1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
3G71P 1M90Q 3CCUP 1YI2P 3CC4P 1K8AQ 3CCSP 1KC8Q 1VQ7P 2QEXP 1YIJP 1QVFO 1VQNP 3CD6P 1VQOP 1Q7YQ 3CC7P 3G4SP 1VQ8P 3CMEP 3G6EP 1VQ9P 3I56P 2QA4P 1YJWP 1Q81Q 3CCQP 1JJ2O 1W2BO 1VQ5P 1M1KQ 3CCJP 1VQPP 1YHQP 1QVGO 1VQLP 3CC2P 1VQ6P 3CCRP 1KD1Q 1YJNP 1Q86Q 1NJIQ 3I55P 1VQKP 3CCEP 2OTLP 3CMAP 2OTJP 1YJ9P 3CCMP 3CPWO 1VQMP 1S72P 3OW2O 1Q82Q 1K73Q 1K9MQ 3CCVP 1VQ4P 3CXCO 1N8RQ 1KQSO 3CCLP 1YITP
chains in the Genus database with same CATH superfamily
1DH3A 1G1JA 1GMJA 2QEXP 1FBMA 5KTBA 3CXHI 1BAJA 2IYOA 3V2RA 2WVRA 4EI2A 3Q1MA 2GDWA 2O1JA 1QVGO 2H88C 5APSA 2D2CD 1E6JP 2WZ7A 1PGQA 5K5GB 2EIAA 3FX0A 3KQGA 1NU1K 3SFDC 4GT1A 2LOLA 2E74C 1UNKA 2XT1A 1L4AD 3BASA 3H1JJ 1PPJE 2PGDA 3MUDA 1QVFO 3USSA 1NWQA 1SQBG 1KV4A 1IC2A 3N4XA 4YPCA 5KAFE 2OTJP 3Q3DA 1NU1E 3HTKA 5KJ7D 1T2KC 2FQ0A 2N9YB 2ZT9C 1VF5D 1J2JB 2RMZA 1AQ5A 1NU1J 1ZRTD 1VQ7P 1USEA 4AQRD 1LP1B 1G2CA 2A45I 3CL3D 4UB6H 1W2BO 1BDDA 1JY2P 1VQ6P 1P84E 5AW2B 2J5UA 2JAZA 4L76A 1GXHA 2C9NY 1HGZA 4WVZA 2FHSC 1YIJP 2KP8A 1L0LD 3G6EP 1OFCX 1UIIA 3V2NA 2RKLA 1JY2O 1LWUA 4N78E 1NTZE 1BGYJ 2KK7A 2N5IA 2GYKA 2M8PA 3IF4A 4CPGA 1S3JA 2AXCA 2SPZA 3L72D 1XTGB 1SQPE 1U7JA 1PGOA 1SQBJ 3HUSA 5GTHE 1GZLA 1NTKE 4XA4A 3V2PA 1JY3N 3VP9A 1FZCC 2H89C 1JUNA 5KJ7C 1T2KD 2BHVA 3L70D 3A5TA 3AE9C 3OW2O 2V7QJ 1IUQA 3AEBC 2HPCA 2PENA 2FYUD 2IZ0A 1HJBA 3CXHE 2FBWC 1LWUC 2JO0A 3U1CA 1SFCD 5TJHA 1AYIA 2FYUG 3MP7B 1K73Q 5TISE 4AYCA 1GL2B 3CXHD 4C46A 1OR5A 3JCUH 3A0BH 2FYUE 1S4XA 3DS1A 1URQB 4U0FA 2MR8A 2KSEA 3GZLA 3B5NC 3OAKA 4N78D 1NO4A 4EIJA 2QJKB 3G1IA 3RG2A 2L91A 1PGJA 4HYTB 5B5EE 3EFGA 2PEJA 3GF7A 2NPSC 2K0DX 2OYIB 1HUCA 1P84H 1CI6B 3M9BA 4KT0J 4C7RA 3C9IA 3L72G 4O9BA 2E5YA 1XTCC 2Y0DA 3LIDA 3T97B 2LF4A 3HE4B 3VTPC 2FFDA 3M06A 2WSSH 4KJMA 3VMYA 5KLIC 3F5HA 4IFMA 3CCVP 4PV1C 2N98A 2WT7B 2G3AA 2E74D 2BQ1E 3NFQA 4IL6H 2WTYA 4PD4D 1SFCA 2L6EA 2FXOA 4I7ZC 3TNUA 3W68A 2OARA 3G3ZA 2PAJA 4EYYQ 2FXMA 2Q9IA 1DD3A 1NTMD 4RJTA 1T6AA 1EXJA 3AE4C 1FZCB 1VQNP 3A7OA 3HD7D 3O6QB 2JU2A 5HVCA 4WWIA 1LWUB 3G26A 3Q5SA 3T97A 2KODA 1DNYA 2KB7P 2MR7A 1RNIA 1QX8A 1FZGA 3Q5PA 2E75C 3CPWO 1HGVA 2BCCG 1GL2C 5CCGA 2O01H 2WSCH 4BWNA 2HODB 1JOCA 1EOQA 1KYOE 3OJAB 5AW8B 4L73A 4LC1A 3RBZA 5CJ4A 2PEMA 3L73G 3FWLA 4XFJA 1KQSO 2GZJA 3BCCE 1ZXGA 2KZIA 1BCCG 3AE6C 1KB9I 1QGKB 3WU2H 5DJUB 1KMIZ 1MUUA 1FJKA 2CGQA 2JDIH 1KN7A 3O6QA 3L71D 1SQVG 3EFFK 3V2QA 1VQMP 3VP8A 1LTTC 2XDJA 3A0BE 3GJNA 1DV5A 1BE3E 3CLQA 4H44D 2OYHA 5AVVB 2K9YA 1BGYG 1NQ4A 1RF1B 4RESB 3KPEA 3VMXA 5KLVJ 3BATA 1KTMA 3CXHH 1N7SA 2JBGA 1HTLC 1UIXA 1H0TA 1Z6MA 3L74G 5DCKA 1N7SD 1GPJA 1FDIA 1L2PA 4OGQC 2PEOA 3H6PA 5APWA 1L0LJ 3AE5C 3H1JE 1YBKA 1NU1G 3QWOC 1BXIA 2GZIA 3MUDC 3Q2YA 3CX5E 2WPQA 5GTHH 4GR6A 4BPGA 1AJYA 1YITP 2LIWA 1EZVE 3GLMA 5KLVE 2KS1A 4NPEA 2Q5UA 1FDMA 2AFDA 1PV3A 3RG6C 1EZVD 2KG9A 4NPDA 3HRNA 2WMMA 2ZT9D 4QNBA 3S4RA 1SQXG 4XFZA 2XZRA 3H1HE 1KILE 1JY3P 2FY8A 1SQQK 2JJLA 4GR2A 2YMYA 1FZEA 1KQLA 1NTMK 2V4HA 2N1TA 3BCCJ 4H2YC 4UB6E 3B71A 3B4QA 1Q86Q 4PJ0E 5H2FE 3RK2D 1A43A 4HKZH 3H1KJ 1NTKG 2MVUA 4H2WC 4HKGA 1YQ3C 2Y0CA 2I8DA 2HFED 1SQQJ 1PIXA 5L8RJ 2C9LY 4Y28J 1E0HA 2M5RA 5BU8B 3G1GA 3H32B 3G28A 1L0NK 2POHA 3QH9A 4JYCA 2LIUA 5AVZB 3P8CE 4I2LC 1W5CE 4KHXA 2WPSA 2LKIA 2XXMA 5APXA 4PH1A 4OVNF 2WWWA 4WBAA 1KILC 1MZ8A 1IMPA 2QNWA 5B5EH 1PEQA 3HE4A 4IFDK 1AFOA 2NZ2A 1M8OB 2GZGA 1NTZJ 3MZWB 1N73C 3JCUE 5H2FH 2K1AA 5HGLA 1FC2C 3VRLC 1X79B 1FDOA 1LT9A 4M3LA 3BRTB 2Z45A 2VLQA 3GHGA 1RY3A 4IL6X 3MGNA 1SVFA 1X22A 4GKGA 2NPSD 2ZVOB 3L71G 2Q3EA 3H25A 4IPYA 5AW6B 2IFMA 1RQUA 1A02J 4COCA 1RE4A 4LGDE 3V4QA 4DJGA 3H1LD 4JBZA 1WRGA 4YXWH 2FYZA 1ZP0C 1AA0A 3L74J 1NOHA 4YTPC 1M90Q 1KB9E 4PD4E 2FFDC 1JEKA 1L4AB 2Y9ZA 1Q7YQ 3V5BA 2IBZG 3GHGC 4F37A 2KNCA 3CE7A 4N3YB 3CC2P 4ZKUA 3A0HE 2Z5IA 5KLVK 1RF1A 2IBZE 4UB8E 2N6YA 2M8RA 1IK7A 1RHZB 4XFYA 1N8RQ 4HB1A 1YTZT 3VMAA 2RN0A 1VF5B 3SSUA 2N5HA 1ZLLA 1JMMA 4WYMA 3PTZA 1LTGC 1OVUA 1A8OA 1Y47A 2AF8A 3CCRP 3NXSA 1L0NE 3TGUE 1M56D 1VKUA 3IN6A 2M8LA 3P05A 1L0NG 3TGUG 5KKZC 4MN4C 1ACPA 3FXDA 2YKPA 3E1IA 1RH5B 4U3FD 3GMAA 4U3FG 3AEEC 2L5GB 1W2EA 3RK2C 1PFIA 2MY5A 1LNQA 3WUUA 1G2CB 1PGPA 1L0ND 4IOIH 1RE3A 3TGUD 3N7NA 4H44B 3GZMA 3DS5A 1SQPG 3U1AA 5AVTB 1SQVE 2Z4EA 4XRQA 5C39A 2JYLA 2KOOA 3P8CD 5AVUB 1UJZA 2JYGA 2ONTA 2WSFJ 3D71A 1R8EA 2XV6A 1SS1A 1TU3F 2J59M 1L4AA 1FZCA 1CW5A 4H44C 3EJDA 2JQ4A 1LTJC 4JPZB 5CJ0A 2H43A 3L74E 4M0IA 1WT6A 3TNUB 2YXRB 1VQ5P 3C1LA 1VQPP 5CMZA 3PHLA 4BPHA 2M3BA 2ZXXA 3SWFA 3KXDA 1N7SC 3P8MC 3GF3A 1K8AQ 1FZBA 4DG9A 2ZYDA 3U43A 1BCCE 1KFNA 1URQD 3NTNA 2Q1KA 3H1HD 1LP1A 4IL6E 1PEUA 1OVVA 3CX5I 4U7JA 2IFNA 3CCLP 1OZHA 3L70G 1J1DB 3PJSK 1M1JC 3R2PA 3SWKA 4DOJA 5B66H 1VDFA 3RL0C 1KZUB 1H89A 4PWVB 1BSHA 5HGOA 2FADA 2GUSA 1M57D 2N50A 1VHNA 2HG5D 4DT0A 1T8KA 2BUOA 3H1LJ 3CWBG 3SWYA 1ZOYC 1EQ7A 1SQVK 2PEKA 1S5LX 1YI2P 5APVA 3RL0g 1E79H 3U59A 1VQ8P 1L0LG 3S1KA 2KOGA 1FU1A 2Z44A 2HYNA 3G21A 2RH0A 1GXGA 1SQBE 1KFMA 2WSCJ 2KORA 2A06D 2WSEH 1VQ4P 3IFMA 5TISH 1NYHA 4ASVA 2V7QH 1JY3O 2KGDA 2K9JB 1MFTA 3AEGC 4W80A 4B86A 2O01N 3G9RA 1JB0J 2XKMA 2ZJSE 1H0TB 1L0HA 2MVVA 2GZFA 2XV5A 5CZDB 1AV1A 3H1HG 2JO1A 1U57A 2ITAA 2BCCE 1USDA 2BASA 1GK6A 2ROQA 2AXTE 3DS4A 2AEJA 2ZVNB 2P1JA 4OGQD 2Y0EA 1S2EA 2WSEJ 2KOPA 1JY2N 2ZFCA 3C8VA 1RQVA 5KP8B 1GL2A 1PP9E 5KAIH 1IJDB 1NTKK 3GHGB 1AF8A 4JYBA 3HE5B 3AE3C 2YIUB 1URQA 4D6TE 2YO2A 3KDPB 1HJ0A 4BPFA 1YTZI 3H1KD 2EFJA 2GA1A 2YMKA 2YXQB 2H7HA 4TT3H 2LXCB 2CWOA 4XFXA 2KIKA 1PL5A 3BVHA 3L75G 1VL2A 2R3SA 4Y99B 5AVXB 1SQQD 2C0XA 1NTME 1L0IA 1YJWP 3B8EB 1JO5A 3Q20A 2FVEA 3R4YA 3CCEP 1RF0C 3LRYA 1SQXK 2E75D 2YO3A 2FVFA 1SQQE 1R5LA 2HPCB 1GU4A 5E79E 1JTHA 3JC22 1DEEG 2GM4A 1QL1A 2E76B 3H1KE 2P9XA 1S5LE 3TDKA 2N6ZA 4D6TD 4NPFX 1LTAC 4K3AA 3CWBD 3H0DA 2VRSA 3KZIH 1PP9D 2D2CC 3M9HA 3TSIA 2DNWA 1JCCA 2GDXA 5EW5E 1IFMA 1SLQA 5EJDA 2E74B 3WUVA 2A45G 3CMEP 3EJBA 1SQVD 4ZKPA 1AVOA 1BCCJ 2NPSB 1N86A 1S9KE 2QJYB 4L75A 5E79H 1ZR4A 1IFJA 4GDOA 3AECC 3LIEA 1FR2A 4R0MA 3M91A 3OA7A 1HY8A 2YNYA 4WY4C 3KYQA 2E5TA 4OH8B 4U0DA 4R4LA 1AVYA 3I55P 3M0DA 3MIWA 2BCCJ 2HODA 1ZR2A 1NTZG 1FOSF 3A3YB 2WPVB 1T3UA 3D6YA 1LTJB 1IFDA 1KORA 3CC4P 1Q2NA 1KYOI 2LL8A 1Y9BA 1FS0E 3DS0A 1EXIA 4HH2A 3CD6P 3CC7P 3E1RA 2KG6A 3HTKB 1DD4A 2O1KA 3CCJP 2H8PD 3EWKA 2E43A 1ZMEC 2YIUC 1NVOA 2Z46A 2FACA 2JB0A 3E2DA 3AEFC 3D70A 3KHUA 5CCHD 1KC8Q 2R32A 5AW4B 1FOSE 3CI9A 1SQPD 2QSIA 4WY4A 3VYIA 4WY4B 1NTKJ 1OW6A 2KI7B 1G1IA 1N2DC 1AUMA 4WB4A 1N7SB 2OYOA 2P2UA 5HV8A 3H1IG 3JSVC 2K2QA 5KAIE 2M5AB 3BCCG 4D6TJ 2KGCA 4H13C 2E1MA 2JGPA 4LLHA 3IR9A 3H47A 5M1BA 3CX5H 3CCMP 4PH0A 1OW7A 5JPAA 2DW3A 5KP7B 4EOTA 5CBNA 3EJEA 1BE3G 4K35A 1N73A 2A45H 3L75J 3RL0D 4PXHB 3B5NB 3W67A 3E7KA 1MV8A 1DIPA 2XNXA 1EDLA 1RO0A 3DS2A 2XZ0D 1PPJG 2B88A 3RK3E 2GUVA 1QEXA 2XNDH 3V4WA 2OTKE 2CPSA 2GZEA 5GTIH 5BS2A 3HYBA 1PEOA 5KLIB 1YHQP 1JMBA 2JEEA 3RGUA 3RK3C 2LMLA 2W83C 3RK3B 2FYNC 2K5XA 2K37A 4PV1D 1M1JB 3L70E 3GG2A 1EZVG 3D6ZA 1RF1C 5KLVG 3AE7C 4QMAA 2QA4P 1KQFB 1SP4A 3H1HJ 5AW3B 3V6IA 1NKNA 1HWTC 1JTHB 3HD7A 3L73E 4U3FE 1Q82Q 3L72E 3TF5A 5KP6B 5DJTB 3B5IA 2JKVA 5KKZB 3CWBE 4U0AA 1EZVI 2KSJA 4CA3A 2PEQA 2KYVA 1BE3J 1IFIA 1JJ2O 1OVRA 3ABVC 1LT9B 2JP3A 1NJIQ 2QVAA 1GL2D 4PJ0H 5AW9B 3NTEA 1M7LA 1NH4A 2C0WA 3HUSC 4U0BA 1URQC 2FYNB 4D6TG 2LPKA 3VOPA 3H1IJ 1P84I 3L75E 2B9BA 3LMOA 1BSNA 3L75D 2CK3H 4HJGH 2LTEA 2M5AA 2VLOA 1JNMA 3HD7B 1F80D 1H88A 2PY8A 3H1JG 2VLNA 1YJNP 1NTZK 1GD2E 1OXZA 5CCGC 4MRTC 3MD0A 2K9JA 1ZN5A 4W7YA 2VSQA 3O8ZA 4H13D 1LT9C 4H0LD 5AVSB 3CCQP 2BCCD 2KOSA 2GDYA 3BRVB 2AEMA 2J58A 3WBHA 2N9BA 1SQXD 2CNRA 3CCUP 3L71E 3P32A 1NKZB 3RL0B 2M8NA 3EQ2A 3VN0A 1EDJA 5APTA 2E76C 3L72J 2JU1A 2JR8A 1NTMG 3IAOA 2P67A 4I1LA 3M1MA 1BGYE 2UWJE 1RO2A 1FE6A 3L35A 7CEIA 4JF7A 1OIPA 1SQPJ 2QJPC 1D7MA 2E75B 1R5SA 1GW3A 3RK2B 2N1TD 3M0AA 3A0HH 3RK3D 3II6A 1LTIC 4N6JA 4PV1B 5CCHA 1CZQA 4COPA 2CPBA 3PLNA 2W27A 2A06G 1NGMB 1M6EX 1K04A 5AVYB 1LTSC 2A06E 2R5BA 2WSFH 3G29A 2KNCB 2K94A 2W8ZA 3PP5A 3CXCO 2PEIA 3AEAC 5AW0B 5KJ7A 2E76D 2K88A 2LKMA 2K0YA 4QKOA 3AE8C 3B5ND 1HBWA 4GIFA 2N1TB 1BCCD 4GODA 3L71J 2QRXA 5AVQB 2FXPA 2Z5HA 1S72P 2G8YA 2IBZI 4UHPB 1NAYA 2K0XA 1KILB 1VF5C 5KLVD 3S9OA 2FFDB 4I6MC 1N7LA 2N1TC 3CX5D 1J1EB 1JCDA 1LJ2A 4PD4I 3CMAP 5BVZA 3Q5RA 2X2BA 2PFXA 2EG5A 2P10A 5APUA 2KUBA 2KOQA 2R3CA 3NMDA 4JQ0D 2OYIA 1IFNA 2W90A 2K3RA 1ZMBA 4TLFA 1EDIA 2FYUK 3KZIE 2DGYA 1OWAA 3DPHA 2LR2A 1NHLA 5AW7B 2M0BA 2FKWB 4XE5B 1QL2A 3ITKA 1YJ9P 1S5LH 1H8AA 1M6NA 3B5NA 2W6JH 2KS1B 2K92A 3G71P 1NTMJ 2QJPB 3H4EA 2LXBA 4DCKA 3H1IE 1RF0A 4H0LB 3HZQA 1MZ9A 1HH0A 1K05A 3G4SP 1BE3D 1DEBA 1M1KQ 1VQLP 2B87B 3FWNA 2QJYC 4YXDC 5CBOA 2KLUA 4U0CA 2D2CB 1GU5A 4A7PA 2IYPA 5EFWB 1S9KD 4NEOA 4ZMDA 1J1EC 4IFFA 1VQ9P 3BCCD 3M9QA 2CG5B 4OWFA 1ZNVA 5BS1A 3AE2C 2XU6A 1OX3A 2EHSA 5AVRB 5F2OA 1EC5A 2BEQD 1SFCC 5AW5B 5HGNA 5CCHC 1MFZA 1RE3C 1OW8A 1X8YA 3RBXA 5AVWB 3F89A 2WPRA 2L0QA 2PNGA 2PP6A 1L0LE 2MJZA 2NO8A 2KWLA 3L70J 1GW4A 4L74A 3GW6A 2AVAA 4IZ6A 2L9FA 2W6AA 3MHVA 2AFEA 1EIAA 1FZAA 2HLOA 2IDBA 3H1LE 2YKQA 3FXEA 2IBZD 3CWBJ 4BXLA 2R5DA 4DZOA 3H1LG 1ZRTE 4ASWA 1Z56A 4GOEA 1SQBK 4H2XC 2Q3IA 1SQXJ 4OGQB 1K30A 1SQPK 3M0DC 2Q6QA 1KILA 3K5BA 1KB9D 2EHTA 1BDCA 2MD9A 3I56P 1HVVA 2YKOA 3MTUE 2KG8A 2IZ1A 5B66E 5KAFH 1PPJD 2ZYAA 3SFEC 1K9MQ 2JWDA 2WITA 1PEMA 1SQVJ 2WPTA 2FAEA 2PRRA 2KXPB 2P58A 2K93A 1M1JA 5CCGD 3HUSB 3WU2E 2L22A 3A2AA 5F2KA 1ZV8A 3WMM0 2CQ8A 2OYHC 2QJKC 4BRYB 2WQYC 1PP9G 4W7ZA 1IMQA 2KR5A 4BRYA 4AUWA 2ZXEB 4WY4D 2M3EA 3WUTA 2KGAA 2QE7H 2I1JA 4U3FJ 3LW5H 1DX7A 1E5WA 3I5CA 3L37A 3FGAD 1YYCA 2WT7A 1A02F 2OYHB 1IFPA 4Z1MH 2O01J 1QRJA 1L0NJ 3TGUJ 2I1KA 1GK4A 2NRGA 1KLPA 3H1ID 2B87A 3DS3A 1S1CX 1LGHB 2Q7CA 3L36A 2ERHA 5CHXA 4U0EA 1L4AC 5AW1B 1HQBA 3MGEA 1SQBD 2R44A 2NPSA 1PZQA 2KLVA 3GKLC 2FVAA 4I7ZB 5GTIE 1X9VA 1X0TA 1IK9A 1KD1Q 1LTBC 2JWAA 3AE1C 4XROA 2Y9YA 1KILD 1GDTA 1X3OA 2ZYGA 3L73J 1NTKD 1JM0A 2AEFA 3ZDMA 3LW5J 5APYA 2MKVA 1SQXE 4ZNCA 2O3JA 3NY7B 3UIAA 3H32A 2VLPA 3DTJA 1M74A 1NTZD 5HGMA 1SFCB 1PP9J 2IPPA 4C7NA 2MF4A 4GOFA 4C7NB 1VQOP 2QIWA 2BEZF 3H1JD 5APQA 1EMVA 4RKUJ 3TK1A 1T3JA 1P84D 1U7MA 3P7KA 1L0LK 1NAFA 1CI6A 1AQTA 1IO4A 1CSBA 1ZW0A 3HD7C 3L4FA 4UB8H 4H0LC 2ZAEB 3HE5A 1Y8AA 1CEIA 2IX7C 2QM7A 1HF9A 3L74D 1FAVA 1NU1D 3VMZA 3PH0A 2L4BA 3B4SA 4PD4H 2FYUJ 1LT1A 2XZ1C 1T8ZA 1OMIA 2KGEA 1WMKA 3CCSP 1LTJA 2QG4A 2FQ2A 2AXTH 4EDFA 1IZNB 3PRJA 1GTWA 2B89A 2OYIC 2OTLP 1RE4C 1KQGB 2QM8A 1FJPA 5I4TG 1BGYD 1N73B 2W6BA 1YQ4C 4Y99C 2HR3A 1KYOH 1KB9H 1QLED 2KZJA 1SQQG 2OGUA 3TYYA 1Q81Q 4H13B 4RO0A 1Q90D 4R4MA 2OQQA 1D1DA 1FZFA 3G0VA 1EDKA 1KYOD 3L73D 2E42A 2FQ1A 1VQKP 2P7JA 1MKMA 3H1KG 1VPCA 3AEDC 5F2NA 2ZT9B 1J1DC 2KW2A 5BU5A
chains in the Genus database with same CATH topology
2XV6A 2PEIA 1M90Q 3E2DA 2BQ1E 1KC8Q 2QEXP 1VQOP 1Q7YQ 5F2KA 2L6EA 1VQ9P 1BAJA 2P9XA 4M0IA 2QA4P 3CCQP 2OARA 1VQ5P 1VQPP 1QVGO 5BS1A 3CC2P 3G1GA 3G28A 2BHVA 1E6JP 5DCKA 1AUMA 3WBHA 3H0DA 5F2OA 2EIAA 1S72P 3OW2O 1Q82Q 4XFYA 1N8RQ 5HGNA 1IUQA 2XXMA 3CCUP 3B5IA 2XT1A 4PH1A 1K8AQ 2PEOA 2PENA 2M8NA 4U0AA 1QVFO 1VQNP 4WYMA 2E1MA 3CMEP 3H47A 2PEQA 1PEQA 1A8OA 3G26A 3DS4A 2JO0A 1JJ2O 1QRJA 2KODA 3CCRP 1NJIQ 1PEUA 1RNIA 3CMAP 3DS3A 2OTJP 4GR6A 3CCMP 3CPWO 4PH0A 1K73Q 3CCLP 2EG5A 3M1MA 5JPAA 3NTEA 2M8LA 1YITP 1RO2A 3P05A 4U0EA 5HGLA 3CCSP 4U0BA 3DS1A 1VQ7P 3MGEA 3VRLC 1EIAA 4U0FA 1EOQA 1ZMBA 3RG6C 2Z45A 5HGOA 4U0DA 2DGYA 2PEMA 3G1IA 3DPHA 1W2BO 4QNBA 1VQ6P 1KD1Q 3I55P 2PEJA 2OTLP 1YJ9P 1RO0A 4XFZA 2BUOA 1M6NA 3DS2A 4XROA 5I4TG 1KQSO 2EFJA 1K30A 3G71P 2PEKA 2CWOA 3H4EA 4IPYA 4XFXA 4COPA 1YI2P 3CC4P 4GR2A 3DS0A 1YIJP 4COCA 3HZQA 3CD6P 3CC7P 3DS5A 3G4SP 1VQ8P 1M6EX 5BS2A 3G6EP 3HYBA 2LF4A 3I56P 1YJWP 2Z44A 2PY8A 4XRQA 1Q81Q 1PEOA 2JYLA 3Q20A 1D1DA 1M1KQ 3G0VA 3CCJP 3G21A 1YHQP 1VQLP 1YJNP 1Q86Q 1VQKP 3CCEP 2JYGA 3LRYA 3DTJA 2ONTA 4U0CA 1M74A 2M8PA 2Z46A 5F2NA 1VQMP 1A43A 1K9MQ 1VQ4P 1PEMA 5HGMA 3CCVP 3CXCO 3G29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 P;  1M90 Q;  3CCU P;  1YI2 P;  3CC4 P;  1K8A Q;  3CCS P;  1KC8 Q;  1VQ7 P;  2QEX P;  1YIJ P;  1QVF O;  1VQN P;  3CD6 P;  1VQO P;  1Q7Y Q;  3CC7 P;  3G4S P;  1VQ8 P;  3CME P;  3G6E P;  1VQ9 P;  3I56 P;  2QA4 P;  1YJW P;  1Q81 Q;  3CCQ P;  1JJ2 O;  1W2B O;  1VQ5 P;  1M1K Q;  3CCJ P;  1VQP P;  1YHQ P;  1QVG O;  1VQL P;  3CC2 P;  1VQ6 P;  3CCR P;  1KD1 Q;  1YJN P;  1Q86 Q;  1NJI Q;  3I55 P;  1VQK P;  3CCE P;  2OTL P;  3CMA P;  2OTJ P;  1YJ9 P;  3CCM P;  3CPW O;  1VQM P;  1S72 P;  3OW2 O;  1Q82 Q;  1K73 Q;  1K9M Q;  3CCV P;  1VQ4 P;  3CXC O;  1N8R Q;  1KQS O;  3CCL P;  1YIT P; 
#chains in the Genus database with same CATH topology
 1DH3 A;  1G1J A;  1GMJ A;  2QEX P;  1FBM A;  5KTB A;  3CXH I;  1BAJ A;  2IYO A;  3V2R A;  2WVR A;  4EI2 A;  3Q1M A;  2GDW A;  2O1J A;  1QVG O;  2H88 C;  5APS A;  2D2C D;  1E6J P;  2WZ7 A;  1PGQ A;  5K5G B;  2EIA A;  3FX0 A;  3KQG A;  1NU1 K;  3SFD C;  4GT1 A;  2LOL A;  2E74 C;  1UNK A;  2XT1 A;  1L4A D;  3BAS A;  3H1J J;  1PPJ E;  2PGD A;  3MUD A;  1QVF O;  3USS A;  1NWQ A;  1SQB G;  1KV4 A;  1IC2 A;  3N4X A;  4YPC A;  5KAF E;  2OTJ P;  3Q3D A;  1NU1 E;  3HTK A;  5KJ7 D;  1T2K C;  2FQ0 A;  2N9Y B;  2ZT9 C;  1VF5 D;  1J2J B;  2RMZ A;  1AQ5 A;  1NU1 J;  1ZRT D;  1VQ7 P;  1USE A;  4AQR D;  1LP1 B;  1G2C A;  2A45 I;  3CL3 D;  4UB6 H;  1W2B O;  1BDD A;  1JY2 P;  1VQ6 P;  1P84 E;  5AW2 B;  2J5U A;  2JAZ A;  4L76 A;  1GXH A;  2C9N Y;  1HGZ A;  4WVZ A;  2FHS C;  1YIJ P;  2KP8 A;  1L0L D;  3G6E P;  1OFC X;  1UII A;  3V2N A;  2RKL A;  1JY2 O;  1LWU A;  4N78 E;  1NTZ E;  1BGY J;  2KK7 A;  2N5I A;  2GYK A;  2M8P A;  3IF4 A;  4CPG A;  1S3J A;  2AXC A;  2SPZ A;  3L72 D;  1XTG B;  1SQP E;  1U7J A;  1PGO A;  1SQB J;  3HUS A;  5GTH E;  1GZL A;  1NTK E;  4XA4 A;  3V2P A;  1JY3 N;  3VP9 A;  1FZC C;  2H89 C;  1JUN A;  5KJ7 C;  1T2K D;  2BHV A;  3L70 D;  3A5T A;  3AE9 C;  3OW2 O;  2V7Q J;  1IUQ A;  3AEB C;  2HPC A;  2PEN A;  2FYU D;  2IZ0 A;  1HJB A;  3CXH E;  2FBW C;  1LWU C;  2JO0 A;  3U1C A;  1SFC D;  5TJH A;  1AYI A;  2FYU G;  3MP7 B;  1K73 Q;  5TIS E;  4AYC A;  1GL2 B;  3CXH D;  4C46 A;  1OR5 A;  3JCU H;  3A0B H;  2FYU E;  1S4X A;  3DS1 A;  1URQ B;  4U0F A;  2MR8 A;  2KSE A;  3GZL A;  3B5N C;  3OAK A;  4N78 D;  1NO4 A;  4EIJ A;  2QJK B;  3G1I A;  3RG2 A;  2L91 A;  1PGJ A;  4HYT B;  5B5E E;  3EFG A;  2PEJ A;  3GF7 A;  2NPS C;  2K0D X;  2OYI B;  1HUC A;  1P84 H;  1CI6 B;  3M9B A;  4KT0 J;  4C7R A;  3C9I A;  3L72 G;  4O9B A;  2E5Y A;  1XTC C;  2Y0D A;  3LID A;  3T97 B;  2LF4 A;  3HE4 B;  3VTP C;  2FFD A;  3M06 A;  2WSS H;  4KJM A;  3VMY A;  5KLI C;  3F5H A;  4IFM A;  3CCV P;  4PV1 C;  2N98 A;  2WT7 B;  2G3A A;  2E74 D;  2BQ1 E;  3NFQ A;  4IL6 H;  2WTY A;  4PD4 D;  1SFC A;  2L6E A;  2FXO A;  4I7Z C;  3TNU A;  3W68 A;  2OAR A;  3G3Z A;  2PAJ A;  4EYY Q;  2FXM A;  2Q9I A;  1DD3 A;  1NTM D;  4RJT A;  1T6A A;  1EXJ A;  3AE4 C;  1FZC B;  1VQN P;  3A7O A;  3HD7 D;  3O6Q B;  2JU2 A;  5HVC A;  4WWI A;  1LWU B;  3G26 A;  3Q5S A;  3T97 A;  2KOD A;  1DNY A;  2KB7 P;  2MR7 A;  1RNI A;  1QX8 A;  1FZG A;  3Q5P A;  2E75 C;  3CPW O;  1HGV A;  2BCC G;  1GL2 C;  5CCG A;  2O01 H;  2WSC H;  4BWN A;  2HOD B;  1JOC A;  1EOQ A;  1KYO E;  3OJA B;  5AW8 B;  4L73 A;  4LC1 A;  3RBZ A;  5CJ4 A;  2PEM A;  3L73 G;  3FWL A;  4XFJ A;  1KQS O;  2GZJ A;  3BCC E;  1ZXG A;  2KZI A;  1BCC G;  3AE6 C;  1KB9 I;  1QGK B;  3WU2 H;  5DJU B;  1KMI Z;  1MUU A;  1FJK A;  2CGQ A;  2JDI H;  1KN7 A;  3O6Q A;  3L71 D;  1SQV G;  3EFF K;  3V2Q A;  1VQM P;  3VP8 A;  1LTT C;  2XDJ A;  3A0B E;  3GJN A;  1DV5 A;  1BE3 E;  3CLQ A;  4H44 D;  2OYH A;  5AVV B;  2K9Y A;  1BGY G;  1NQ4 A;  1RF1 B;  4RES B;  3KPE A;  3VMX A;  5KLV J;  3BAT A;  1KTM A;  3CXH H;  1N7S A;  2JBG A;  1HTL C;  1UIX A;  1H0T A;  1Z6M A;  3L74 G;  5DCK A;  1N7S D;  1GPJ A;  1FDI A;  1L2P A;  4OGQ C;  2PEO A;  3H6P A;  5APW A;  1L0L J;  3AE5 C;  3H1J E;  1YBK A;  1NU1 G;  3QWO C;  1BXI A;  2GZI A;  3MUD C;  3Q2Y A;  3CX5 E;  2WPQ A;  5GTH H;  4GR6 A;  4BPG A;  1AJY A;  1YIT P;  2LIW A;  1EZV E;  3GLM A;  5KLV E;  2KS1 A;  4NPE A;  2Q5U A;  1FDM A;  2AFD A;  1PV3 A;  3RG6 C;  1EZV D;  2KG9 A;  4NPD A;  3HRN A;  2WMM A;  2ZT9 D;  4QNB A;  3S4R A;  1SQX G;  4XFZ A;  2XZR A;  3H1H E;  1KIL E;  1JY3 P;  2FY8 A;  1SQQ K;  2JJL A;  4GR2 A;  2YMY A;  1FZE A;  1KQL A;  1NTM K;  2V4H A;  2N1T A;  3BCC J;  4H2Y C;  4UB6 E;  3B71 A;  3B4Q A;  1Q86 Q;  4PJ0 E;  5H2F E;  3RK2 D;  1A43 A;  4HKZ H;  3H1K J;  1NTK G;  2MVU A;  4H2W C;  4HKG A;  1YQ3 C;  2Y0C A;  2I8D A;  2HFE D;  1SQQ J;  1PIX A;  5L8R J;  2C9L Y;  4Y28 J;  1E0H A;  2M5R A;  5BU8 B;  3G1G A;  3H32 B;  3G28 A;  1L0N K;  2POH A;  3QH9 A;  4JYC A;  2LIU A;  5AVZ B;  3P8C E;  4I2L C;  1W5C E;  4KHX A;  2WPS A;  2LKI A;  2XXM A;  5APX A;  4PH1 A;  4OVN F;  2WWW A;  4WBA A;  1KIL C;  1MZ8 A;  1IMP A;  2QNW A;  5B5E H;  1PEQ A;  3HE4 A;  4IFD K;  1AFO A;  2NZ2 A;  1M8O B;  2GZG A;  1NTZ J;  3MZW B;  1N73 C;  3JCU E;  5H2F H;  2K1A A;  5HGL A;  1FC2 C;  3VRL C;  1X79 B;  1FDO A;  1LT9 A;  4M3L A;  3BRT B;  2Z45 A;  2VLQ A;  3GHG A;  1RY3 A;  4IL6 X;  3MGN A;  1SVF A;  1X22 A;  4GKG A;  2NPS D;  2ZVO B;  3L71 G;  2Q3E A;  3H25 A;  4IPY A;  5AW6 B;  2IFM A;  1RQU A;  1A02 J;  4COC A;  1RE4 A;  4LGD E;  3V4Q A;  4DJG A;  3H1L D;  4JBZ A;  1WRG A;  4YXW H;  2FYZ A;  1ZP0 C;  1AA0 A;  3L74 J;  1NOH A;  4YTP C;  1M90 Q;  1KB9 E;  4PD4 E;  2FFD C;  1JEK A;  1L4A B;  2Y9Z A;  1Q7Y Q;  3V5B A;  2IBZ G;  3GHG C;  4F37 A;  2KNC A;  3CE7 A;  4N3Y B;  3CC2 P;  4ZKU A;  3A0H E;  2Z5I A;  5KLV K;  1RF1 A;  2IBZ E;  4UB8 E;  2N6Y A;  2M8R A;  1IK7 A;  1RHZ B;  4XFY A;  1N8R Q;  4HB1 A;  1YTZ T;  3VMA A;  2RN0 A;  1VF5 B;  3SSU A;  2N5H A;  1ZLL A;  1JMM A;  4WYM A;  3PTZ A;  1LTG C;  1OVU A;  1A8O A;  1Y47 A;  2AF8 A;  3CCR P;  3NXS A;  1L0N E;  3TGU E;  1M56 D;  1VKU A;  3IN6 A;  2M8L A;  3P05 A;  1L0N G;  3TGU G;  5KKZ C;  4MN4 C;  1ACP A;  3FXD A;  2YKP A;  3E1I A;  1RH5 B;  4U3F D;  3GMA A;  4U3F G;  3AEE C;  2L5G B;  1W2E A;  3RK2 C;  1PFI A;  2MY5 A;  1LNQ A;  3WUU A;  1G2C B;  1PGP A;  1L0N D;  4IOI H;  1RE3 A;  3TGU D;  3N7N A;  4H44 B;  3GZM A;  3DS5 A;  1SQP G;  3U1A A;  5AVT B;  1SQV E;  2Z4E A;  4XRQ A;  5C39 A;  2JYL A;  2KOO A;  3P8C D;  5AVU B;  1UJZ A;  2JYG A;  2ONT A;  2WSF J;  3D71 A;  1R8E A;  2XV6 A;  1SS1 A;  1TU3 F;  2J59 M;  1L4A A;  1FZC A;  1CW5 A;  4H44 C;  3EJD A;  2JQ4 A;  1LTJ C;  4JPZ B;  5CJ0 A;  2H43 A;  3L74 E;  4M0I A;  1WT6 A;  3TNU B;  2YXR B;  1VQ5 P;  3C1L A;  1VQP P;  5CMZ A;  3PHL A;  4BPH A;  2M3B A;  2ZXX A;  3SWF A;  3KXD A;  1N7S C;  3P8M C;  3GF3 A;  1K8A Q;  1FZB A;  4DG9 A;  2ZYD A;  3U43 A;  1BCC E;  1KFN A;  1URQ D;  3NTN A;  2Q1K A;  3H1H D;  1LP1 A;  4IL6 E;  1PEU A;  1OVV A;  3CX5 I;  4U7J A;  2IFN A;  3CCL P;  1OZH A;  3L70 G;  1J1D B;  3PJS K;  1M1J C;  3R2P A;  3SWK A;  4DOJ A;  5B66 H;  1VDF A;  3RL0 C;  1KZU B;  1H89 A;  4PWV B;  1BSH A;  5HGO A;  2FAD A;  2GUS A;  1M57 D;  2N50 A;  1VHN A;  2HG5 D;  4DT0 A;  1T8K A;  2BUO A;  3H1L J;  3CWB G;  3SWY A;  1ZOY C;  1EQ7 A;  1SQV K;  2PEK A;  1S5L X;  1YI2 P;  5APV A;  3RL0 g;  1E79 H;  3U59 A;  1VQ8 P;  1L0L G;  3S1K A;  2KOG A;  1FU1 A;  2Z44 A;  2HYN A;  3G21 A;  2RH0 A;  1GXG A;  1SQB E;  1KFM A;  2WSC J;  2KOR A;  2A06 D;  2WSE H;  1VQ4 P;  3IFM A;  5TIS H;  1NYH A;  4ASV A;  2V7Q H;  1JY3 O;  2KGD A;  2K9J B;  1MFT A;  3AEG C;  4W80 A;  4B86 A;  2O01 N;  3G9R A;  1JB0 J;  2XKM A;  2ZJS E;  1H0T B;  1L0H A;  2MVV A;  2GZF A;  2XV5 A;  5CZD B;  1AV1 A;  3H1H G;  2JO1 A;  1U57 A;  2ITA A;  2BCC E;  1USD A;  2BAS A;  1GK6 A;  2ROQ A;  2AXT E;  3DS4 A;  2AEJ A;  2ZVN B;  2P1J A;  4OGQ D;  2Y0E A;  1S2E A;  2WSE J;  2KOP A;  1JY2 N;  2ZFC A;  3C8V A;  1RQV A;  5KP8 B;  1GL2 A;  1PP9 E;  5KAI H;  1IJD B;  1NTK K;  3GHG B;  1AF8 A;  4JYB A;  3HE5 B;  3AE3 C;  2YIU B;  1URQ A;  4D6T E;  2YO2 A;  3KDP B;  1HJ0 A;  4BPF A;  1YTZ I;  3H1K D;  2EFJ A;  2GA1 A;  2YMK A;  2YXQ B;  2H7H A;  4TT3 H;  2LXC B;  2CWO A;  4XFX A;  2KIK A;  1PL5 A;  3BVH A;  3L75 G;  1VL2 A;  2R3S A;  4Y99 B;  5AVX B;  1SQQ D;  2C0X A;  1NTM E;  1L0I A;  1YJW P;  3B8E B;  1JO5 A;  3Q20 A;  2FVE A;  3R4Y A;  3CCE P;  1RF0 C;  3LRY A;  1SQX K;  2E75 D;  2YO3 A;  2FVF A;  1SQQ E;  1R5L A;  2HPC B;  1GU4 A;  5E79 E;  1JTH A;  3JC2 2;  1DEE G;  2GM4 A;  1QL1 A;  2E76 B;  3H1K E;  2P9X A;  1S5L E;  3TDK A;  2N6Z A;  4D6T D;  4NPF X;  1LTA C;  4K3A A;  3CWB D;  3H0D A;  2VRS A;  3KZI H;  1PP9 D;  2D2C C;  3M9H A;  3TSI A;  2DNW A;  1JCC A;  2GDX A;  5EW5 E;  1IFM A;  1SLQ A;  5EJD A;  2E74 B;  3WUV A;  2A45 G;  3CME P;  3EJB A;  1SQV D;  4ZKP A;  1AVO A;  1BCC J;  2NPS B;  1N86 A;  1S9K E;  2QJY B;  4L75 A;  5E79 H;  1ZR4 A;  1IFJ A;  4GDO A;  3AEC C;  3LIE A;  1FR2 A;  4R0M A;  3M91 A;  3OA7 A;  1HY8 A;  2YNY A;  4WY4 C;  3KYQ A;  2E5T A;  4OH8 B;  4U0D A;  4R4L A;  1AVY A;  3I55 P;  3M0D A;  3MIW A;  2BCC J;  2HOD A;  1ZR2 A;  1NTZ G;  1FOS F;  3A3Y B;  2WPV B;  1T3U A;  3D6Y A;  1LTJ B;  1IFD A;  1KOR A;  3CC4 P;  1Q2N A;  1KYO I;  2LL8 A;  1Y9B A;  1FS0 E;  3DS0 A;  1EXI A;  4HH2 A;  3CD6 P;  3CC7 P;  3E1R A;  2KG6 A;  3HTK B;  1DD4 A;  2O1K A;  3CCJ P;  2H8P D;  3EWK A;  2E43 A;  1ZME C;  2YIU C;  1NVO A;  2Z46 A;  2FAC A;  2JB0 A;  3E2D A;  3AEF C;  3D70 A;  3KHU A;  5CCH D;  1KC8 Q;  2R32 A;  5AW4 B;  1FOS E;  3CI9 A;  1SQP D;  2QSI A;  4WY4 A;  3VYI A;  4WY4 B;  1NTK J;  1OW6 A;  2KI7 B;  1G1I A;  1N2D C;  1AUM A;  4WB4 A;  1N7S B;  2OYO A;  2P2U A;  5HV8 A;  3H1I G;  3JSV C;  2K2Q A;  5KAI E;  2M5A B;  3BCC G;  4D6T J;  2KGC A;  4H13 C;  2E1M A;  2JGP A;  4LLH A;  3IR9 A;  3H47 A;  5M1B A;  3CX5 H;  3CCM P;  4PH0 A;  1OW7 A;  5JPA A;  2DW3 A;  5KP7 B;  4EOT A;  5CBN A;  3EJE A;  1BE3 G;  4K35 A;  1N73 A;  2A45 H;  3L75 J;  3RL0 D;  4PXH B;  3B5N B;  3W67 A;  3E7K A;  1MV8 A;  1DIP A;  2XNX A;  1EDL A;  1RO0 A;  3DS2 A;  2XZ0 D;  1PPJ G;  2B88 A;  3RK3 E;  2GUV A;  1QEX A;  2XND H;  3V4W A;  2OTK E;  2CPS A;  2GZE A;  5GTI H;  5BS2 A;  3HYB A;  1PEO A;  5KLI B;  1YHQ P;  1JMB A;  2JEE A;  3RGU A;  3RK3 C;  2LML A;  2W83 C;  3RK3 B;  2FYN C;  2K5X A;  2K37 A;  4PV1 D;  1M1J B;  3L70 E;  3GG2 A;  1EZV G;  3D6Z A;  1RF1 C;  5KLV G;  3AE7 C;  4QMA A;  2QA4 P;  1KQF B;  1SP4 A;  3H1H J;  5AW3 B;  3V6I A;  1NKN A;  1HWT C;  1JTH B;  3HD7 A;  3L73 E;  4U3F E;  1Q82 Q;  3L72 E;  3TF5 A;  5KP6 B;  5DJT B;  3B5I A;  2JKV A;  5KKZ B;  3CWB E;  4U0A A;  1EZV I;  2KSJ A;  4CA3 A;  2PEQ A;  2KYV A;  1BE3 J;  1IFI A;  1JJ2 O;  1OVR A;  3ABV C;  1LT9 B;  2JP3 A;  1NJI Q;  2QVA A;  1GL2 D;  4PJ0 H;  5AW9 B;  3NTE A;  1M7L A;  1NH4 A;  2C0W A;  3HUS C;  4U0B A;  1URQ C;  2FYN B;  4D6T G;  2LPK A;  3VOP A;  3H1I J;  1P84 I;  3L75 E;  2B9B A;  3LMO A;  1BSN A;  3L75 D;  2CK3 H;  4HJG H;  2LTE A;  2M5A A;  2VLO A;  1JNM A;  3HD7 B;  1F80 D;  1H88 A;  2PY8 A;  3H1J G;  2VLN A;  1YJN P;  1NTZ K;  1GD2 E;  1OXZ A;  5CCG C;  4MRT C;  3MD0 A;  2K9J A;  1ZN5 A;  4W7Y A;  2VSQ A;  3O8Z A;  4H13 D;  1LT9 C;  4H0L D;  5AVS B;  3CCQ P;  2BCC D;  2KOS A;  2GDY A;  3BRV B;  2AEM A;  2J58 A;  3WBH A;  2N9B A;  1SQX D;  2CNR A;  3CCU P;  3L71 E;  3P32 A;  1NKZ B;  3RL0 B;  2M8N A;  3EQ2 A;  3VN0 A;  1EDJ A;  5APT A;  2E76 C;  3L72 J;  2JU1 A;  2JR8 A;  1NTM G;  3IAO A;  2P67 A;  4I1L A;  3M1M A;  1BGY E;  2UWJ E;  1RO2 A;  1FE6 A;  3L35 A;  7CEI A;  4JF7 A;  1OIP A;  1SQP J;  2QJP C;  1D7M A;  2E75 B;  1R5S A;  1GW3 A;  3RK2 B;  2N1T D;  3M0A A;  3A0H H;  3RK3 D;  3II6 A;  1LTI C;  4N6J A;  4PV1 B;  5CCH A;  1CZQ A;  4COP A;  2CPB A;  3PLN A;  2W27 A;  2A06 G;  1NGM B;  1M6E X;  1K04 A;  5AVY B;  1LTS C;  2A06 E;  2R5B A;  2WSF H;  3G29 A;  2KNC B;  2K94 A;  2W8Z A;  3PP5 A;  3CXC O;  2PEI A;  3AEA C;  5AW0 B;  5KJ7 A;  2E76 D;  2K88 A;  2LKM A;  2K0Y A;  4QKO A;  3AE8 C;  3B5N D;  1HBW A;  4GIF A;  2N1T B;  1BCC D;  4GOD A;  3L71 J;  2QRX A;  5AVQ B;  2FXP A;  2Z5H A;  1S72 P;  2G8Y A;  2IBZ I;  4UHP B;  1NAY A;  2K0X A;  1KIL B;  1VF5 C;  5KLV D;  3S9O A;  2FFD B;  4I6M C;  1N7L A;  2N1T C;  3CX5 D;  1J1E B;  1JCD A;  1LJ2 A;  4PD4 I;  3CMA P;  5BVZ A;  3Q5R A;  2X2B A;  2PFX A;  2EG5 A;  2P10 A;  5APU A;  2KUB A;  2KOQ A;  2R3C A;  3NMD A;  4JQ0 D;  2OYI A;  1IFN A;  2W90 A;  2K3R A;  1ZMB A;  4TLF A;  1EDI A;  2FYU K;  3KZI E;  2DGY A;  1OWA A;  3DPH A;  2LR2 A;  1NHL A;  5AW7 B;  2M0B A;  2FKW B;  4XE5 B;  1QL2 A;  3ITK A;  1YJ9 P;  1S5L H;  1H8A A;  1M6N A;  3B5N A;  2W6J H;  2KS1 B;  2K92 A;  3G71 P;  1NTM J;  2QJP B;  3H4E A;  2LXB A;  4DCK A;  3H1I E;  1RF0 A;  4H0L B;  3HZQ A;  1MZ9 A;  1HH0 A;  1K05 A;  3G4S P;  1BE3 D;  1DEB A;  1M1K Q;  1VQL P;  2B87 B;  3FWN A;  2QJY C;  4YXD C;  5CBO A;  2KLU A;  4U0C A;  2D2C B;  1GU5 A;  4A7P A;  2IYP A;  5EFW B;  1S9K D;  4NEO A;  4ZMD A;  1J1E C;  4IFF A;  1VQ9 P;  3BCC D;  3M9Q A;  2CG5 B;  4OWF A;  1ZNV A;  5BS1 A;  3AE2 C;  2XU6 A;  1OX3 A;  2EHS A;  5AVR B;  5F2O A;  1EC5 A;  2BEQ D;  1SFC C;  5AW5 B;  5HGN A;  5CCH C;  1MFZ A;  1RE3 C;  1OW8 A;  1X8Y A;  3RBX A;  5AVW B;  3F89 A;  2WPR A;  2L0Q A;  2PNG A;  2PP6 A;  1L0L E;  2MJZ A;  2NO8 A;  2KWL A;  3L70 J;  1GW4 A;  4L74 A;  3GW6 A;  2AVA A;  4IZ6 A;  2L9F A;  2W6A A;  3MHV A;  2AFE A;  1EIA A;  1FZA A;  2HLO A;  2IDB A;  3H1L E;  2YKQ A;  3FXE A;  2IBZ D;  3CWB J;  4BXL A;  2R5D A;  4DZO A;  3H1L G;  1ZRT E;  4ASW A;  1Z56 A;  4GOE A;  1SQB K;  4H2X C;  2Q3I A;  1SQX J;  4OGQ B;  1K30 A;  1SQP K;  3M0D C;  2Q6Q A;  1KIL A;  3K5B A;  1KB9 D;  2EHT A;  1BDC A;  2MD9 A;  3I56 P;  1HVV A;  2YKO A;  3MTU E;  2KG8 A;  2IZ1 A;  5B66 E;  5KAF H;  1PPJ D;  2ZYA A;  3SFE C;  1K9M Q;  2JWD A;  2WIT A;  1PEM A;  1SQV J;  2WPT A;  2FAE A;  2PRR A;  2KXP B;  2P58 A;  2K93 A;  1M1J A;  5CCG D;  3HUS B;  3WU2 E;  2L22 A;  3A2A A;  5F2K A;  1ZV8 A;  3WMM 0;  2CQ8 A;  2OYH C;  2QJK C;  4BRY B;  2WQY C;  1PP9 G;  4W7Z A;  1IMQ A;  2KR5 A;  4BRY A;  4AUW A;  2ZXE B;  4WY4 D;  2M3E A;  3WUT A;  2KGA A;  2QE7 H;  2I1J A;  4U3F J;  3LW5 H;  1DX7 A;  1E5W A;  3I5C A;  3L37 A;  3FGA D;  1YYC A;  2WT7 A;  1A02 F;  2OYH B;  1IFP A;  4Z1M H;  2O01 J;  1QRJ A;  1L0N J;  3TGU J;  2I1K A;  1GK4 A;  2NRG A;  1KLP A;  3H1I D;  2B87 A;  3DS3 A;  1S1C X;  1LGH B;  2Q7C A;  3L36 A;  2ERH A;  5CHX A;  4U0E A;  1L4A C;  5AW1 B;  1HQB A;  3MGE A;  1SQB D;  2R44 A;  2NPS A;  1PZQ A;  2KLV A;  3GKL C;  2FVA A;  4I7Z B;  5GTI E;  1X9V A;  1X0T A;  1IK9 A;  1KD1 Q;  1LTB C;  2JWA A;  3AE1 C;  4XRO A;  2Y9Y A;  1KIL D;  1GDT A;  1X3O A;  2ZYG A;  3L73 J;  1NTK D;  1JM0 A;  2AEF A;  3ZDM A;  3LW5 J;  5APY A;  2MKV A;  1SQX E;  4ZNC A;  2O3J A;  3NY7 B;  3UIA A;  3H32 A;  2VLP A;  3DTJ A;  1M74 A;  1NTZ D;  5HGM A;  1SFC B;  1PP9 J;  2IPP A;  4C7N A;  2MF4 A;  4GOF A;  4C7N B;  1VQO P;  2QIW A;  2BEZ F;  3H1J D;  5APQ A;  1EMV A;  4RKU J;  3TK1 A;  1T3J A;  1P84 D;  1U7M A;  3P7K A;  1L0L K;  1NAF A;  1CI6 A;  1AQT A;  1IO4 A;  1CSB A;  1ZW0 A;  3HD7 C;  3L4F A;  4UB8 H;  4H0L C;  2ZAE B;  3HE5 A;  1Y8A A;  1CEI A;  2IX7 C;  2QM7 A;  1HF9 A;  3L74 D;  1FAV A;  1NU1 D;  3VMZ A;  3PH0 A;  2L4B A;  3B4S A;  4PD4 H;  2FYU J;  1LT1 A;  2XZ1 C;  1T8Z A;  1OMI A;  2KGE A;  1WMK A;  3CCS P;  1LTJ A;  2QG4 A;  2FQ2 A;  2AXT H;  4EDF A;  1IZN B;  3PRJ A;  1GTW A;  2B89 A;  2OYI C;  2OTL P;  1RE4 C;  1KQG B;  2QM8 A;  1FJP A;  5I4T G;  1BGY D;  1N73 B;  2W6B A;  1YQ4 C;  4Y99 C;  2HR3 A;  1KYO H;  1KB9 H;  1QLE D;  2KZJ A;  1SQQ G;  2OGU A;  3TYY A;  1Q81 Q;  4H13 B;  4RO0 A;  1Q90 D;  4R4M A;  2OQQ A;  1D1D A;  1FZF A;  3G0V A;  1EDK A;  1KYO D;  3L73 D;  2E42 A;  2FQ1 A;  1VQK P;  2P7J A;  1MKM A;  3H1K G;  1VPC A;  3AED C;  5F2N A;  2ZT9 B;  1J1D C;  2KW2 A;  5BU5 A; 
#chains in the Genus database with same CATH homology
 2XV6 A;  2PEI A;  1M90 Q;  3E2D A;  2BQ1 E;  1KC8 Q;  2QEX P;  1VQO P;  1Q7Y Q;  5F2K A;  2L6E A;  1VQ9 P;  1BAJ A;  2P9X A;  4M0I A;  2QA4 P;  3CCQ P;  2OAR A;  1VQ5 P;  1VQP P;  1QVG O;  5BS1 A;  3CC2 P;  3G1G A;  3G28 A;  2BHV A;  1E6J P;  5DCK A;  1AUM A;  3WBH A;  3H0D A;  5F2O A;  2EIA A;  1S72 P;  3OW2 O;  1Q82 Q;  4XFY A;  1N8R Q;  5HGN A;  1IUQ A;  2XXM A;  3CCU P;  3B5I A;  2XT1 A;  4PH1 A;  1K8A Q;  2PEO A;  2PEN A;  2M8N A;  4U0A A;  1QVF O;  1VQN P;  4WYM A;  2E1M A;  3CME P;  3H47 A;  2PEQ A;  1PEQ A;  1A8O A;  3G26 A;  3DS4 A;  2JO0 A;  1JJ2 O;  1QRJ A;  2KOD A;  3CCR P;  1NJI Q;  1PEU A;  1RNI A;  3CMA P;  3DS3 A;  2OTJ P;  4GR6 A;  3CCM P;  3CPW O;  4PH0 A;  1K73 Q;  3CCL P;  2EG5 A;  3M1M A;  5JPA A;  3NTE A;  2M8L A;  1YIT P;  1RO2 A;  3P05 A;  4U0E A;  5HGL A;  3CCS P;  4U0B A;  3DS1 A;  1VQ7 P;  3MGE A;  3VRL C;  1EIA A;  4U0F A;  1EOQ A;  1ZMB A;  3RG6 C;  2Z45 A;  5HGO A;  4U0D A;  2DGY A;  2PEM A;  3G1I A;  3DPH A;  1W2B O;  4QNB A;  1VQ6 P;  1KD1 Q;  3I55 P;  2PEJ A;  2OTL P;  1YJ9 P;  1RO0 A;  4XFZ A;  2BUO A;  1M6N A;  3DS2 A;  4XRO A;  5I4T G;  1KQS O;  2EFJ A;  1K30 A;  3G71 P;  2PEK A;  2CWO A;  3H4E A;  4IPY A;  4XFX A;  4COP A;  1YI2 P;  3CC4 P;  4GR2 A;  3DS0 A;  1YIJ P;  4COC A;  3HZQ A;  3CD6 P;  3CC7 P;  3DS5 A;  3G4S P;  1VQ8 P;  1M6E X;  5BS2 A;  3G6E P;  3HYB A;  2LF4 A;  3I56 P;  1YJW P;  2Z44 A;  2PY8 A;  4XRQ A;  1Q81 Q;  1PEO A;  2JYL A;  3Q20 A;  1D1D A;  1M1K Q;  3G0V A;  3CCJ P;  3G21 A;  1YHQ P;  1VQL P;  1YJN P;  1Q86 Q;  1VQK P;  3CCE P;  2JYG A;  3LRY A;  3DTJ A;  2ONT A;  4U0C A;  1M74 A;  2M8P A;  2Z46 A;  5F2N A;  1VQM P;  1A43 A;  1K9M Q;  1VQ4 P;  1PEM A;  5HGM A;  3CCV P;  3CXC O;  3G29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...