1M90Q

Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1m90Q02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1m90Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1m90Q03
1QVGO 1YITP 1M90Q 3CCQP 1VQPP 3CCUP 3G6EP 3CCSP 1VQKP 3CCMP 1KC8Q 1YI2P 3CCLP 3CCEP 3CMEP 1JJ2O 2QA4P 1N8RQ 3I56P 3CC4P 1YJ9P 1VQ5P 1YJWP 3CCVP 1Q81Q 2OTJP 1VQ9P 3I55P 1K73Q 2QEXP 3CC2P 3G4SP 1VQ7P 1YIJP 1S72P 1KD1Q 1YJNP 2OTLP 3CD6P 1K9MQ 3CXCO 1K8AQ 1VQLP 1VQOP 1Q7YQ 1QVFO 3OW2O 3G71P 1W2BO 1NJIQ 1KQSO 1VQ6P 1VQMP 1VQNP 1Q86Q 3CMAP 3CCRP 1Q82Q 3CC7P 3CCJP 1M1KQ 1VQ4P 3CPWO 1VQ8P 1YHQP
chains in the Genus database with same CATH superfamily
2GZFA 2I8DA 5KAIE 2Q9IA 1H89A 5KAFE 4ZKPA 3RBZA 1L4AD 1PGQA 1UIIA 2XV5A 1NTMJ 2LIUA 2N6ZA 1MV8A 1RF0A 3H1JJ 2OYIC 3CLQA 2DGYA 3G1IA 3U1CA 2KZJA 2KS1A 4WY4B 2OTJP 1RY3A 1CZQA 1P84H 1PP9D 2AEJA 3L70D 2KS1B 5KTBA 2C9NY 2YKOA 2OYHC 5TISH 3FGAD 1M1KQ 2A45I 1SQXD 3C8VA 1SQXK 1RQVA 2H8PD 3U59A 5AW5B 3D6YA 1JJ2O 2Z4EA 2K9YA 5HGOA 2CK3H 4L74A 2V4HA 1FZAA 1HGZA 5AVTB 2E43A 2V7QJ 1FE6A 5CCHD 2AEFA 2K37A 1CI6A 4H0LB 3VMYA 3DS3A 5BS1A 2IFMA 1AUMA 1S3JA 3UIAA 3NTEA 2PGDA 2FYNB 1E5WA 5KP6B 1EZVI 2E76C 2KYVA 1FZCB 1KILA 5APWA 1SQVK 2ZYDA 1ZR4A 1GK4A 1JMMA 2KR5A 2JO1A 4N6JA 1S2EA 3H1ID 3AEDC 4H13B 2QRXA 3KHUA 3HRNA 2KUBA 1IFDA 2YXQB 4M3LA 5AVSB 3CXHH 3S9OA 2LKMA 3BATA 4I1LA 2KLVA 3P32A 3QH9A 4PWVB 3HUSC 1FDIA 2BHVA 3Q5SA 2FYUD 5I4TG 1IFPA 1KYOH 1HF9A 4XRQA 1USEA 3E2DA 1SQBG 2B89A 4U3FJ 2WMMA 1AQTA 1Y9BA 2KGEA 3GZLA 1VQ8P 2QSIA 2JP3A 3KZIH 2P10A 1S9KD 3L70J 3II6A 1X9VA 1L0NJ 3I56P 1IFJA 2Q5UA 2LXCB 2FXOA 1H88A 3C1LA 2WSEJ 3L36A 1JM0A 4JYBA 2GYKA 2WVRA 2O01N 3H1HG 4ASWA 3M0DA 1PFIA 1DNYA 1G1IA 3PHLA 1PP9G 1VDFA 3M0DC 3KXDA 2FQ0A 2VLPA 1NU1D 3OAKA 2L4BA 1S72P 1KD1Q 2LXBA 2GZEA 1VQ6P 3B5IA 4WBAA 3GG2A 3AE8C 3RGUA 5F2OA 4YPCA 4B86A 5AVYB 2AXTE 1NTZJ 3BVHA 1GDTA 1LP1B 2NPSD 3M9QA 3M1MA 1IFMA 2M8NA 1LWUA 3H4EA 1RE3A 3M9BA 1NJIQ 2IDBA 3A0HH 2EFJA 3LRYA 1NU1G 3TGUG 3VMAA 5CCGA 2MJZA 2L91A 1E79H 1KLPA 5AW9B 2OYOA 5BU8B 3HD7D 1KN7A 3CMEP 3I5CA 2PY8A 3G21A 1ZMEC 2WPRA 2EG5A 1KMIZ 2YNYA 3SFEC 3GJNA 4UB6H 4U7JA 4L73A 2K93A 4XFJA 2LPKA 3Q2YA 1VQLP 3H25A 1RO0A 5AW4B 3H6PA 4I6MC 1A8OA 3Q5RA 2LR2A 5AVZB 1LTIC 3PTZA 4WWIA 4H2XC 2CWOA 1YITP 3RG2A 3L73E 2C0WA 1OW6A 3S1KA 3G6EP 2BASA 1HVVA 2E5YA 1X3OA 1URQB 2JKVA 2WPTA 1EC5A 1URQA 1X79B 4PJ0H 1BCCJ 3H1KJ 5CMZA 3IR9A 4XFZA 2XV6A 1L0LK 2OYIB 4IL6H 1EDKA 1NU1J 2K5XA 3M06A 1QVGO 1GXHA 1SQVE 1VQKP 1L0LJ 3CX5D 3HYBA 2VSQA 3DS0A 3H1LG 3RK2D 2QJKC 2MD9A 3FXDA 4PD4H 2HG5D 2L6EA 1VQNP 1HQBA 1GW4A 2G8YA 3L72G 5E79E 4DOJA 1LJ2A 2N5HA 2Y0CA 2QJPC 3AEBC 2E74B 1EQ7A 1BGYG 1NHLA 3DS5A 5TISE 3G0VA 3CD6P 1L0NE 3IF4A 4YXWH 2E74C 1BSNA 1ZXGA 1GL2A 3VTPC 2WPVB 1JCDA 1PEMA 1TU3F 5AVVB 1NGMB 2QVAA 4U3FD 2YIUB 5HGMA 2Q3IA 3MUDA 1LTAC 3CWBJ 1M57D 2A45G 5K5GB 4NPDA 5KJ7D 3P8CE 1NTKG 1NTZE 1BGYE 3BRVB 1NTZK 1GPJA 2M8RA 3NMDA 4EYYQ 2XU6A 3L73D 1NWQA 1MUUA 3V2QA 1L0LG 1PGOA 1K8AQ 2L0QA 1LTGC 5M1BA 1EZVG 1NOHA 1IMQA 1Q86Q 3MZWB 1ZRTD 2QE7H 1JUNA 3VMZA 3B71A 1K73Q 5APXA 1QL1A 1LWUC 1YBKA 5HGLA 3IN6A 3B5NC 3L71J 1OMIA 4GT1A 2O01J 1L4AB 2KOPA 2GZJA 5AW2B 2KOSA 1R5SA 1L0NK 1L4AA 4Y99B 2EIAA 3TGUD 3M9HA 4GODA 1HBWA 1J1DC 2KXPB 2ROQA 3H1JD 4Y99C 3GW6A 2YMYA 2PNGA 3KDPB 3EWKA 2FVAA 4NEOA 4PD4E 1NTKJ 1NU1K 4LGDE 2O1JA 1FZBA 2WWWA 1FZFA 4GIFA 2JWAA 2PEIA 1X22A 4XE5B 2K88A 3RK2C 2N98A 2RH0A 2OYHB 3KQGA 3H1LD 1GXGA 2E75B 4H44B 2JGPA 2N50A 3H1JG 1FBMA 3BCCD 2CNRA 5BS2A 2HLOA 1LGHB 2WZ7A 4U0DA 1BE3D 3L4FA 3CC2P 3C9IA 3MP7B 1L0IA 4RJTA 2E42A 1SFCA 1PV3A 2R5BA 3Q5PA 2FACA 3PP5A 3G29A 3CC7P 3HE4B 1LTBC 3HE4A 4PV1B 2RN0A 5APTA 3V4WA 5KKZC 5KP8B 3R2PA 1HJ0A 4DT0A 1CW5A 1Q7YQ 2KWLA 1A02J 1SFCC 3HUSB 2JWDA 4H13C 4I2LC 4D6TD 2Q1KA 3R4YA 4DG9A 3Q3DA 1EOQA 3OA7A 3TYYA 4JPZB 2QM8A 1ACPA 3L73G 1U7JA 2K3RA 3I55P 1MZ9A 5KLVD 1NYHA 1IZNB 1K05A 1L0ND 3AEGC 1GU5A 5EW5E 4YXDC 4YTPC 2MVVA 1EZVD 1OX3A 3DS2A 2FAEA 1L2PA 4WY4A 4IL6E 2GZIA 1SFCD 2YXRB 2LMLA 1M8OB 3EJEA 4H0LC 5KJ7A 2KG6A 1H8AA 2O3JA 2Q7CA 3EJBA 1T6AA 5AW1B 5GTHE 3DPHA 2WQYC 1DIPA 2HPCA 1SQPK 3A2AA 1SQBJ 2KOGA 1Y8AA 1RH5B 4COCA 3O8ZA 2K1AA 5CCHC 2FYUJ 1RF1A 3QWOC 2W90A 2OARA 1ZN5A 2WITA 2AFEA 5F2NA 1IC2A 3L72D 2WPSA 1KQLA 3BCCG 1QGKB 2PEOA 4O9BA 4TLFA 3L75J 2LL8A 2W6JH 1T8KA 5AVUB 1JY3O 4QMAA 3L70G 3W68A 2AXTH 1G1JA 2B9BA 2WTYA 4IFMA 1HWTC 1L4AC 4C46A 4JF7A 2YKPA 2JU1A 5F2KA 2E1MA 1Y47A 1J1EB 5KLIC 4ASVA 1EXIA 3SWYA 4EIJA 3RL0C 1A02F 1N73C 2AXCA 2JEEA 5B5EE 2JU2A 2KI7B 1FDMA 1W5CE 3CXCO 1LTSC 1NAYA 1SQVG 1T2KC 2ZYAA 1OXZA 1J1DB 4U3FG 2R44A 4Y28J 1GZLA 5APYA 2KGDA 2XNXA 3M91A 2ZAEB 3L74D 2KORA 1JTHB 1X8YA 4KJMA 1AFOA 4H2YC 1KYOE 5E79H 2E75C 2Z45A 1NTMK 4OWFA 2KK7A 1WRGA 4HKGA 2JJLA 2GA1A 4PD4D 1EDJA 1LP1A 3AE7C 2IYOA 2IZ0A 3WMM0 1NTZD 1KC8Q 1NTME 2D2CD 1NTKD 2GUSA 1H0TB 1KB9E 3SFDC 3H1JE 1JB0J 1KB9I 2FXPA 1VQOP 3L71E 4W7YA 2IZ1A 1FJKA 2KODA 3CCRP 1YYCA 5AVXB 1AVYA 2FQ1A 5AW8B 2HPCB 2C9LY 2E5TA 1KQGB 1SQQG 1FS0E 2JYGA 2G3AA 1DD3A 2M5AA 3G26A 4PJ0E 1RF1B 1KYOI 3BASA 3V4QA 3EJDA 2CPSA 3E1IA 5HV8A 2VLOA 3CI9A 3LIDA 1VL2A 2PEQA 5C39A 1KZUB 3G9RA 3MGEA 2JO0A 2Q3EA 1L0HA 1DD4A 4JYCA 3P7KA 1N7SD 2YMKA 1D1DA 1OZHA 4BRYA 3V6IA 1QVFO 1N7SC 4BRYB 1HH0A 5CCHA 1ZOYC 2W6BA 4AQRD 1JMBA 1FOSF 1YI2P 1AV1A 4U0FA 2FYUE 1VQ9P 2XZRA 3D6ZA 3CL3D 3TSIA 1G2CB 3V2NA 1PL5A 4D6TG 4K35A 1BE3G 3RK3B 1OW8A 2FXMA 2MY5A 2BCCD 2Q6QA 5DCKA 4RESB 2WSFH 3V2RA 2K2QA 1S5LX 3F5HA 4N78E 1GL2B 4R4MA 5AVWB 1SQQJ 1SQPE 1W2BO 2H7HA 2LKIA 2YO2A 4HKZH 4PXHB 1GMJA 4IZ6A 4PV1D 1FDOA 2GZGA 2M3EA 4ZNCA 3B8EB 3RK2B 1LT9A 3GMAA 2PAJA 1M1JA 3FXEA 2MKVA 1ZW0A 3G71P 2PP6A 3CMAP 2H88C 1U7MA 3AE2C 2A06E 5HVCA 4XA4A 4GOFA 2KW2A 1FZCC 1DX7A 2QNWA 4ZMDA 2QEXP 1H0TA 2KP8A 2NO8A 3RL0g 2PFXA 1KB9H 4WY4D 4HB1A 2IBZG 2PENA 1DEBA 3BCCJ 3CCJP 1K30A 5BU5A 4OH8B 1VQPP 2R3CA 2PEJA 1N73B 3CCEP 1EDIA 1N73A 3CCVP 1BCCD 3H1KD 4A7PA 4N3YB 3RL0B 4QNBA 3T97B 4R0MA 2KNCB 1UNKA 3T97A 3F89A 3AEEC 2KNCA 4HH2A 2H89C 1EDLA 2XZ0D 4IPYA 3B4SA 3N4XA 3VP8A 4H2WC 2PEMA 1VQ7P 1QL2A 1KB9D 4WB4A 2FFDC 3RK3C 2E76D 4HJGH 1PPJE 1FR2A 2N1TB 2LIWA 2MR8A 3CCMP 5AW6B 2A45H 3O6QB 2KIKA 3USSA 3SWFA 3O6QA 2PRRA 3L73J 1FJPA 4IOIH 1WT6A 2GDYA 3L75G 1AJYA 4PH0A 4BPGA 1OVVA 3CX5I 5KJ7C 3LIEA 1YQ4C 2E74D 3B4QA 4LC1A 1SFCB 3H1HD 1SQPG 1X0TA 4GOEA 3VP9A 4KHXA 2BEZF 3MUDC 2JYLA 1IK9A 1R5LA 3WBHA 3A7OA 5CJ0A 2N9YB 5KAFH 1UJZA 2M3BA 1OVRA 2FBWC 2Z5IA 1DEEG 1KFNA 2NRGA 1FAVA 1LT9B 1PEQA 2KSEA 3HUSA 3CWBG 2I1KA 3RK3D 1WMKA 3NFQA 2YIUC 1JY2P 2J59M 2L22A 4OVNF 3HZQA 1YHQP 1S4XA 2WT7B 4N78D 1SQBK 4C7NA 3B5ND 2IBZI 1RHZB 5KAIH 1XTGB 2ZT9C 1D7MA 2O01H 4UB8E 1IK7A 1RE4A 1Z56A 1KYOD 1JY2O 2P58A 3CWBE 4PH1A 3L74E 2M5RA 3P8CD 3B5NA 1M7LA 3P05A 3SSUA 3RBXA 5KLIB 1SS1A 2BUOA 3CXHD 5KKZB 3BCCE 1CSBA 4U0EA 3WUTA 5AW7B 1K9MQ 4U0AA 1E0HA 1LTJB 2HFED 4GR2A 4UHPB 3HTKA 2Y9ZA 1FC2C 1DH3A 2QA4P 2FADA 1OWAA 3MGNA 1PP9E 2FKWB 3GHGC 3VOPA 1SLQA 5DJUB 1SQQD 1NO4A 4D6TJ 1KTMA 1SQQK 2GM4A 3ZDMA 1BDCA 1HGVA 2FY8A 3GF3A 3CCLP 1T8ZA 2YO3A 1AA0A 3L71G 3EQ2A 4PD4I 2W6AA 1VQ5P 1EIAA 3TGUE 1HTLC 2OYHA 3A0HE 1S1CX 2M0BA 1KFMA 5AW3B 1SVFA 3A0BE 1A43A 2FYNC 2ZVNB 4HYTB 2VLNA 2AF8A 3L75E 2P67A 3SWKA 2IX7C 1T2KD 2CG5B 3H1LJ 5KLVJ 2HODA 4U0CA 1NTKE 3JC22 1KILB 2P9XA 2HODB 4OGQB 5GTIH 4F37A 3DS4A 2H43A 1GL2D 1FU1A 1U57A 2WSCH 2P2UA 1OIPA 1BE3E 1M6EX 1JTHA 3WU2E 1GU4A 1JY2N 1KV4A 1F80D 1VKUA 3H32A 3G28A 1OW7A 1E6JP 1N8RQ 4WY4C 5KLVG 2GDWA 3CXHE 2W8ZA 1JY3P 2WT7A 4C7NB 3H47A 2ITAA 4GDOA 2IBZD 4C7RA 1BDDA 1AQ5A 1Z6MA 4L76A 3PRJA 3CC4P 1EXJA 2J58A 2YKQA 2QM7A 3U43A 3L70E 2LF4A 3GLMA 4XFXA 3VN0A 1KQFB 2XZ1C 3GKLC 3L74J 4EI2A 1J2JB 1CEIA 1ZLLA 4IL6X 2A06G 4K3AA 2Y9YA 3RG6C 2GDXA 2FQ2A 5AW0B 3CPWO 2ERHA 1LTJA 3RK3E 4H0LD 4BWNA 2CPBA 3AEAC 3HTKB 2AFDA 2QJYC 4MRTC 1YQ3C 3L35A 4CA3A 1OVUA 2OTKE 2JAZA 5APQA 1KORA 3CXHI 4KT0J 1KILD 1PGJA 2J5UA 5HGNA 1LT9C 3TGUJ 3DS1A 5L8RJ 3U1AA 3D70A 2C0XA 2KG8A 3EFGA 3V5BA 4PV1C 2K0XA 2B88A 1BCCE 3H1KE 1BSHA 3L71D 4D6TE 5CCGD 3H1HE 1PIXA 1HUCA 3AE3C 4XROA 3W67A 1LT1A 2K92A 1PGPA 3ITKA 5KLVK 1VF5C 4NPFX 3JCUE 2JQ4A 1P84E 2OQQA 1L0LE 4W7ZA 2JR8A 3P8MC 4L75A 2AEMA 1PEOA 5EFWB 2R32A 3N7NA 1EMVA 1CI6B 5CHXA 4I7ZB 2Z5HA 1AF8A 2LTEA 2ZJSE 1NKNA 2XKMA 1KILE 1PP9J 2DNWA 4Z1MH 1FZCA 2ZFCA 2KOQA 3H1IJ 3NTNA 1GD2E 1AYIA 3L72J 1T3JA 1NKZB 2BCCJ 5B66H 3H1LE 1S9KE 2OYIA 1SQXE 3CWBD 1YJNP 2P1JA 2IPPA 4MN4C 3AE1C 5APVA 3S4RA 1ZP0C 1N7LA 3MHVA 2X2BA 1RO2A 2Y0EA 1QX8A 2DW3A 3V2PA 2FYUK 1P84D 1NU1E 1SQPD 2M8PA 3WU2H 1JCCA 2UWJE 1GK6A 4IFFA 3H32B 1BGYJ 1ZV8A 2JDIH 3HD7C 1YJWP 3BRTB 1Q81Q 4R4LA 1JY3N 1M6NA 1BGYD 4UB6E 2VRSA 3KZIE 3M0AA 3L37A 2B87B 1NTZG 3TDKA 4XFYA 5TJHA 2RKLA 1ZMBA 1VHNA 3AEFC 2FHSC 1NVOA 5CBOA 3G1GA 2NPSC 1M90Q 5GTIE 4I7ZC 2NZ2A 2FFDA 2QJYB 4OGQC 5AVRB 2K0DX 2RMZA 5B66E 4IFDK 3EFFK 2XDJA 4OGQD 2EHSA 1HJBA 2KG9A 4DJGA 1RNIA 2SPZA 1KQSO 5APSA 2A06D 1ZRTE 1Q82Q 3A0BH 1AVOA 2N1TC 3LW5J 3AE6C 2Z44A 2M5AB 5CBNA 2FVFA 3Q1MA 4W80A 1LTTC 5H2FE 2E75D 1MFTA 2K94A 3MTUE 2MR7A 2WSSH 1LWUB 3H1KG 2CGQA 1BCCG 1QRJA 5B5EH 2N6YA 3PH0A 3GF7A 1IUQA 1PPJG 2LOLA 1YTZI 5JPAA 3GZMA 3D71A 1W2EA 2ONTA 4BPHA 3A5TA 3WUUA 3H1HJ 1FZGA 3LW5H 2ZVOB 2W83C 3H1IG 2N5IA 1URQD 4JQ0D 1QEXA 1G2CA 2XXMA 5KP7B 2N1TD 1LTJC 2KB7P 1VF5D 1GTWA 2BEQD 2ZXEB 5KLVE 3TK1A 1NTMD 1RF1C 4EDFA 3OW2O 4JBZA 3ABVC 2KOOA 3JCUH 1ZR2A 3VMXA 2D2CC 1T3UA 2GUVA 7CEIA 1MZ8A 1M1JC 4NPEA 1NTKK 3TF5A 1N2DC 4H44C 2BCCE 2OTLP 5CCGC 3JSVC 3L75D 3AE9C 2I1JA 4DZOA 3DTJA 4RKUJ 1M74A 1IJDB 1S5LE 1Q90D 1NTMG 2P7JA 3CCSP 1M56D 3E7KA 1M1JB 4EOTA 2QJPB 2PEKA 1IMPA 4LLHA 2JB0A 1K04A 3NY7B 1YIJP 4WYMA 2CQ8A 2FYZA 2B87A 1SQBD 2Y0DA 4ZKUA 3AECC 3L72E 3HE5A 2HYNA 1OFCX 3HE5B 2QJKB 4AYCA 1SQQE 3GHGA 1SQPJ 3L74G 3KYQA 2K0YA 2Z46A 1JOCA 3AE4C 1LNQA 1SQXJ 2W27A 2FFDB 1RQUA 2KGAA 1L0NG 2POHA 3Q20A 4U0BA 3B5NB 3G3ZA 1URQC 1BAJA 3IAOA 5APUA 3VYIA 1PPJD 3CCQP 1L0LD 4QKOA 2IBZE 2WPQA 1HY8A 2WSFJ 1UIXA 2O1KA 2R5DA 3RL0D 2ZXXA 1XTCC 5H2FH 2WSEH 3MIWA 1OR5A 2NPSB 3TNUB 1SQBE 1USDA 1VF5B 4CPGA 1J1EC 2NPSA 3AE5C 3TNUA 1VQMP 4M0IA 1QLED 1GW3A 3CX5H 4DCKA 1MFZA 3HD7B 1NAFA 2EHTA 2XNDH 1P84I 3HD7A 2FVEA 1GL2C 1SQXG 1KILC 3VRLC 2N1TA 2L9FA 2M8LA 1IO4A 4BPFA 1NH4A 1PEUA 3E1RA 4RO0A 1YJ9P 3FWLA 4COPA 1SP4A 2IYPA 1FOSE 3H1IE 3K5BA 1PZQA 3CX5E 2KSJA 3CE7A 1YTZT 4WVZA 2IFNA 2QG4A 3PJSK 1NQ4A 1VQ4P 2L5GB 1N7SA 1ZNVA 5GTHH 2R3SA 1N7SB 2QIWA 1Q2NA 3FX0A 4TT3H 2ZYGA 1BXIA 3A3YB 2V7QH 2JBGA 4H44D 1JO5A 3WUVA 4AUWA 2BCCG 4BXLA 5EJDA 2D2CB 2VLQA 2E76B 2KZIA 3CCUP 1SQVJ 2N9BA 4GKGA 1IFIA 1IFNA 3FWNA 1DV5A 2AVAA 2ZT9D 1FZEA 2WSCJ 3MD0A 2XT1A 1RE3C 5BVZA 3PLNA 3H0DA 4GR6A 1N86A 2HR3A 2MF4A 2K9JB 3IFMA 5CJ4A 2K9JA 2MVUA 1JNMA 1RE4C 2ZT9B 1VPCA 3GHGB 5DJTB 4U3FE 2KGCA 1MKMA 2KLUA 3G4SP 5CZDB 3KPEA 2FYUG 1JEKA 4H13D 1S5LH 3LMOA 1BE3J 2BQ1E 1RF0C 1SQVD 5AVQB 3NXSA 4UB8H 1R8EA 1EZVE 3OJAB 2OGUA
chains in the Genus database with same CATH topology
2Z44A 1PEUA 3G28A 3CCSP 1PEMA 2PEQA 3CMEP 1E6JP 2PY8A 3G21A 2QA4P 1N8RQ 3MGEA 2JO0A 2BHVA 1YJ9P 4COPA 2PEKA 2EG5A 5HGMA 2QEXP 5I4TG 2PEIA 1YIJP 3H47A 3CXCO 4WYMA 1D1DA 1VQLP 4XRQA 1QVFO 3E2DA 1RO0A 2JYLA 2PENA 3WBHA 1A8OA 3DPHA 3CCJP 1VQ4P 1VQ8P 3CC4P 1K30A 2CWOA 1QRJA 1YITP 2DGYA 3G1IA 1VQPP 3G6EP 2PEJA 1YI2P 5BS2A 3CCEP 3CCLP 1IUQA 2LF4A 4COCA 3I56P 4U0FA 1VQ5P 2OTJP 2Z46A 5JPAA 1EIAA 4U0DA 4XFXA 3CCVP 1VQ9P 1PEQA 2Z45A 3CC2P 2OARA 1YJNP 3Q20A 4U0BA 2ONTA 1K8AQ 4QNBA 5F2NA 4XFZA 1Q86Q 2XV6A 1RO2A 3RG6C 1BAJA 3G29A 3CC7P 1M1KQ 3CPWO 3HZQA 1A43A 1YHQP 1QVGO 4IPYA 2PEOA 3CCQP 3CCUP 2M8PA 1VQKP 1KC8Q 2XXMA 5DCKA 1JJ2O 5HGOA 3HYBA 3DS0A 1YJWP 1Q81Q 1K73Q 1M6NA 2PEMA 1VQ7P 2XT1A 1S72P 1KD1Q 4U0CA 5HGLA 3H0DA 2P9XA 1VQOP 1Q7YQ 4GR6A 3OW2O 4XFYA 1W2BO 2L6EA 1VQ6P 3B5IA 1VQMP 4M0IA 1VQNP 1ZMBA 5HGNA 3DS3A 2KODA 3CCRP 5BS1A 3DS1A 4PH1A 5F2OA 1AUMA 1EOQA 2EIAA 3G1GA 3NTEA 1M90Q 3P05A 3CCMP 3DS4A 2BUOA 3I55P 2JYGA 4XROA 4U0EA 5F2KA 3G4SP 3DS5A 3G0VA 2OTLP 2E1MA 3G26A 1K9MQ 3M1MA 3CD6P 2M8NA 3VRLC 3H4EA 1RNIA 3G71P 1NJIQ 2M8LA 1KQSO 1M6EX 4PH0A 2BQ1E 2EFJA 3DS2A 3LRYA 4U0AA 3CMAP 3DTJA 1M74A 1Q82Q 4GR2A 1PEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  1YIT P;  1M90 Q;  3CCQ P;  1VQP P;  3CCU P;  3G6E P;  3CCS P;  1VQK P;  3CCM P;  1KC8 Q;  1YI2 P;  3CCL P;  3CCE P;  3CME P;  1JJ2 O;  2QA4 P;  1N8R Q;  3I56 P;  3CC4 P;  1YJ9 P;  1VQ5 P;  1YJW P;  3CCV P;  1Q81 Q;  2OTJ P;  1VQ9 P;  3I55 P;  1K73 Q;  2QEX P;  3CC2 P;  3G4S P;  1VQ7 P;  1YIJ P;  1S72 P;  1KD1 Q;  1YJN P;  2OTL P;  3CD6 P;  1K9M Q;  3CXC O;  1K8A Q;  1VQL P;  1VQO P;  1Q7Y Q;  1QVF O;  3OW2 O;  3G71 P;  1W2B O;  1NJI Q;  1KQS O;  1VQ6 P;  1VQM P;  1VQN P;  1Q86 Q;  3CMA P;  3CCR P;  1Q82 Q;  3CC7 P;  3CCJ P;  1M1K Q;  1VQ4 P;  3CPW O;  1VQ8 P;  1YHQ P; 
#chains in the Genus database with same CATH topology
 2GZF A;  2I8D A;  5KAI E;  2Q9I A;  1H89 A;  5KAF E;  4ZKP A;  3RBZ A;  1L4A D;  1PGQ A;  1UII A;  2XV5 A;  1NTM J;  2LIU A;  2N6Z A;  1MV8 A;  1RF0 A;  3H1J J;  2OYI C;  3CLQ A;  2DGY A;  3G1I A;  3U1C A;  2KZJ A;  2KS1 A;  4WY4 B;  2OTJ P;  1RY3 A;  1CZQ A;  1P84 H;  1PP9 D;  2AEJ A;  3L70 D;  2KS1 B;  5KTB A;  2C9N Y;  2YKO A;  2OYH C;  5TIS H;  3FGA D;  1M1K Q;  2A45 I;  1SQX D;  3C8V A;  1SQX K;  1RQV A;  2H8P D;  3U59 A;  5AW5 B;  3D6Y A;  1JJ2 O;  2Z4E A;  2K9Y A;  5HGO A;  2CK3 H;  4L74 A;  2V4H A;  1FZA A;  1HGZ A;  5AVT B;  2E43 A;  2V7Q J;  1FE6 A;  5CCH D;  2AEF A;  2K37 A;  1CI6 A;  4H0L B;  3VMY A;  3DS3 A;  5BS1 A;  2IFM A;  1AUM A;  1S3J A;  3UIA A;  3NTE A;  2PGD A;  2FYN B;  1E5W A;  5KP6 B;  1EZV I;  2E76 C;  2KYV A;  1FZC B;  1KIL A;  5APW A;  1SQV K;  2ZYD A;  1ZR4 A;  1GK4 A;  1JMM A;  2KR5 A;  2JO1 A;  4N6J A;  1S2E A;  3H1I D;  3AED C;  4H13 B;  2QRX A;  3KHU A;  3HRN A;  2KUB A;  1IFD A;  2YXQ B;  4M3L A;  5AVS B;  3CXH H;  3S9O A;  2LKM A;  3BAT A;  4I1L A;  2KLV A;  3P32 A;  3QH9 A;  4PWV B;  3HUS C;  1FDI A;  2BHV A;  3Q5S A;  2FYU D;  5I4T G;  1IFP A;  1KYO H;  1HF9 A;  4XRQ A;  1USE A;  3E2D A;  1SQB G;  2B89 A;  4U3F J;  2WMM A;  1AQT A;  1Y9B A;  2KGE A;  3GZL A;  1VQ8 P;  2QSI A;  2JP3 A;  3KZI H;  2P10 A;  1S9K D;  3L70 J;  3II6 A;  1X9V A;  1L0N J;  3I56 P;  1IFJ A;  2Q5U A;  2LXC B;  2FXO A;  1H88 A;  3C1L A;  2WSE J;  3L36 A;  1JM0 A;  4JYB A;  2GYK A;  2WVR A;  2O01 N;  3H1H G;  4ASW A;  3M0D A;  1PFI A;  1DNY A;  1G1I A;  3PHL A;  1PP9 G;  1VDF A;  3M0D C;  3KXD A;  2FQ0 A;  2VLP A;  1NU1 D;  3OAK A;  2L4B A;  1S72 P;  1KD1 Q;  2LXB A;  2GZE A;  1VQ6 P;  3B5I A;  4WBA A;  3GG2 A;  3AE8 C;  3RGU A;  5F2O A;  4YPC A;  4B86 A;  5AVY B;  2AXT E;  1NTZ J;  3BVH A;  1GDT A;  1LP1 B;  2NPS D;  3M9Q A;  3M1M A;  1IFM A;  2M8N A;  1LWU A;  3H4E A;  1RE3 A;  3M9B A;  1NJI Q;  2IDB A;  3A0H H;  2EFJ A;  3LRY A;  1NU1 G;  3TGU G;  3VMA A;  5CCG A;  2MJZ A;  2L91 A;  1E79 H;  1KLP A;  5AW9 B;  2OYO A;  5BU8 B;  3HD7 D;  1KN7 A;  3CME P;  3I5C A;  2PY8 A;  3G21 A;  1ZME C;  2WPR A;  2EG5 A;  1KMI Z;  2YNY A;  3SFE C;  3GJN A;  4UB6 H;  4U7J A;  4L73 A;  2K93 A;  4XFJ A;  2LPK A;  3Q2Y A;  1VQL P;  3H25 A;  1RO0 A;  5AW4 B;  3H6P A;  4I6M C;  1A8O A;  3Q5R A;  2LR2 A;  5AVZ B;  1LTI C;  3PTZ A;  4WWI A;  4H2X C;  2CWO A;  1YIT P;  3RG2 A;  3L73 E;  2C0W A;  1OW6 A;  3S1K A;  3G6E P;  2BAS A;  1HVV A;  2E5Y A;  1X3O A;  1URQ B;  2JKV A;  2WPT A;  1EC5 A;  1URQ A;  1X79 B;  4PJ0 H;  1BCC J;  3H1K J;  5CMZ A;  3IR9 A;  4XFZ A;  2XV6 A;  1L0L K;  2OYI B;  4IL6 H;  1EDK A;  1NU1 J;  2K5X A;  3M06 A;  1QVG O;  1GXH A;  1SQV E;  1VQK P;  1L0L J;  3CX5 D;  3HYB A;  2VSQ A;  3DS0 A;  3H1L G;  3RK2 D;  2QJK C;  2MD9 A;  3FXD A;  4PD4 H;  2HG5 D;  2L6E A;  1VQN P;  1HQB A;  1GW4 A;  2G8Y A;  3L72 G;  5E79 E;  4DOJ A;  1LJ2 A;  2N5H A;  2Y0C A;  2QJP C;  3AEB C;  2E74 B;  1EQ7 A;  1BGY G;  1NHL A;  3DS5 A;  5TIS E;  3G0V A;  3CD6 P;  1L0N E;  3IF4 A;  4YXW H;  2E74 C;  1BSN A;  1ZXG A;  1GL2 A;  3VTP C;  2WPV B;  1JCD A;  1PEM A;  1TU3 F;  5AVV B;  1NGM B;  2QVA A;  4U3F D;  2YIU B;  5HGM A;  2Q3I A;  3MUD A;  1LTA C;  3CWB J;  1M57 D;  2A45 G;  5K5G B;  4NPD A;  5KJ7 D;  3P8C E;  1NTK G;  1NTZ E;  1BGY E;  3BRV B;  1NTZ K;  1GPJ A;  2M8R A;  3NMD A;  4EYY Q;  2XU6 A;  3L73 D;  1NWQ A;  1MUU A;  3V2Q A;  1L0L G;  1PGO A;  1K8A Q;  2L0Q A;  1LTG C;  5M1B A;  1EZV G;  1NOH A;  1IMQ A;  1Q86 Q;  3MZW B;  1ZRT D;  2QE7 H;  1JUN A;  3VMZ A;  3B71 A;  1K73 Q;  5APX A;  1QL1 A;  1LWU C;  1YBK A;  5HGL A;  3IN6 A;  3B5N C;  3L71 J;  1OMI A;  4GT1 A;  2O01 J;  1L4A B;  2KOP A;  2GZJ A;  5AW2 B;  2KOS A;  1R5S A;  1L0N K;  1L4A A;  4Y99 B;  2EIA A;  3TGU D;  3M9H A;  4GOD A;  1HBW A;  1J1D C;  2KXP B;  2ROQ A;  3H1J D;  4Y99 C;  3GW6 A;  2YMY A;  2PNG A;  3KDP B;  3EWK A;  2FVA A;  4NEO A;  4PD4 E;  1NTK J;  1NU1 K;  4LGD E;  2O1J A;  1FZB A;  2WWW A;  1FZF A;  4GIF A;  2JWA A;  2PEI A;  1X22 A;  4XE5 B;  2K88 A;  3RK2 C;  2N98 A;  2RH0 A;  2OYH B;  3KQG A;  3H1L D;  1GXG A;  2E75 B;  4H44 B;  2JGP A;  2N50 A;  3H1J G;  1FBM A;  3BCC D;  2CNR A;  5BS2 A;  2HLO A;  1LGH B;  2WZ7 A;  4U0D A;  1BE3 D;  3L4F A;  3CC2 P;  3C9I A;  3MP7 B;  1L0I A;  4RJT A;  2E42 A;  1SFC A;  1PV3 A;  2R5B A;  3Q5P A;  2FAC A;  3PP5 A;  3G29 A;  3CC7 P;  3HE4 B;  1LTB C;  3HE4 A;  4PV1 B;  2RN0 A;  5APT A;  3V4W A;  5KKZ C;  5KP8 B;  3R2P A;  1HJ0 A;  4DT0 A;  1CW5 A;  1Q7Y Q;  2KWL A;  1A02 J;  1SFC C;  3HUS B;  2JWD A;  4H13 C;  4I2L C;  4D6T D;  2Q1K A;  3R4Y A;  4DG9 A;  3Q3D A;  1EOQ A;  3OA7 A;  3TYY A;  4JPZ B;  2QM8 A;  1ACP A;  3L73 G;  1U7J A;  2K3R A;  3I55 P;  1MZ9 A;  5KLV D;  1NYH A;  1IZN B;  1K05 A;  1L0N D;  3AEG C;  1GU5 A;  5EW5 E;  4YXD C;  4YTP C;  2MVV A;  1EZV D;  1OX3 A;  3DS2 A;  2FAE A;  1L2P A;  4WY4 A;  4IL6 E;  2GZI A;  1SFC D;  2YXR B;  2LML A;  1M8O B;  3EJE A;  4H0L C;  5KJ7 A;  2KG6 A;  1H8A A;  2O3J A;  2Q7C A;  3EJB A;  1T6A A;  5AW1 B;  5GTH E;  3DPH A;  2WQY C;  1DIP A;  2HPC A;  1SQP K;  3A2A A;  1SQB J;  2KOG A;  1Y8A A;  1RH5 B;  4COC A;  3O8Z A;  2K1A A;  5CCH C;  2FYU J;  1RF1 A;  3QWO C;  2W90 A;  2OAR A;  1ZN5 A;  2WIT A;  2AFE A;  5F2N A;  1IC2 A;  3L72 D;  2WPS A;  1KQL A;  3BCC G;  1QGK B;  2PEO A;  4O9B A;  4TLF A;  3L75 J;  2LL8 A;  2W6J H;  1T8K A;  5AVU B;  1JY3 O;  4QMA A;  3L70 G;  3W68 A;  2AXT H;  1G1J A;  2B9B A;  2WTY A;  4IFM A;  1HWT C;  1L4A C;  4C46 A;  4JF7 A;  2YKP A;  2JU1 A;  5F2K A;  2E1M A;  1Y47 A;  1J1E B;  5KLI C;  4ASV A;  1EXI A;  3SWY A;  4EIJ A;  3RL0 C;  1A02 F;  1N73 C;  2AXC A;  2JEE A;  5B5E E;  2JU2 A;  2KI7 B;  1FDM A;  1W5C E;  3CXC O;  1LTS C;  1NAY A;  1SQV G;  1T2K C;  2ZYA A;  1OXZ A;  1J1D B;  4U3F G;  2R44 A;  4Y28 J;  1GZL A;  5APY A;  2KGD A;  2XNX A;  3M91 A;  2ZAE B;  3L74 D;  2KOR A;  1JTH B;  1X8Y A;  4KJM A;  1AFO A;  4H2Y C;  1KYO E;  5E79 H;  2E75 C;  2Z45 A;  1NTM K;  4OWF A;  2KK7 A;  1WRG A;  4HKG A;  2JJL A;  2GA1 A;  4PD4 D;  1EDJ A;  1LP1 A;  3AE7 C;  2IYO A;  2IZ0 A;  3WMM 0;  1NTZ D;  1KC8 Q;  1NTM E;  2D2C D;  1NTK D;  2GUS A;  1H0T B;  1KB9 E;  3SFD C;  3H1J E;  1JB0 J;  1KB9 I;  2FXP A;  1VQO P;  3L71 E;  4W7Y A;  2IZ1 A;  1FJK A;  2KOD A;  3CCR P;  1YYC A;  5AVX B;  1AVY A;  2FQ1 A;  5AW8 B;  2HPC B;  2C9L Y;  2E5T A;  1KQG B;  1SQQ G;  1FS0 E;  2JYG A;  2G3A A;  1DD3 A;  2M5A A;  3G26 A;  4PJ0 E;  1RF1 B;  1KYO I;  3BAS A;  3V4Q A;  3EJD A;  2CPS A;  3E1I A;  5HV8 A;  2VLO A;  3CI9 A;  3LID A;  1VL2 A;  2PEQ A;  5C39 A;  1KZU B;  3G9R A;  3MGE A;  2JO0 A;  2Q3E A;  1L0H A;  1DD4 A;  4JYC A;  3P7K A;  1N7S D;  2YMK A;  1D1D A;  1OZH A;  4BRY A;  3V6I A;  1QVF O;  1N7S C;  4BRY B;  1HH0 A;  5CCH A;  1ZOY C;  2W6B A;  4AQR D;  1JMB A;  1FOS F;  1YI2 P;  1AV1 A;  4U0F A;  2FYU E;  1VQ9 P;  2XZR A;  3D6Z A;  3CL3 D;  3TSI A;  1G2C B;  3V2N A;  1PL5 A;  4D6T G;  4K35 A;  1BE3 G;  3RK3 B;  1OW8 A;  2FXM A;  2MY5 A;  2BCC D;  2Q6Q A;  5DCK A;  4RES B;  2WSF H;  3V2R A;  2K2Q A;  1S5L X;  3F5H A;  4N78 E;  1GL2 B;  4R4M A;  5AVW B;  1SQQ J;  1SQP E;  1W2B O;  2H7H A;  2LKI A;  2YO2 A;  4HKZ H;  4PXH B;  1GMJ A;  4IZ6 A;  4PV1 D;  1FDO A;  2GZG A;  2M3E A;  4ZNC A;  3B8E B;  3RK2 B;  1LT9 A;  3GMA A;  2PAJ A;  1M1J A;  3FXE A;  2MKV A;  1ZW0 A;  3G71 P;  2PP6 A;  3CMA P;  2H88 C;  1U7M A;  3AE2 C;  2A06 E;  5HVC A;  4XA4 A;  4GOF A;  2KW2 A;  1FZC C;  1DX7 A;  2QNW A;  4ZMD A;  2QEX P;  1H0T A;  2KP8 A;  2NO8 A;  3RL0 g;  2PFX A;  1KB9 H;  4WY4 D;  4HB1 A;  2IBZ G;  2PEN A;  1DEB A;  3BCC J;  3CCJ P;  1K30 A;  5BU5 A;  4OH8 B;  1VQP P;  2R3C A;  2PEJ A;  1N73 B;  3CCE P;  1EDI A;  1N73 A;  3CCV P;  1BCC D;  3H1K D;  4A7P A;  4N3Y B;  3RL0 B;  4QNB A;  3T97 B;  4R0M A;  2KNC B;  1UNK A;  3T97 A;  3F89 A;  3AEE C;  2KNC A;  4HH2 A;  2H89 C;  1EDL A;  2XZ0 D;  4IPY A;  3B4S A;  3N4X A;  3VP8 A;  4H2W C;  2PEM A;  1VQ7 P;  1QL2 A;  1KB9 D;  4WB4 A;  2FFD C;  3RK3 C;  2E76 D;  4HJG H;  1PPJ E;  1FR2 A;  2N1T B;  2LIW A;  2MR8 A;  3CCM P;  5AW6 B;  2A45 H;  3O6Q B;  2KIK A;  3USS A;  3SWF A;  3O6Q A;  2PRR A;  3L73 J;  1FJP A;  4IOI H;  1WT6 A;  2GDY A;  3L75 G;  1AJY A;  4PH0 A;  4BPG A;  1OVV A;  3CX5 I;  5KJ7 C;  3LIE A;  1YQ4 C;  2E74 D;  3B4Q A;  4LC1 A;  1SFC B;  3H1H D;  1SQP G;  1X0T A;  4GOE A;  3VP9 A;  4KHX A;  2BEZ F;  3MUD C;  2JYL A;  1IK9 A;  1R5L A;  3WBH A;  3A7O A;  5CJ0 A;  2N9Y B;  5KAF H;  1UJZ A;  2M3B A;  1OVR A;  2FBW C;  2Z5I A;  1DEE G;  1KFN A;  2NRG A;  1FAV A;  1LT9 B;  1PEQ A;  2KSE A;  3HUS A;  3CWB G;  2I1K A;  3RK3 D;  1WMK A;  3NFQ A;  2YIU C;  1JY2 P;  2J59 M;  2L22 A;  4OVN F;  3HZQ A;  1YHQ P;  1S4X A;  2WT7 B;  4N78 D;  1SQB K;  4C7N A;  3B5N D;  2IBZ I;  1RHZ B;  5KAI H;  1XTG B;  2ZT9 C;  1D7M A;  2O01 H;  4UB8 E;  1IK7 A;  1RE4 A;  1Z56 A;  1KYO D;  1JY2 O;  2P58 A;  3CWB E;  4PH1 A;  3L74 E;  2M5R A;  3P8C D;  3B5N A;  1M7L A;  3P05 A;  3SSU A;  3RBX A;  5KLI B;  1SS1 A;  2BUO A;  3CXH D;  5KKZ B;  3BCC E;  1CSB A;  4U0E A;  3WUT A;  5AW7 B;  1K9M Q;  4U0A A;  1E0H A;  1LTJ B;  2HFE D;  4GR2 A;  4UHP B;  3HTK A;  2Y9Z A;  1FC2 C;  1DH3 A;  2QA4 P;  2FAD A;  1OWA A;  3MGN A;  1PP9 E;  2FKW B;  3GHG C;  3VOP A;  1SLQ A;  5DJU B;  1SQQ D;  1NO4 A;  4D6T J;  1KTM A;  1SQQ K;  2GM4 A;  3ZDM A;  1BDC A;  1HGV A;  2FY8 A;  3GF3 A;  3CCL P;  1T8Z A;  2YO3 A;  1AA0 A;  3L71 G;  3EQ2 A;  4PD4 I;  2W6A A;  1VQ5 P;  1EIA A;  3TGU E;  1HTL C;  2OYH A;  3A0H E;  1S1C X;  2M0B A;  1KFM A;  5AW3 B;  1SVF A;  3A0B E;  1A43 A;  2FYN C;  2ZVN B;  4HYT B;  2VLN A;  2AF8 A;  3L75 E;  2P67 A;  3SWK A;  2IX7 C;  1T2K D;  2CG5 B;  3H1L J;  5KLV J;  2HOD A;  4U0C A;  1NTK E;  3JC2 2;  1KIL B;  2P9X A;  2HOD B;  4OGQ B;  5GTI H;  4F37 A;  3DS4 A;  2H43 A;  1GL2 D;  1FU1 A;  1U57 A;  2WSC H;  2P2U A;  1OIP A;  1BE3 E;  1M6E X;  1JTH A;  3WU2 E;  1GU4 A;  1JY2 N;  1KV4 A;  1F80 D;  1VKU A;  3H32 A;  3G28 A;  1OW7 A;  1E6J P;  1N8R Q;  4WY4 C;  5KLV G;  2GDW A;  3CXH E;  2W8Z A;  1JY3 P;  2WT7 A;  4C7N B;  3H47 A;  2ITA A;  4GDO A;  2IBZ D;  4C7R A;  1BDD A;  1AQ5 A;  1Z6M A;  4L76 A;  3PRJ A;  3CC4 P;  1EXJ A;  2J58 A;  2YKQ A;  2QM7 A;  3U43 A;  3L70 E;  2LF4 A;  3GLM A;  4XFX A;  3VN0 A;  1KQF B;  2XZ1 C;  3GKL C;  3L74 J;  4EI2 A;  1J2J B;  1CEI A;  1ZLL A;  4IL6 X;  2A06 G;  4K3A A;  2Y9Y A;  3RG6 C;  2GDX A;  2FQ2 A;  5AW0 B;  3CPW O;  2ERH A;  1LTJ A;  3RK3 E;  4H0L D;  4BWN A;  2CPB A;  3AEA C;  3HTK B;  2AFD A;  2QJY C;  4MRT C;  1YQ3 C;  3L35 A;  4CA3 A;  1OVU A;  2OTK E;  2JAZ A;  5APQ A;  1KOR A;  3CXH I;  4KT0 J;  1KIL D;  1PGJ A;  2J5U A;  5HGN A;  1LT9 C;  3TGU J;  3DS1 A;  5L8R J;  3U1A A;  3D70 A;  2C0X A;  2KG8 A;  3EFG A;  3V5B A;  4PV1 C;  2K0X A;  2B88 A;  1BCC E;  3H1K E;  1BSH A;  3L71 D;  4D6T E;  5CCG D;  3H1H E;  1PIX A;  1HUC A;  3AE3 C;  4XRO A;  3W67 A;  1LT1 A;  2K92 A;  1PGP A;  3ITK A;  5KLV K;  1VF5 C;  4NPF X;  3JCU E;  2JQ4 A;  1P84 E;  2OQQ A;  1L0L E;  4W7Z A;  2JR8 A;  3P8M C;  4L75 A;  2AEM A;  1PEO A;  5EFW B;  2R32 A;  3N7N A;  1EMV A;  1CI6 B;  5CHX A;  4I7Z B;  2Z5H A;  1AF8 A;  2LTE A;  2ZJS E;  1NKN A;  2XKM A;  1KIL E;  1PP9 J;  2DNW A;  4Z1M H;  1FZC A;  2ZFC A;  2KOQ A;  3H1I J;  3NTN A;  1GD2 E;  1AYI A;  3L72 J;  1T3J A;  1NKZ B;  2BCC J;  5B66 H;  3H1L E;  1S9K E;  2OYI A;  1SQX E;  3CWB D;  1YJN P;  2P1J A;  2IPP A;  4MN4 C;  3AE1 C;  5APV A;  3S4R A;  1ZP0 C;  1N7L A;  3MHV A;  2X2B A;  1RO2 A;  2Y0E A;  1QX8 A;  2DW3 A;  3V2P A;  2FYU K;  1P84 D;  1NU1 E;  1SQP D;  2M8P A;  3WU2 H;  1JCC A;  2UWJ E;  1GK6 A;  4IFF A;  3H32 B;  1BGY J;  1ZV8 A;  2JDI H;  3HD7 C;  1YJW P;  3BRT B;  1Q81 Q;  4R4L A;  1JY3 N;  1M6N A;  1BGY D;  4UB6 E;  2VRS A;  3KZI E;  3M0A A;  3L37 A;  2B87 B;  1NTZ G;  3TDK A;  4XFY A;  5TJH A;  2RKL A;  1ZMB A;  1VHN A;  3AEF C;  2FHS C;  1NVO A;  5CBO A;  3G1G A;  2NPS C;  1M90 Q;  5GTI E;  4I7Z C;  2NZ2 A;  2FFD A;  2QJY B;  4OGQ C;  5AVR B;  2K0D X;  2RMZ A;  5B66 E;  4IFD K;  3EFF K;  2XDJ A;  4OGQ D;  2EHS A;  1HJB A;  2KG9 A;  4DJG A;  1RNI A;  2SPZ A;  1KQS O;  5APS A;  2A06 D;  1ZRT E;  1Q82 Q;  3A0B H;  1AVO A;  2N1T C;  3LW5 J;  3AE6 C;  2Z44 A;  2M5A B;  5CBN A;  2FVF A;  3Q1M A;  4W80 A;  1LTT C;  5H2F E;  2E75 D;  1MFT A;  2K94 A;  3MTU E;  2MR7 A;  2WSS H;  1LWU B;  3H1K G;  2CGQ A;  1BCC G;  1QRJ A;  5B5E H;  2N6Y A;  3PH0 A;  3GF7 A;  1IUQ A;  1PPJ G;  2LOL A;  1YTZ I;  5JPA A;  3GZM A;  3D71 A;  1W2E A;  2ONT A;  4BPH A;  3A5T A;  3WUU A;  3H1H J;  1FZG A;  3LW5 H;  2ZVO B;  2W83 C;  3H1I G;  2N5I A;  1URQ D;  4JQ0 D;  1QEX A;  1G2C A;  2XXM A;  5KP7 B;  2N1T D;  1LTJ C;  2KB7 P;  1VF5 D;  1GTW A;  2BEQ D;  2ZXE B;  5KLV E;  3TK1 A;  1NTM D;  1RF1 C;  4EDF A;  3OW2 O;  4JBZ A;  3ABV C;  2KOO A;  3JCU H;  1ZR2 A;  3VMX A;  2D2C C;  1T3U A;  2GUV A;  7CEI A;  1MZ8 A;  1M1J C;  4NPE A;  1NTK K;  3TF5 A;  1N2D C;  4H44 C;  2BCC E;  2OTL P;  5CCG C;  3JSV C;  3L75 D;  3AE9 C;  2I1J A;  4DZO A;  3DTJ A;  4RKU J;  1M74 A;  1IJD B;  1S5L E;  1Q90 D;  1NTM G;  2P7J A;  3CCS P;  1M56 D;  3E7K A;  1M1J B;  4EOT A;  2QJP B;  2PEK A;  1IMP A;  4LLH A;  2JB0 A;  1K04 A;  3NY7 B;  1YIJ P;  4WYM A;  2CQ8 A;  2FYZ A;  2B87 A;  1SQB D;  2Y0D A;  4ZKU A;  3AEC C;  3L72 E;  3HE5 A;  2HYN A;  1OFC X;  3HE5 B;  2QJK B;  4AYC A;  1SQQ E;  3GHG A;  1SQP J;  3L74 G;  3KYQ A;  2K0Y A;  2Z46 A;  1JOC A;  3AE4 C;  1LNQ A;  1SQX J;  2W27 A;  2FFD B;  1RQU A;  2KGA A;  1L0N G;  2POH A;  3Q20 A;  4U0B A;  3B5N B;  3G3Z A;  1URQ C;  1BAJ A;  3IAO A;  5APU A;  3VYI A;  1PPJ D;  3CCQ P;  1L0L D;  4QKO A;  2IBZ E;  2WPQ A;  1HY8 A;  2WSF J;  1UIX A;  2O1K A;  2R5D A;  3RL0 D;  2ZXX A;  1XTC C;  5H2F H;  2WSE H;  3MIW A;  1OR5 A;  2NPS B;  3TNU B;  1SQB E;  1USD A;  1VF5 B;  4CPG A;  1J1E C;  2NPS A;  3AE5 C;  3TNU A;  1VQM P;  4M0I A;  1QLE D;  1GW3 A;  3CX5 H;  4DCK A;  1MFZ A;  3HD7 B;  1NAF A;  2EHT A;  2XND H;  1P84 I;  3HD7 A;  2FVE A;  1GL2 C;  1SQX G;  1KIL C;  3VRL C;  2N1T A;  2L9F A;  2M8L A;  1IO4 A;  4BPF A;  1NH4 A;  1PEU A;  3E1R A;  4RO0 A;  1YJ9 P;  3FWL A;  4COP A;  1SP4 A;  2IYP A;  1FOS E;  3H1I E;  3K5B A;  1PZQ A;  3CX5 E;  2KSJ A;  3CE7 A;  1YTZ T;  4WVZ A;  2IFN A;  2QG4 A;  3PJS K;  1NQ4 A;  1VQ4 P;  2L5G B;  1N7S A;  1ZNV A;  5GTH H;  2R3S A;  1N7S B;  2QIW A;  1Q2N A;  3FX0 A;  4TT3 H;  2ZYG A;  1BXI A;  3A3Y B;  2V7Q H;  2JBG A;  4H44 D;  1JO5 A;  3WUV A;  4AUW A;  2BCC G;  4BXL A;  5EJD A;  2D2C B;  2VLQ A;  2E76 B;  2KZI A;  3CCU P;  1SQV J;  2N9B A;  4GKG A;  1IFI A;  1IFN A;  3FWN A;  1DV5 A;  2AVA A;  2ZT9 D;  1FZE A;  2WSC J;  3MD0 A;  2XT1 A;  1RE3 C;  5BVZ A;  3PLN A;  3H0D A;  4GR6 A;  1N86 A;  2HR3 A;  2MF4 A;  2K9J B;  3IFM A;  5CJ4 A;  2K9J A;  2MVU A;  1JNM A;  1RE4 C;  2ZT9 B;  1VPC A;  3GHG B;  5DJT B;  4U3F E;  2KGC A;  1MKM A;  2KLU A;  3G4S P;  5CZD B;  3KPE A;  2FYU G;  1JEK A;  4H13 D;  1S5L H;  3LMO A;  1BE3 J;  2BQ1 E;  1RF0 C;  1SQV D;  5AVQ B;  3NXS A;  4UB8 H;  1R8E A;  1EZV E;  3OJA B;  2OGU A; 
#chains in the Genus database with same CATH homology
 2Z44 A;  1PEU A;  3G28 A;  3CCS P;  1PEM A;  2PEQ A;  3CME P;  1E6J P;  2PY8 A;  3G21 A;  2QA4 P;  1N8R Q;  3MGE A;  2JO0 A;  2BHV A;  1YJ9 P;  4COP A;  2PEK A;  2EG5 A;  5HGM A;  2QEX P;  5I4T G;  2PEI A;  1YIJ P;  3H47 A;  3CXC O;  4WYM A;  1D1D A;  1VQL P;  4XRQ A;  1QVF O;  3E2D A;  1RO0 A;  2JYL A;  2PEN A;  3WBH A;  1A8O A;  3DPH A;  3CCJ P;  1VQ4 P;  1VQ8 P;  3CC4 P;  1K30 A;  2CWO A;  1QRJ A;  1YIT P;  2DGY A;  3G1I A;  1VQP P;  3G6E P;  2PEJ A;  1YI2 P;  5BS2 A;  3CCE P;  3CCL P;  1IUQ A;  2LF4 A;  4COC A;  3I56 P;  4U0F A;  1VQ5 P;  2OTJ P;  2Z46 A;  5JPA A;  1EIA A;  4U0D A;  4XFX A;  3CCV P;  1VQ9 P;  1PEQ A;  2Z45 A;  3CC2 P;  2OAR A;  1YJN P;  3Q20 A;  4U0B A;  2ONT A;  1K8A Q;  4QNB A;  5F2N A;  4XFZ A;  1Q86 Q;  2XV6 A;  1RO2 A;  3RG6 C;  1BAJ A;  3G29 A;  3CC7 P;  1M1K Q;  3CPW O;  3HZQ A;  1A43 A;  1YHQ P;  1QVG O;  4IPY A;  2PEO A;  3CCQ P;  3CCU P;  2M8P A;  1VQK P;  1KC8 Q;  2XXM A;  5DCK A;  1JJ2 O;  5HGO A;  3HYB A;  3DS0 A;  1YJW P;  1Q81 Q;  1K73 Q;  1M6N A;  2PEM A;  1VQ7 P;  2XT1 A;  1S72 P;  1KD1 Q;  4U0C A;  5HGL A;  3H0D A;  2P9X A;  1VQO P;  1Q7Y Q;  4GR6 A;  3OW2 O;  4XFY A;  1W2B O;  2L6E A;  1VQ6 P;  3B5I A;  1VQM P;  4M0I A;  1VQN P;  1ZMB A;  5HGN A;  3DS3 A;  2KOD A;  3CCR P;  5BS1 A;  3DS1 A;  4PH1 A;  5F2O A;  1AUM A;  1EOQ A;  2EIA A;  3G1G A;  3NTE A;  1M90 Q;  3P05 A;  3CCM P;  3DS4 A;  2BUO A;  3I55 P;  2JYG A;  4XRO A;  4U0E A;  5F2K A;  3G4S P;  3DS5 A;  3G0V A;  2OTL P;  2E1M A;  3G26 A;  1K9M Q;  3M1M A;  3CD6 P;  2M8N A;  3VRL C;  3H4E A;  1RNI A;  3G71 P;  1NJI Q;  2M8L A;  1KQS O;  1M6E X;  4PH0 A;  2BQ1 E;  2EFJ A;  3DS2 A;  3LRY A;  4U0A A;  3CMA P;  3DTJ A;  1M74 A;  1Q82 Q;  4GR2 A;  1PEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...