCD 4XFZA 4IL6H 2JKVA 2M5AB 1KILD 1KQSO 1OXZA 3L73D 4R4LA 3Q20A 1ZRTE 2P10A 1VQ8P 1USDA 1MV8A 5AW0B 1PGJA 2J59M 4YTPC 1J2JB 4RO0A 3VP8A 2IX7C 4B86A 3G1IA 2WPTA 5AVUB 1SQQE 5AW8B 2JEEA 4KHXA 3TGUG 3I55P 4U3FD 2KS1A 2RMZA 2VLOA 2V7QJ 2CGQA 2Y0CA 2ITAA 2JJLA 1NWQA 1P84D 4U0FA 2O3JA 2KG8A 1JY3O 4CA3A 1R5LA 1DEBA 1U7MA 3L70J 3G29A 1YI2P 1Z6MA 1M1KQ 1VKUA 3H1KJ 4WBAA 2YXRB 1YBKA 1BCCJ 3OJAB 2PAJA 3VMAA 3A5TA 1PEMA 1HY8A 3L72J 2E74B 4XFJA 1K04A 1YQ4C 2Q7CA 5APUA 5K5GB 1L0NK 1YTZT 2W6AA 2H8PD 3U1AA 2KSEA 3AE2C 4COCA 3CC7P 2E74D 1L0NJ 2Z45A 3IN6A 2Q1KA 2X2BA 1PP9G 2N1TA 3M9BA 4OWFA 1WT6A 2IBZE 4GKGA 2E76C 5AVRB 3CE7A 1JTHA 2BASA 1KTMA 1EZVG 1AQTA 2QIWA 2MF4A 1S4XA 1J1DC 1T8KA 5KJ7A 1S2EA 1P84H 2FXOA 2FFDB 1LTIC 4GIFA 1VQPP 1VQ7P 3H1LE 3HTKA 2Y9YA 2E5TA 3G4SP 1SQPD 1EDJA 4N3YB 4R0MA 2YKQA 1S3JA 1BDDA 2O1JA 2W8ZA 1GU5A 2OYOA 3CX5H 3BCCJ 3PH0A 2M8RA 1CW5A 1DV5A 3MTUE 2BCCJ 2P67A 2OYHA 3CCMP 1W2EA 2M0BA 3AEAC 1RF1C 1RE4A 1JOCA 3GHGB 5EJDA 1GZLA 2O01N 2PP6A 3CWBE 2YIUB 3TGUD 3SFEC 1AVYA 3L36A 5CJ4A 1N8RQ 1FZCA 1K30A 1QLED 3HZQA 1W2BO 1LTAC 4PJ0H 3RK2B 2ZAEB 1PV3A 2M8NA 1N86A 1OW7A 1AYIA 3G1GA 2PRRA 4HB1A 5CHXA 1EQ7A 3EFGA 1DD4A 1QVFO 1LJ2A 1SQQK 2H89C 2IBZD 3B5NC 2K88A 3RK2D 2E42A 3HRNA 4H0LB 3CCLP 2KS1B 2CPBA 4HKGA 1SQQJ 1VPCA 1AA0A 2OTKE 1OWAA 1GMJA 4JF7A 2ROQA 4JPZB 4H0LD 1BGYG 1LT9C 2VRSA 1S9KD 3RK3E 2L6EA 2PEQA 1OFCX 1NJIQ 1PGOA 3A2AA 3H1HG 3G6EP 1NTZG 1KORA 1BE3E 1SQVG 4HJGH 1NHLA 2A06G 1LTTC 3HUSB 2ZJSE 1FJKA 1ZMBA 3LMOA 1LTJA 1N7LA 5B66E 3PHLA 1ZN5A 2WSCJ 2KLVA 1LP1A 3RG2A 3L71G 1TU3F 5APVA 3TSIA 2N1TB 1J1EC 5AVWB 2I1JA 4YPCA 4XRQA 1JTHB 1FZBA 3TNUA 1ZMEC 3VRLC 1KLPA 3A0HH 2R3CA 1FU1A 2KLUA 2N1TD 3VOPA 2KORA 3U43A 3S4RA 2AVAA 2KR5A 2FACA 2YKOA 3HTKB 3LIEA 3VMYA 2GYKA 3H1JE 1SQXE 2KB7P 5KJ7D 2J58A 3CXHE 2QM7A 1M1JC 3H1LJ 4C7RA 1QEXA 1E79H 3RG6C 4PD4D 4LGDE 1IZNB 2W83C 3BRVB 2FYNC 5B5EH 1BE3D 1AF8A 3CC4P 2PEIA 3B5IA 5F2OA 2WVRA 4PH0A 2P9XA 4MN4C 2KZJA 1KFNA 1KN7A 1IK9A 3R2PA 1OVUA 3L4FA 1HGZA 1FZCB 2JWAA 2L22A 2BHVA 1JY2P 1DD3A 3CWBJ 3MUDC 1E0HA 1L4AD 1NTMG 2WSFH 1KMIZ 3G28A 2IFNA 2AEJA 1BGYD 5KAFE 1EDKA 3CXCO 2PEKA 1LT1A 1KFMA 2LMLA 4KT0J 4BPGA 3H1HD 1SQBG 2XDJA 3BATA 2B87A 2IZ1A 3CL3D 2JO0A 1FBMA 1JY3P 1YJ9P 2XNDH 1SQVD 1ZR4A 1M8OB 2A06D 2OGUA 5KLVG 3OAKA 1HQBA 5AVYB 4WYMA 1NTKE 2I1KA 2E1MA 3L72G 1QL1A 1ZW0A 3CCVP 4U0DA 4EI2A 2W27A 2E75B 2EHTA 3G26A 1AFOA 2YMYA 4QKOA 2YKPA 2KGDA 3G21A 1FOSF 2HYNA 2A45H 3RL0g 3RK3C 3V2RA 5H2FH 1GTWA 1FE6A 1NU1E 3L37A 2B89A 1X0TA 2E75D 5AVTB 2YNYA 2LL8A 2Y0DA 5DJUB 1EDIA 1LTJB 2J5UA 1M90Q 5E79H 3H1IE 3AEGC 2C0WA 3L70E 2WT7A 1K9MQ 1LP1B 3H1KE 2GZFA 2FQ2A 2OYHC 1RF1A 1BCCE 5KLIB 1PGPA 1M57D 5KKZB 3P32A 1PFIA 1IMPA 4JQ0D 3V2QA 1L4AC 4O9BA 2CPSA 1N73A 1IC2A 1FZGA 3KQGA 4ZKUA 2XU6A 1FZCC 3OW2O 1GXHA 3RL0C 2N9YB 3TNUB 2XZ0D 1FDOA 1LTBC 1L0NE 2K37A 2R3SA 4LC1A 3BCCG 4YXWH 2HODA 4GODA 3WU2H 2OARA 1DNYA 3L74E 2WQYC 1FAVA 3B5NA 1SQXK 2LIWA 2AXCA 3F5HA 3Q3DA 1WRGA 3L75J 1OVVA 3II6A 1AUMA 3ABVC 2IYPA 5CBNA 4BWNA 3H1JJ 1SQXJ 1NGMB 1HGVA 4HKZH 2FQ0A 4NEOA 3H4EA 2M8PA 3G9RA 2PNGA 1GD2E 4F37A 2FAEA 2GZJA 4ZNCA 5DCKA 1LT9A 1YTZI 1T2KC 4Z1MH 4NPEA 4NPFX 5KP7B 1P84I 1Y8AA 1Y47A 4IFDK 3H1KD 2QJPC 1PIXA 1SQBD 2BCCE 3SWKA 1BCCD 1FZFA 5BS1A 1OW6A 1G1JA 5APWA 4H44D 5KLVD 3E2DA 3L72D 4GR2A 3CX5I 3KZIH 2YO3A 1T6AA 2JGPA 2XKMA 2GZIA 4ZMDA 1VQ4P 2JO1A 3NY7B 2FY8A 2BEQD 1KZUB 1L0LE 2B87B 3U1CA 1KQFB 3HE5A 1GXGA 4UB8H 2E76B 2KUBA 4DT0A 4QNBA 4DOJA 1NTKK 1KQLA 1J1DB 5HGMA 2MJZA 2UWJE 4CPGA 1KB9H 1VQOP 1JY2O 3CCUP 1NTKJ 1SLQA 2E76D 2LF4A 4EOTA 2KGEA 1NU1K 1KYOD 5BS2A 1URQC 4RJTA 1NQ4A 1M1JA 1T3JA 3VP9A 4XFYA 1YJNP 4PJ0E 1NU1J 3NTNA 1IFDA 2WT7B 3GJNA 3NMDA 1YITP 2OTLP 1VQ5P 2QNWA 2PGDA 2K92A 1NO4A 2Q3IA 5M1BA 1RF1B 3BCCD 3H1IJ 2LXCB 2JBGA 3H32A 2BCCD 3G71P 3IF4A 2IBZG 2MR8A 2ONTA 3UIAA 1N73B 4XA4A 4H44C 3Q2YA 1CI6A 3AE3C 3A0BE 3C1LA 1MZ9A 2ERHA 4H13C 2AEMA 3MUDA 4HH2A 1VQ6P 5EW5E 3PRJA 1JCCA 4M3LA 3TDKA 2N50A 2HODB 1OR5A 4D6TE 3E1RA 3DS5A 3B5NB 3KXDA 3GG2A 2KIKA 1ZRTD 1FDMA 3L74J 1BSHA 1USEA 1RF0C 1KV4A 4OGQC 2FYUK 1NAYA 3B5ND 5AVZB 2P2UA 1FZEA 1ZLLA 2WWWA 1SQQD 2LPKA 2Q9IA 4GDOA 5APYA 3CWBG 2KXPB 1LT9B 2FYUJ 2H7HA 2WSEH 2RN0A 1ACPA 1N7SD 3OA7A 1K73Q 4ASVA 2D2CC 1T3UA 3MP7B 1IK7A 4IZ6A 1PEQA 2IFMA 3A0HE 3DPHA 3CCRP 3GW6A 2LKIA 1DH3A 2FVFA 5AVVB 1ZP0C 3QH9A 3CCSP 4AQRD 2MY5A 2R5DA 2GUSA 1NYHA 2QSIA 1G2CA 3IAOA 2XZRA 1L4AA 2KOGA 1L0LK 1J1EB 1N73C 1EZVI 4H2WC 3RBXA 1IFNA 3EJDA 1PP9E 3I5CA 3HE5B 3S1KA 2QRXA 3HE4A 1RNIA 3KPEA 1L0LJ 5B5EE 5AW4B 1BE3G 2ZVOB 1EZVE 4N78E 4IPYA 4N6JA 2CK3H 1UIXA 1FC2C 1Q2NA 1JNMA 3E7KA 1M1JB 2K9JA 4XROA 1A43A 5AVXB 1T8ZA 2C9NY 2C9LY 1IO4A 2NPSC 2W6BA 2FYNB 1N7SC 4BPHA 3H1LD 5BU8B 1NKNA 1SS1A 5TJHA 2CNRA 4IFFA 3JCUE 2POHA 2W90A 3H32B 1FJPA 5AW5B 5CCGA 2K0XA 3N4XA 2MVUA 1EDLA 1IMQA 2Z5HA 2ZT9B 3MZWB 5CCHC 1SQPK 4WY4C 1JO5A 1JEKA 2A45I 1IFIA 2FVAA 2L5GB 3DS0A 1OVRA 3H1JG 1SQXG 1SQPJ 1JB0J 1ZV8A 3LW5H 3P8CE 2ZT9D 1HBWA 1RO0A 3CWBD 4RESB 3D6YA 1BSNA 5I4TG 5H2FE 1JMBA 1NVOA 1JMMA 4D6TJ 1CSBA 5AW6B 3S9OA 2Q6QA 1S5LH 1QL2A 1HJBA 1PGQA 2P7JA 1Q82Q 3H25A 1GL2D 3W67A 1YYCA 3WUTA 3D6ZA 5KAIH 3RGUA 3LW5J 2BQ1E 2MD9A 2IDBA 3GZLA 3L75E 2VLNA 3RK3B 1H0TA 4U0BA 1A8OA 3V4QA 1URQA 1VQNP 2WPSA 1NTZE 3HD7A 1KD1Q 2KK7A 1NAFA 3RK3D 4COPA 4L74A 2DNWA 1SP4A 2ZYAA 2OYHB 3IR9A 4DG9A 5GTHE 5KTBA 2Z46A 3ZDMA 1G2CB 3L71E 1L4AB 4XE5B 1NTKG 2OQQA 2QJKC 2ZT9C 3RL0B 2OTJP 3NTEA 3GZMA 3HE4B 1Q90D 3P8MC 5TISE 2QEXP 1HVVA 1NU1G 1VQMP 3QWOC 1PP9J 5HGNA 2JR8A 2KOPA 2KODA 1QVGO 2N98A 3RL0D 1RO2A 1RHZB 2Z5IA 3H1IG 3Q5PA 3L70G 2FADA 2GDXA 1RF0A 4AYCA 3H1KG 3A3YB 1GL2C 1OW8A 3MGNA 1BCCG 1JY2N 3B4SA 1MKMA 2GDYA 2QG4A 3MHVA 1JM0A 3NXSA 2KW2A 1SQXD 3H1JD 3AE1C 3KZIE 3L35A 2KWLA 2PEJA 2HFED 2KOQA 1M6EX 4PD4H 1OX3A 1EOQA 2WSFJ 3CXHD 2WPRA 1BAJA 1M7LA 2N6ZA 1LTGC 2HPCA 2W6JH 4WB4A 1K05A 5CZDB 3E1IA 3Q5RA 1S1CX 3CLQA 1KB9I 3WMM0 1L0NG 1JY3N 4IL6E 2QJPB 1T2KD 1AV1A 1M6NA 2YMKA 2PFXA 5B66H 3L74G 5CCGD 3G3ZA 1ZXGA 3PP5A 2JU1A 1KB9E 3P05A 1NTME 3SWYA 3CD6P 4BRYA 5APTA 2XZ1C 2O01H 4GT1A 3M06A 4HYTB 5APXA 3O6QA 1YHQP 3O8ZA 1QX8A 1LTSC 2QA4P 1PPJE 1Y9BA 2BCCG 2R44A 1BDCA 3C9IA 4Y28J 1E6JP 1R5SA 1NOHA 1URQB 1LWUC 1NTKD 2WPQA 1IFJA 1NTZK 1A02F 2LR2A 4GOFA 3D71A 1KC8Q 4U0EA 3JSVC 1SQVK 2RKLA 1KILE 2FYUE 1DIPA 2NPSA 3L73E 4L73A 1Q81Q 1VF5C 1M74A 1N7SA 1NTZJ 1URQD 2QJYC 1NU1D 2IPPA 1L0LG 1HJ0A 3HD7D 2OYIC 3M1MA 3NFQA 1M56D 3GMAA 5CCGC 4H44B 3H1ID 1D7MA 3DTJA 3L70D 5CCHA 2I8DA 4M0IA 4WY4A 4H13B 2EG5A 4U3FE 3L71J 2K3RA 3C8VA 1SQQG 2FYZA 3RBZA 2JU2A 2H88C 5KAFH 2Y9ZA 2K0DX 1RE3C 1P84E 4H13D 2B88A 2CWOA 3SFDC 3JC22 3AE4C 1PPJD 3AE8C 3LIDA 2JYLA 2WPVB 3V5BA 1L0ND 4OGQB 3M9HA 3CX5E 3L74D 2NZ2A 2XV5A 2ZYDA 4Y99C 3FGAD 3VN0A 2IZ0A 3PJSK 4BXLA 3TF5A 4JYCA 4OGQD 1FOSE 3GHGA 2V7QH 2HPCB 4W80A 2MKVA 2C0XA 3EQ2A 1SVFA 5GTIH 1UNKA 2FYUD 3ITKA 1Q7YQ 4R4MA 2KI7B 2D2CB 1AJYA 2XXMA 2M3BA 5JPAA 5C39A 1QRJA 2M8LA 4D6TG 3HD7C 3DS4A 3DS1A 3I56P 2AXTH 2MVVA 2R5BA 2LIUA 5BVZA 1NTMK 2D2CD 2WITA 3SWFA 4BRYB 2JP3A 3B8EB 3N7NA 3M91A 1NTMJ 4I7ZC 4L75A 1LGHB 3O6QB 2N5HA 2HLOA 5AW2B 2XNXA 1SQPE 1SQBK 1GW4A 1JJ2O 1LNQA 1EXJA 2L4BA 1L0HA 3EJEA 3H1LG 5KLVK 2ZXXA 2PENA 1SQBJ 5AW9B 1L0LD 1IFMA 3BRTB 2XT1A 3CX5D 3IFMA 5KLVJ 3CC2P 1NH4A 4UHPB 3HUSA 3KDPB 1GL2A 3H6PA 1YJWP 4WWIA 2WSSH 1KYOH 3AE6C 3T97A 4DCKA 4C7NA 3TGUE 5AW1B 5APQA 1RY3A 2IYOA 4I6MC 5HV8A 2NPSB 3LRYA 3V6IA 2CQ8A 1SFCC 1N7SB 2IBZI 1EMVA 3HYBA 1KILC 5AW7B 2FVEA 4A7PA 2K0YA 2BUOA 3L73J 2K94A 2SPZA 2NPSD 4U7JA 1VQKP 4WY4B 1YIJP 1S5LE 3VYIA 4AUWA 1PZQA 4K3AA 1GDTA 3CMEP 4EIJA 2DGYA 4TT3H 5KAIE 4U3FJ 5CCHD 5L8RJ 2CG5B 4UB6H 2KG9A 4WY4D 3GF3A 1PL5A 3FXEA 1S9KE 1FR2A 2WSEJ 3AE9C 1GK4A 2JYGA 2K93A 2E43A 2HG5D 4D6TD 1VL2A 3AECC 4IFMA 3CCJP 1RQUA 2LTEA 1F80D 2KGAA 2M5RA 2QM8A 2L0QA 4QMAA 2KZIA 4BPFA 1HF9A 4IL6X 4MRTC 3M0DC 1LWUA 5EFWB 2E74C 3EJBA 2G8YA 2NRGA 3M9QA 1HWTC 1DX7A 2JAZA 4H2YC 3GKLC 1IUQA 2A45G 4I2LC 2RH0A 2LXBA 1PEOA 3AEEC 5HGOA 2OYIA 2AFEA 3VMXA 2KGCA 3SSUA 2HR3A 5AVSB 4LLHA 2KNCA 1K8AQ 1VDFA 2V4HA 4PD4I 3A0BH 4W7ZA 2WSCH 2PEMA
chains in the Genus database with same CATH topology
1E6JP 1Q7YQ 3G26A 3CCSP 1VQKP 3G71P 1YIJP 2PY8A 2ONTA 2XXMA 3G21A 1QVFO 5JPAA 1QRJA 4COCA 2M8LA 3CC7P 3DS4A 3DS1A 1KC8Q 4U0EA 3CMEP 3I56P 2Z45A 2DGYA 3CCLP 1Q81Q 1M74A 1Q82Q 2XV6A 1D1DA 5BS1A 1RNIA 3CCQP 1EIAA 1VQLP 4XFZA 3CMAP 2PEJA 3RG6C 1M90Q 3E2DA 1M6EX 1VQ6P 1KQSO 3M1MA 1EOQA 2BQ1E 4XFXA 1BAJA 5I4TG 3Q20A 3H47A 1K9MQ 4GR2A 4IPYA 1VQ8P 3DS5A 4U0BA 3CC4P 3DTJA 1VQ4P 1A8OA 2PEIA 3B5IA 5F2KA 2L6EA 5F2OA 2JYGA 3DS3A 4M0IA 4PH0A 2EG5A 1VQNP 2P9XA 2PEQA 1JJ2O 1PEUA 1VQPP 1M6NA 5F2NA 1VQ7P 3G1IA 1NJIQ 4XROA 3CCJP 1A43A 3G6EP 1KD1Q 3G4SP 4COPA 3I55P 3OW2O 3H0DA 2PENA 4QNBA 2BHVA 3P05A 2EIAA 2CWOA 3G0VA 1ZMBA 3CD6P 2XT1A 5HGMA 4PH1A 3G28A 3CC2P 3CCVP 3CCEP 1VQOP 2Z46A 2OARA 3CCUP 1Q86Q 2EFJA 4U0FA 3DS2A 3CCMP 2JYLA 4U0CA 2LF4A 1YJWP 1K73Q 3CXCO 1IUQA 3WBHA 1YHQP 2PEKA 4U0AA 3G29A 1YI2P 5BS2A 1M1KQ 3LRYA 1AUMA 2OTJP 2QA4P 3NTEA 1PEOA 4XFYA 3HYBA 3MGEA 1YJNP 1VQ9P 4GR6A 5HGLA 2Z44A 5HGOA 1PEQA 2JO0A 2QEXP 3CPWO 3DPHA 3CCRP 2PEOA 3DS0A 1PEMA 1YJ9P 2BUOA 1N8RQ 1VQMP 1S72P 1K30A 3H4EA 5HGNA 2M8PA 1YITP 1RO0A 3HZQA 2OTLP 4XRQA 2KODA 4WYMA 1W2BO 2E1MA 1QVGO 1VQ5P 3VRLC 1K8AQ 2M8NA 5DCKA 3G1GA 4U0DA 1RO2A 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y Q;  1YHQ P;  1VQ6 P;  1KQS O;  3CCS P;  1YI2 P;  1VQK P;  1M1K Q;  3G71 P;  3I55 P;  3OW2 O;  1YIJ P;  1QVF O;  1K9M Q;  2OTJ P;  2QA4 P;  3G4S P;  1VQ8 P;  1YJN P;  1VQ9 P;  3CC7 P;  3CD6 P;  3CC4 P;  3CPW O;  2QEX P;  3CCR P;  1KC8 Q;  1VQ4 P;  3CME P;  3I56 P;  1YJ9 P;  1N8R Q;  1VQM P;  1S72 P;  3CC2 P;  3CCE P;  3CCL P;  1VQO P;  1YIT P;  1VQN P;  3CCU P;  1Q81 Q;  1Q86 Q;  1VQP P;  1Q82 Q;  1JJ2 O;  1W2B O;  1VQ7 P;  1QVG O;  2OTL P;  1VQ5 P;  1NJI Q;  1K8A Q;  3CCJ P;  3CCM P;  3CCQ P;  1YJW P;  3CMA P;  1K73 Q;  3G6E P;  1KD1 Q;  1VQL P;  3CCV P;  3CXC O;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1CI6 B;  2QJK B;  1NKZ B;  2AEF A;  2MR7 A;  3FWN A;  3L75 G;  4YXD C;  3VTP C;  2E5Y A;  3K5B A;  2FFD C;  4PD4 E;  2VSQ A;  1RE3 A;  2AFD A;  1IFP A;  3USS A;  2XV6 A;  1D1D A;  5CBO A;  1R8E A;  2N5I A;  1PP9 D;  4OH8 B;  4XFX A;  4JYB A;  1AQ5 A;  1H89 A;  4GOE A;  1GL2 B;  1QGK B;  2KYV A;  1EXI A;  1RQV A;  3T97 B;  4C7N B;  1EZV D;  2Z4E A;  4N78 D;  3V4W A;  1A02 J;  5E79 E;  4WVZ A;  2M3E A;  1XTC C;  1GU4 A;  3TGU J;  3AEB C;  2JDI H;  3KYQ A;  1E5W A;  5BU5 A;  2BEZ F;  3GHG C;  1BGY E;  2N9B A;  2K9Y A;  2G3A A;  2K5X A;  2EIA A;  2YIU C;  3V2N A;  2GM4 A;  2ZFC A;  5AVQ B;  2GZG A;  2EFJ A;  3RK2 C;  2FQ1 A;  3DS2 A;  3H1H E;  4PV1 B;  5DJT B;  3CXH I;  2LKM A;  1VHN A;  4U0A A;  3GF7 A;  2LOL A;  1SQV E;  1G1I A;  2A06 E;  4I1L A;  1FDI A;  2KSJ A;  3WU2 E;  4GR6 A;  2Y0E A;  1XTG B;  2NO8 A;  5APS A;  2FXM A;  3CPW O;  4PV1 D;  2PEO A;  1S72 P;  4H0L C;  3BAS A;  1OZH A;  3WUU A;  3MIW A;  1H8A A;  3P8C D;  2PY8 A;  2GDW A;  1MFZ A;  1HUC A;  4NPD A;  3AE7 C;  2Q3E A;  3R4Y A;  2B9B A;  3CMA P;  4DJG A;  2VLQ A;  3A7O A;  1WMK A;  2WMM A;  4W7Y A;  3EFF K;  1LWU B;  1MZ8 A;  2FBW C;  2VLP A;  2K1A A;  3HUS C;  3AE5 C;  2K9J B;  1L2P A;  2KG6 A;  1JUN A;  4EDF A;  5F2K A;  1HH0 A;  3DS3 A;  3L75 D;  2FHS C;  2L9F A;  1PEU A;  1VF5 B;  3F89 A;  1SFC A;  1X9V A;  5F2N A;  1ZNV A;  2FXP A;  2QJY B;  1H88 A;  2GZE A;  2GA1 A;  3JCU H;  1KIL A;  4PWV B;  2KOO A;  2JWD A;  2OYI B;  4KJM A;  1Z56 A;  1NTZ D;  4TLF A;  2KNC B;  2N1T C;  2WZ7 A;  1VF5 D;  1PPJ G;  4L76 A;  2M5A A;  5KP6 B;  2QVA A;  4PH1 A;  3W68 A;  3TYY A;  2QE7 H;  4UB8 E;  4OVN F;  3KHU A;  4U0C A;  3PLN A;  4PV1 C;  3WBH A;  5KJ7 C;  3AEF C;  3L71 D;  3GLM A;  2ZXE B;  1X79 B;  1JCD A;  2FKW B;  5GTI E;  3Q5S A;  1FS0 E;  3BVH A;  2FYU G;  4ZKP A;  3V2P A;  4JBZ A;  1U7J A;  3L73 G;  4ASW A;  1X3O A;  1L0I A;  1MFT A;  1YQ3 C;  2ZVN B;  1BE3 J;  2JQ4 A;  2AXT E;  5CMZ A;  5HVC A;  1SQB E;  1HTL C;  2H43 A;  4Y99 B;  2EHS A;  1RE4 C;  2N6Y A;  2R32 A;  2DW3 A;  7CEI A;  1U57 A;  3FX0 A;  3MD0 A;  4PXH B;  5KLV E;  3B71 A;  3L72 E;  1UJZ A;  4U3F G;  3CCQ P;  2L91 A;  3AED C;  1EIA A;  1VQL P;  1OMI A;  1H0T B;  3EWK A;  3Q1M A;  2O01 J;  1S5L X;  3M0A A;  3M0D A;  3CXH H;  2O1K A;  3H47 A;  1BGY J;  2WTY A;  1DEE G;  3HD7 B;  1W5C E;  2KOS A;  3WUV A;  1X22 A;  2Q5U A;  2JB0 A;  1OIP A;  4C46 A;  2P58 A;  3H1H J;  2YO2 A;  1KYO I;  5GTH H;  1ZR2 A;  1MUU A;  1SQV J;  3H0D A;  1N2D C;  3FWL A;  1EC5 A;  1X8Y A;  4I7Z B;  1RH5 B;  3B4Q A;  3G0V A;  1GW3 A;  4RKU J;  1KYO E;  3CCE P;  1IJD B;  1KQG B;  4DZO A;  1KB9 D;  1Q86 Q;  1NTM D;  5TIS H;  5CJ0 A;  3D70 A;  3VMZ A;  1GPJ A;  2GUV A;  3CI9 A;  2P1J A;  2E75 C;  1GK6 A;  2FFD A;  3MGE A;  1VQ9 P;  3P7K A;  5HGL A;  2Z44 A;  2KP8 A;  2ZYG A;  3BCC E;  1BXI A;  2AF8 A;  2YXQ B;  1LTJ C;  1AVO A;  2K2Q A;  3U59 A;  3FXD A;  3TK1 A;  1ZOY C;  1SFC B;  1FZA A;  3PTZ A;  4UB6 E;  1KIL B;  5KLI C;  5AW3 B;  1CZQ A;  4IOI H;  5KKZ C;  4H2X C;  1CEI A;  5KP8 B;  4EYY Q;  1SQP G;  4K35 A;  1UII A;  1SFC D;  4XFZ A;  4IL6 H;  2JKV A;  2M5A B;  1KIL D;  1KQS O;  1OXZ A;  3L73 D;  4R4L A;  3Q20 A;  1ZRT E;  2P10 A;  1VQ8 P;  1USD A;  1MV8 A;  5AW0 B;  1PGJ A;  2J59 M;  4YTP C;  1J2J B;  4RO0 A;  3VP8 A;  2IX7 C;  4B86 A;  3G1I A;  2WPT A;  5AVU B;  1SQQ E;  5AW8 B;  2JEE A;  4KHX A;  3TGU G;  3I55 P;  4U3F D;  2KS1 A;  2RMZ A;  2VLO A;  2V7Q J;  2CGQ A;  2Y0C A;  2ITA A;  2JJL A;  1NWQ A;  1P84 D;  4U0F A;  2O3J A;  2KG8 A;  1JY3 O;  4CA3 A;  1R5L A;  1DEB A;  1U7M A;  3L70 J;  3G29 A;  1YI2 P;  1Z6M A;  1M1K Q;  1VKU A;  3H1K J;  4WBA A;  2YXR B;  1YBK A;  1BCC J;  3OJA B;  2PAJ A;  3VMA A;  3A5T A;  1PEM A;  1HY8 A;  3L72 J;  2E74 B;  4XFJ A;  1K04 A;  1YQ4 C;  2Q7C A;  5APU A;  5K5G B;  1L0N K;  1YTZ T;  2W6A A;  2H8P D;  3U1A A;  2KSE A;  3AE2 C;  4COC A;  3CC7 P;  2E74 D;  1L0N J;  2Z45 A;  3IN6 A;  2Q1K A;  2X2B A;  1PP9 G;  2N1T A;  3M9B A;  4OWF A;  1WT6 A;  2IBZ E;  4GKG A;  2E76 C;  5AVR B;  3CE7 A;  1JTH A;  2BAS A;  1KTM A;  1EZV G;  1AQT A;  2QIW A;  2MF4 A;  1S4X A;  1J1D C;  1T8K A;  5KJ7 A;  1S2E A;  1P84 H;  2FXO A;  2FFD B;  1LTI C;  4GIF A;  1VQP P;  1VQ7 P;  3H1L E;  3HTK A;  2Y9Y A;  2E5T A;  3G4S P;  1SQP D;  1EDJ A;  4N3Y B;  4R0M A;  2YKQ A;  1S3J A;  1BDD A;  2O1J A;  2W8Z A;  1GU5 A;  2OYO A;  3CX5 H;  3BCC J;  3PH0 A;  2M8R A;  1CW5 A;  1DV5 A;  3MTU E;  2BCC J;  2P67 A;  2OYH A;  3CCM P;  1W2E A;  2M0B A;  3AEA C;  1RF1 C;  1RE4 A;  1JOC A;  3GHG B;  5EJD A;  1GZL A;  2O01 N;  2PP6 A;  3CWB E;  2YIU B;  3TGU D;  3SFE C;  1AVY A;  3L36 A;  5CJ4 A;  1N8R Q;  1FZC A;  1K30 A;  1QLE D;  3HZQ A;  1W2B O;  1LTA C;  4PJ0 H;  3RK2 B;  2ZAE B;  1PV3 A;  2M8N A;  1N86 A;  1OW7 A;  1AYI A;  3G1G A;  2PRR A;  4HB1 A;  5CHX A;  1EQ7 A;  3EFG A;  1DD4 A;  1QVF O;  1LJ2 A;  1SQQ K;  2H89 C;  2IBZ D;  3B5N C;  2K88 A;  3RK2 D;  2E42 A;  3HRN A;  4H0L B;  3CCL P;  2KS1 B;  2CPB A;  4HKG A;  1SQQ J;  1VPC A;  1AA0 A;  2OTK E;  1OWA A;  1GMJ A;  4JF7 A;  2ROQ A;  4JPZ B;  4H0L D;  1BGY G;  1LT9 C;  2VRS A;  1S9K D;  3RK3 E;  2L6E A;  2PEQ A;  1OFC X;  1NJI Q;  1PGO A;  3A2A A;  3H1H G;  3G6E P;  1NTZ G;  1KOR A;  1BE3 E;  1SQV G;  4HJG H;  1NHL A;  2A06 G;  1LTT C;  3HUS B;  2ZJS E;  1FJK A;  1ZMB A;  3LMO A;  1LTJ A;  1N7L A;  5B66 E;  3PHL A;  1ZN5 A;  2WSC J;  2KLV A;  1LP1 A;  3RG2 A;  3L71 G;  1TU3 F;  5APV A;  3TSI A;  2N1T B;  1J1E C;  5AVW B;  2I1J A;  4YPC A;  4XRQ A;  1JTH B;  1FZB A;  3TNU A;  1ZME C;  3VRL C;  1KLP A;  3A0H H;  2R3C A;  1FU1 A;  2KLU A;  2N1T D;  3VOP A;  2KOR A;  3U43 A;  3S4R A;  2AVA A;  2KR5 A;  2FAC A;  2YKO A;  3HTK B;  3LIE A;  3VMY A;  2GYK A;  3H1J E;  1SQX E;  2KB7 P;  5KJ7 D;  2J58 A;  3CXH E;  2QM7 A;  1M1J C;  3H1L J;  4C7R A;  1QEX A;  1E79 H;  3RG6 C;  4PD4 D;  4LGD E;  1IZN B;  2W83 C;  3BRV B;  2FYN C;  5B5E H;  1BE3 D;  1AF8 A;  3CC4 P;  2PEI A;  3B5I A;  5F2O A;  2WVR A;  4PH0 A;  2P9X A;  4MN4 C;  2KZJ A;  1KFN A;  1KN7 A;  1IK9 A;  3R2P A;  1OVU A;  3L4F A;  1HGZ A;  1FZC B;  2JWA A;  2L22 A;  2BHV A;  1JY2 P;  1DD3 A;  3CWB J;  3MUD C;  1E0H A;  1L4A D;  1NTM G;  2WSF H;  1KMI Z;  3G28 A;  2IFN A;  2AEJ A;  1BGY D;  5KAF E;  1EDK A;  3CXC O;  2PEK A;  1LT1 A;  1KFM A;  2LML A;  4KT0 J;  4BPG A;  3H1H D;  1SQB G;  2XDJ A;  3BAT A;  2B87 A;  2IZ1 A;  3CL3 D;  2JO0 A;  1FBM A;  1JY3 P;  1YJ9 P;  2XND H;  1SQV D;  1ZR4 A;  1M8O B;  2A06 D;  2OGU A;  5KLV G;  3OAK A;  1HQB A;  5AVY B;  4WYM A;  1NTK E;  2I1K A;  2E1M A;  3L72 G;  1QL1 A;  1ZW0 A;  3CCV P;  4U0D A;  4EI2 A;  2W27 A;  2E75 B;  2EHT A;  3G26 A;  1AFO A;  2YMY A;  4QKO A;  2YKP A;  2KGD A;  3G21 A;  1FOS F;  2HYN A;  2A45 H;  3RL0 g;  3RK3 C;  3V2R A;  5H2F H;  1GTW A;  1FE6 A;  1NU1 E;  3L37 A;  2B89 A;  1X0T A;  2E75 D;  5AVT B;  2YNY A;  2LL8 A;  2Y0D A;  5DJU B;  1EDI A;  1LTJ B;  2J5U A;  1M90 Q;  5E79 H;  3H1I E;  3AEG C;  2C0W A;  3L70 E;  2WT7 A;  1K9M Q;  1LP1 B;  3H1K E;  2GZF A;  2FQ2 A;  2OYH C;  1RF1 A;  1BCC E;  5KLI B;  1PGP A;  1M57 D;  5KKZ B;  3P32 A;  1PFI A;  1IMP A;  4JQ0 D;  3V2Q A;  1L4A C;  4O9B A;  2CPS A;  1N73 A;  1IC2 A;  1FZG A;  3KQG A;  4ZKU A;  2XU6 A;  1FZC C;  3OW2 O;  1GXH A;  3RL0 C;  2N9Y B;  3TNU B;  2XZ0 D;  1FDO A;  1LTB C;  1L0N E;  2K37 A;  2R3S A;  4LC1 A;  3BCC G;  4YXW H;  2HOD A;  4GOD A;  3WU2 H;  2OAR A;  1DNY A;  3L74 E;  2WQY C;  1FAV A;  3B5N A;  1SQX K;  2LIW A;  2AXC A;  3F5H A;  3Q3D A;  1WRG A;  3L75 J;  1OVV A;  3II6 A;  1AUM A;  3ABV C;  2IYP A;  5CBN A;  4BWN A;  3H1J J;  1SQX J;  1NGM B;  1HGV A;  4HKZ H;  2FQ0 A;  4NEO A;  3H4E A;  2M8P A;  3G9R A;  2PNG A;  1GD2 E;  4F37 A;  2FAE A;  2GZJ A;  4ZNC A;  5DCK A;  1LT9 A;  1YTZ I;  1T2K C;  4Z1M H;  4NPE A;  4NPF X;  5KP7 B;  1P84 I;  1Y8A A;  1Y47 A;  4IFD K;  3H1K D;  2QJP C;  1PIX A;  1SQB D;  2BCC E;  3SWK A;  1BCC D;  1FZF A;  5BS1 A;  1OW6 A;  1G1J A;  5APW A;  4H44 D;  5KLV D;  3E2D A;  3L72 D;  4GR2 A;  3CX5 I;  3KZI H;  2YO3 A;  1T6A A;  2JGP A;  2XKM A;  2GZI A;  4ZMD A;  1VQ4 P;  2JO1 A;  3NY7 B;  2FY8 A;  2BEQ D;  1KZU B;  1L0L E;  2B87 B;  3U1C A;  1KQF B;  3HE5 A;  1GXG A;  4UB8 H;  2E76 B;  2KUB A;  4DT0 A;  4QNB A;  4DOJ A;  1NTK K;  1KQL A;  1J1D B;  5HGM A;  2MJZ A;  2UWJ E;  4CPG A;  1KB9 H;  1VQO P;  1JY2 O;  3CCU P;  1NTK J;  1SLQ A;  2E76 D;  2LF4 A;  4EOT A;  2KGE A;  1NU1 K;  1KYO D;  5BS2 A;  1URQ C;  4RJT A;  1NQ4 A;  1M1J A;  1T3J A;  3VP9 A;  4XFY A;  1YJN P;  4PJ0 E;  1NU1 J;  3NTN A;  1IFD A;  2WT7 B;  3GJN A;  3NMD A;  1YIT P;  2OTL P;  1VQ5 P;  2QNW A;  2PGD A;  2K92 A;  1NO4 A;  2Q3I A;  5M1B A;  1RF1 B;  3BCC D;  3H1I J;  2LXC B;  2JBG A;  3H32 A;  2BCC D;  3G71 P;  3IF4 A;  2IBZ G;  2MR8 A;  2ONT A;  3UIA A;  1N73 B;  4XA4 A;  4H44 C;  3Q2Y A;  1CI6 A;  3AE3 C;  3A0B E;  3C1L A;  1MZ9 A;  2ERH A;  4H13 C;  2AEM A;  3MUD A;  4HH2 A;  1VQ6 P;  5EW5 E;  3PRJ A;  1JCC A;  4M3L A;  3TDK A;  2N50 A;  2HOD B;  1OR5 A;  4D6T E;  3E1R A;  3DS5 A;  3B5N B;  3KXD A;  3GG2 A;  2KIK A;  1ZRT D;  1FDM A;  3L74 J;  1BSH A;  1USE A;  1RF0 C;  1KV4 A;  4OGQ C;  2FYU K;  1NAY A;  3B5N D;  5AVZ B;  2P2U A;  1FZE A;  1ZLL A;  2WWW A;  1SQQ D;  2LPK A;  2Q9I A;  4GDO A;  5APY A;  3CWB G;  2KXP B;  1LT9 B;  2FYU J;  2H7H A;  2WSE H;  2RN0 A;  1ACP A;  1N7S D;  3OA7 A;  1K73 Q;  4ASV A;  2D2C C;  1T3U A;  3MP7 B;  1IK7 A;  4IZ6 A;  1PEQ A;  2IFM A;  3A0H E;  3DPH A;  3CCR P;  3GW6 A;  2LKI A;  1DH3 A;  2FVF A;  5AVV B;  1ZP0 C;  3QH9 A;  3CCS P;  4AQR D;  2MY5 A;  2R5D A;  2GUS A;  1NYH A;  2QSI A;  1G2C A;  3IAO A;  2XZR A;  1L4A A;  2KOG A;  1L0L K;  1J1E B;  1N73 C;  1EZV I;  4H2W C;  3RBX A;  1IFN A;  3EJD A;  1PP9 E;  3I5C A;  3HE5 B;  3S1K A;  2QRX A;  3HE4 A;  1RNI A;  3KPE A;  1L0L J;  5B5E E;  5AW4 B;  1BE3 G;  2ZVO B;  1EZV E;  4N78 E;  4IPY A;  4N6J A;  2CK3 H;  1UIX A;  1FC2 C;  1Q2N A;  1JNM A;  3E7K A;  1M1J B;  2K9J A;  4XRO A;  1A43 A;  5AVX B;  1T8Z A;  2C9N Y;  2C9L Y;  1IO4 A;  2NPS C;  2W6B A;  2FYN B;  1N7S C;  4BPH A;  3H1L D;  5BU8 B;  1NKN A;  1SS1 A;  5TJH A;  2CNR A;  4IFF A;  3JCU E;  2POH A;  2W90 A;  3H32 B;  1FJP A;  5AW5 B;  5CCG A;  2K0X A;  3N4X A;  2MVU A;  1EDL A;  1IMQ A;  2Z5H A;  2ZT9 B;  3MZW B;  5CCH C;  1SQP K;  4WY4 C;  1JO5 A;  1JEK A;  2A45 I;  1IFI A;  2FVA A;  2L5G B;  3DS0 A;  1OVR A;  3H1J G;  1SQX G;  1SQP J;  1JB0 J;  1ZV8 A;  3LW5 H;  3P8C E;  2ZT9 D;  1HBW A;  1RO0 A;  3CWB D;  4RES B;  3D6Y A;  1BSN A;  5I4T G;  5H2F E;  1JMB A;  1NVO A;  1JMM A;  4D6T J;  1CSB A;  5AW6 B;  3S9O A;  2Q6Q A;  1S5L H;  1QL2 A;  1HJB A;  1PGQ A;  2P7J A;  1Q82 Q;  3H25 A;  1GL2 D;  3W67 A;  1YYC A;  3WUT A;  3D6Z A;  5KAI H;  3RGU A;  3LW5 J;  2BQ1 E;  2MD9 A;  2IDB A;  3GZL A;  3L75 E;  2VLN A;  3RK3 B;  1H0T A;  4U0B A;  1A8O A;  3V4Q A;  1URQ A;  1VQN P;  2WPS A;  1NTZ E;  3HD7 A;  1KD1 Q;  2KK7 A;  1NAF A;  3RK3 D;  4COP A;  4L74 A;  2DNW A;  1SP4 A;  2ZYA A;  2OYH B;  3IR9 A;  4DG9 A;  5GTH E;  5KTB A;  2Z46 A;  3ZDM A;  1G2C B;  3L71 E;  1L4A B;  4XE5 B;  1NTK G;  2OQQ A;  2QJK C;  2ZT9 C;  3RL0 B;  2OTJ P;  3NTE A;  3GZM A;  3HE4 B;  1Q90 D;  3P8M C;  5TIS E;  2QEX P;  1HVV A;  1NU1 G;  1VQM P;  3QWO C;  1PP9 J;  5HGN A;  2JR8 A;  2KOP A;  2KOD A;  1QVG O;  2N98 A;  3RL0 D;  1RO2 A;  1RHZ B;  2Z5I A;  3H1I G;  3Q5P A;  3L70 G;  2FAD A;  2GDX A;  1RF0 A;  4AYC A;  3H1K G;  3A3Y B;  1GL2 C;  1OW8 A;  3MGN A;  1BCC G;  1JY2 N;  3B4S A;  1MKM A;  2GDY A;  2QG4 A;  3MHV A;  1JM0 A;  3NXS A;  2KW2 A;  1SQX D;  3H1J D;  3AE1 C;  3KZI E;  3L35 A;  2KWL A;  2PEJ A;  2HFE D;  2KOQ A;  1M6E X;  4PD4 H;  1OX3 A;  1EOQ A;  2WSF J;  3CXH D;  2WPR A;  1BAJ A;  1M7L A;  2N6Z A;  1LTG C;  2HPC A;  2W6J H;  4WB4 A;  1K05 A;  5CZD B;  3E1I A;  3Q5R A;  1S1C X;  3CLQ A;  1KB9 I;  3WMM 0;  1L0N G;  1JY3 N;  4IL6 E;  2QJP B;  1T2K D;  1AV1 A;  1M6N A;  2YMK A;  2PFX A;  5B66 H;  3L74 G;  5CCG D;  3G3Z A;  1ZXG A;  3PP5 A;  2JU1 A;  1KB9 E;  3P05 A;  1NTM E;  3SWY A;  3CD6 P;  4BRY A;  5APT A;  2XZ1 C;  2O01 H;  4GT1 A;  3M06 A;  4HYT B;  5APX A;  3O6Q A;  1YHQ P;  3O8Z A;  1QX8 A;  1LTS C;  2QA4 P;  1PPJ E;  1Y9B A;  2BCC G;  2R44 A;  1BDC A;  3C9I A;  4Y28 J;  1E6J P;  1R5S A;  1NOH A;  1URQ B;  1LWU C;  1NTK D;  2WPQ A;  1IFJ A;  1NTZ K;  1A02 F;  2LR2 A;  4GOF A;  3D71 A;  1KC8 Q;  4U0E A;  3JSV C;  1SQV K;  2RKL A;  1KIL E;  2FYU E;  1DIP A;  2NPS A;  3L73 E;  4L73 A;  1Q81 Q;  1VF5 C;  1M74 A;  1N7S A;  1NTZ J;  1URQ D;  2QJY C;  1NU1 D;  2IPP A;  1L0L G;  1HJ0 A;  3HD7 D;  2OYI C;  3M1M A;  3NFQ A;  1M56 D;  3GMA A;  5CCG C;  4H44 B;  3H1I D;  1D7M A;  3DTJ A;  3L70 D;  5CCH A;  2I8D A;  4M0I A;  4WY4 A;  4H13 B;  2EG5 A;  4U3F E;  3L71 J;  2K3R A;  3C8V A;  1SQQ G;  2FYZ A;  3RBZ A;  2JU2 A;  2H88 C;  5KAF H;  2Y9Z A;  2K0D X;  1RE3 C;  1P84 E;  4H13 D;  2B88 A;  2CWO A;  3SFD C;  3JC2 2;  3AE4 C;  1PPJ D;  3AE8 C;  3LID A;  2JYL A;  2WPV B;  3V5B A;  1L0N D;  4OGQ B;  3M9H A;  3CX5 E;  3L74 D;  2NZ2 A;  2XV5 A;  2ZYD A;  4Y99 C;  3FGA D;  3VN0 A;  2IZ0 A;  3PJS K;  4BXL A;  3TF5 A;  4JYC A;  4OGQ D;  1FOS E;  3GHG A;  2V7Q H;  2HPC B;  4W80 A;  2MKV A;  2C0X A;  3EQ2 A;  1SVF A;  5GTI H;  1UNK A;  2FYU D;  3ITK A;  1Q7Y Q;  4R4M A;  2KI7 B;  2D2C B;  1AJY A;  2XXM A;  2M3B A;  5JPA A;  5C39 A;  1QRJ A;  2M8L A;  4D6T G;  3HD7 C;  3DS4 A;  3DS1 A;  3I56 P;  2AXT H;  2MVV A;  2R5B A;  2LIU A;  5BVZ A;  1NTM K;  2D2C D;  2WIT A;  3SWF A;  4BRY B;  2JP3 A;  3B8E B;  3N7N A;  3M91 A;  1NTM J;  4I7Z C;  4L75 A;  1LGH B;  3O6Q B;  2N5H A;  2HLO A;  5AW2 B;  2XNX A;  1SQP E;  1SQB K;  1GW4 A;  1JJ2 O;  1LNQ A;  1EXJ A;  2L4B A;  1L0H A;  3EJE A;  3H1L G;  5KLV K;  2ZXX A;  2PEN A;  1SQB J;  5AW9 B;  1L0L D;  1IFM A;  3BRT B;  2XT1 A;  3CX5 D;  3IFM A;  5KLV J;  3CC2 P;  1NH4 A;  4UHP B;  3HUS A;  3KDP B;  1GL2 A;  3H6P A;  1YJW P;  4WWI A;  2WSS H;  1KYO H;  3AE6 C;  3T97 A;  4DCK A;  4C7N A;  3TGU E;  5AW1 B;  5APQ A;  1RY3 A;  2IYO A;  4I6M C;  5HV8 A;  2NPS B;  3LRY A;  3V6I A;  2CQ8 A;  1SFC C;  1N7S B;  2IBZ I;  1EMV A;  3HYB A;  1KIL C;  5AW7 B;  2FVE A;  4A7P A;  2K0Y A;  2BUO A;  3L73 J;  2K94 A;  2SPZ A;  2NPS D;  4U7J A;  1VQK P;  4WY4 B;  1YIJ P;  1S5L E;  3VYI A;  4AUW A;  1PZQ A;  4K3A A;  1GDT A;  3CME P;  4EIJ A;  2DGY A;  4TT3 H;  5KAI E;  4U3F J;  5CCH D;  5L8R J;  2CG5 B;  4UB6 H;  2KG9 A;  4WY4 D;  3GF3 A;  1PL5 A;  3FXE A;  1S9K E;  1FR2 A;  2WSE J;  3AE9 C;  1GK4 A;  2JYG A;  2K93 A;  2E43 A;  2HG5 D;  4D6T D;  1VL2 A;  3AEC C;  4IFM A;  3CCJ P;  1RQU A;  2LTE A;  1F80 D;  2KGA A;  2M5R A;  2QM8 A;  2L0Q A;  4QMA A;  2KZI A;  4BPF A;  1HF9 A;  4IL6 X;  4MRT C;  3M0D C;  1LWU A;  5EFW B;  2E74 C;  3EJB A;  2G8Y A;  2NRG A;  3M9Q A;  1HWT C;  1DX7 A;  2JAZ A;  4H2Y C;  3GKL C;  1IUQ A;  2A45 G;  4I2L C;  2RH0 A;  2LXB A;  1PEO A;  3AEE C;  5HGO A;  2OYI A;  2AFE A;  3VMX A;  2KGC A;  3SSU A;  2HR3 A;  5AVS B;  4LLH A;  2KNC A;  1K8A Q;  1VDF A;  2V4H A;  4PD4 I;  3A0B H;  4W7Z A;  2WSC H;  2PEM A; 
#chains in the Genus database with same CATH homology
 1E6J P;  1Q7Y Q;  3G26 A;  3CCS P;  1VQK P;  3G71 P;  1YIJ P;  2PY8 A;  2ONT A;  2XXM A;  3G21 A;  1QVF O;  5JPA A;  1QRJ A;  4COC A;  2M8L A;  3CC7 P;  3DS4 A;  3DS1 A;  1KC8 Q;  4U0E A;  3CME P;  3I56 P;  2Z45 A;  2DGY A;  3CCL P;  1Q81 Q;  1M74 A;  1Q82 Q;  2XV6 A;  1D1D A;  5BS1 A;  1RNI A;  3CCQ P;  1EIA A;  1VQL P;  4XFZ A;  3CMA P;  2PEJ A;  3RG6 C;  1M90 Q;  3E2D A;  1M6E X;  1VQ6 P;  1KQS O;  3M1M A;  1EOQ A;  2BQ1 E;  4XFX A;  1BAJ A;  5I4T G;  3Q20 A;  3H47 A;  1K9M Q;  4GR2 A;  4IPY A;  1VQ8 P;  3DS5 A;  4U0B A;  3CC4 P;  3DTJ A;  1VQ4 P;  1A8O A;  2PEI A;  3B5I A;  5F2K A;  2L6E A;  5F2O A;  2JYG A;  3DS3 A;  4M0I A;  4PH0 A;  2EG5 A;  1VQN P;  2P9X A;  2PEQ A;  1JJ2 O;  1PEU A;  1VQP P;  1M6N A;  5F2N A;  1VQ7 P;  3G1I A;  1NJI Q;  4XRO A;  3CCJ P;  1A43 A;  3G6E P;  1KD1 Q;  3G4S P;  4COP A;  3I55 P;  3OW2 O;  3H0D A;  2PEN A;  4QNB A;  2BHV A;  3P05 A;  2EIA A;  2CWO A;  3G0V A;  1ZMB A;  3CD6 P;  2XT1 A;  5HGM A;  4PH1 A;  3G28 A;  3CC2 P;  3CCV P;  3CCE P;  1VQO P;  2Z46 A;  2OAR A;  3CCU P;  1Q86 Q;  2EFJ A;  4U0F A;  3DS2 A;  3CCM P;  2JYL A;  4U0C A;  2LF4 A;  1YJW P;  1K73 Q;  3CXC O;  1IUQ A;  3WBH A;  1YHQ P;  2PEK A;  4U0A A;  3G29 A;  1YI2 P;  5BS2 A;  1M1K Q;  3LRY A;  1AUM A;  2OTJ P;  2QA4 P;  3NTE A;  1PEO A;  4XFY A;  3HYB A;  3MGE A;  1YJN P;  1VQ9 P;  4GR6 A;  5HGL A;  2Z44 A;  5HGO A;  1PEQ A;  2JO0 A;  2QEX P;  3CPW O;  3DPH A;  3CCR P;  2PEO A;  3DS0 A;  1PEM A;  1YJ9 P;  2BUO A;  1N8R Q;  1VQM P;  1S72 P;  1K30 A;  3H4E A;  5HGN A;  2M8P A;  1YIT P;  1RO0 A;  3HZQ A;  2OTL P;  4XRQ A;  2KOD A;  4WYM A;  1W2B O;  2E1M A;  1QVG O;  1VQ5 P;  3VRL C;  1K8A Q;  2M8N A;  5DCK A;  3G1G A;  4U0D A;  1RO2 A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...