2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
b'GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
4NEOA 2FAEA 2KOQA 2FVEA 4DG9A 3GZMA 3RG2A 3EJDA 5KP6B 4MRTC 2JU2A 1ACPA 2KR5A 2LIWA 2MR7A 1OR5A 2KOSA 2CGQA 2FVAA 1VKUA 4PWVB 1X3OA 2KOPA 3CE7A 2AFEA 2GDWA 1L0IA 2K94A 2K2QA 2CG5B 2L9FA 2LIUA 4BPHA 2K93A 2L22A 1DNYA 2FHSC 2XZ0D 2JQ4A 2MY5A 2PNGA 1T8KA 1NQ4A 2K92A 4CA3A 2XZ1C 2CQ8A 5EJDA 1DV5A 2KG6A 4BPGA 2N6YA 2FVFA 2DNWA 2N6ZA 2QNWA 2MD9A 2KWLA 2GDXA 2MR8A 2FADA 1KLPA 2K0YA 1F80D 2KOOA 2MF4A 5HV8A 2MVUA 2ROQA 2AF8A 2AVAA 4R0MA 1L0HA 2LMLA 2LOLA 2N5HA 4H2WC 4BPFA 2K0XA 2LTEA 2KG9A 2X2BA 3NY7B 3LMOA 2KGEA 2AFDA 2EHTA 2KORA 2FQ2A 2KW2A 2VSQA 4IZ6A 5CZDB 2M5RA 4H2YC 5HVCA 2KG8A 5KP7B 2LPKA 1HQBA 2LKIA 2GDYA 2KGCA 2LL8A 2N50A 5KP8B 3EJBA 1HY8A 2KGDA 3GZLA 4PXHB 3EJEA 2EHSA 2L0QA 2FACA 2JU1A 2FQ1A 2N5IA 4HKGA 2KGAA 2N98A 2CNRA 2FQ0A 2JGPA 4H2XC 2MVVA 2L4BA 1AF8A
chains in the Genus database with same CATH superfamily
2PEQA 3CCUP 1M74A 3CCRP 3DS1A 3GZMA 5BS2A 1M6EX 1Q7YQ 2M8NA 4MRTC 1ACPA 2KR5A 2PEJA 2CGQA 2FVAA 2JBGA 3MGEA 3E2DA 3G1IA 4PWVB 3CC7P 1M1KQ 1MZ8A 3G21A 1DNYA 2JO0A 2FHSC 2DGYA 2K92A 2LF4A 5F2OA 2K0DX 2XZ1C 5I4TG 4BPGA 3DS4A 2N6ZA 2QNWA 2MR8A 2L6EA 1EIAA 5HV8A 3CCMP 4BPFA 4H2WC 1Q82Q 3DS3A 1YJ9P 4XROA 1UNKA 2KGEA 2ERHA 2KORA 2GZGA 2P9XA 4U0AA 3G1GA 2VSQA 4IZ6A 2M5RA 4H2YC 1Q81Q 1VQ5P 2KG8A 1K8AQ 2LPKA 5DCKA 2LKIA 3U43A 3CMEP 3DPHA 3G4SP 3I56P 2E1MA 5JPAA 2KGDA 1Z6MA 5HGLA 1VQ9P 2QA4P 2L0QA 1VQ8P 2JU1A 2KGAA 2CNRA 1YITP 3RG6C 2L4BA 1BXIA 3LRYA 2FAEA 1VQ7P 2KOQA 2FVEA 1YJNP 1K30A 3DTJA 2EFJA 1S72P 2LIWA 1M90Q 1VQKP 2JB0A 2GZJA 2PEIA 3CPWO 2KOSA 2VLQA 3CC4P 1NJIQ 1X3OA 2KOPA 2AFEA 2GDWA 1L0IA 2K94A 3P05A 2CG5B 3B4QA 2EG5A 2LIUA 3GKLC 1KC8Q 3CMAP 1E6JP 2PNGA 1T8KA 4U0CA 1ZMBA 1IMPA 4CA3A 2Z46A 5EJDA 1DV5A 2N6YA 2OARA 2MD9A 2GYKA 2GDXA 2PY8A 2FADA 2K0YA 2VLPA 1YI2P 2CWOA 2LMLA 2K0XA 2GZIA 2LTEA 2KG9A 3Q20A 2XXMA 3H0DA 2EHTA 3NTEA 3CCVP 2KW2A 1CEIA 2EIAA 4XFYA 3G71P 1N8RQ 4XRQA 5HVCA 1VQLP 3DS2A 4GR2A 1HQBA 5HGNA 4QKOA 2KGCA 3M1MA 7CEIA 3CCLP 2VLNA 1HY8A 4PH0A 3HYBA 3GZLA 1RO2A 2FQ1A 2N5IA 3CCSP 2N98A 2FQ0A 2JGPA 2PEKA 4H2XC 1QVFO 3G0VA 4NEOA 1E0HA 3RG2A 2M8LA 4U0EA 5KP6B 1KQSO 4GR6A 1VQOP 2BUOA 2MR7A 2Z44A 1OR5A 3H47A 4XFXA 3OW2O 1YJWP 1JJ2O 4BPHA 3B5IA 3GJNA 1GXHA 2XZ0D 2GZFA 3I55P 2MY5A 4U0DA 1NQ4A 2GZEA 2KG6A 1GPJA 2FVFA 2DNWA 2XT1A 2PENA 4IPYA 2KWLA 1KLPA 1F80D 2KOOA 2ROQA 2AF8A 4U0BA 4M0IA 1K9MQ 4R0MA 2N5HA 2LOLA 2WPTA 3NY7B 1FR2A 3LMOA 2PEMA 2AFDA 2OTJP 1EMVA 2BHVA 2OTLP 4COCA 1A8OA 1QVGO 4XFZA 2GDYA 4U0FA 2LL8A 2N50A 4COPA 1RNIA 5KP8B 3EJBA 1VHNA 2KODA 1VQPP 3WBHA 1YHQP 2FACA 4HKGA 2QEXP 1GXGA 2JAZA 1AF8A 1M6NA 1UJZA 4UHPB 4DG9A 2ONTA 3EJDA 1D1DA 1RO0A 3H4EA 2JU2A 5HGMA 3DS0A 2JYLA 3G29A 5EW5E 1VKUA 3CE7A 1W2BO 1K73Q 2K2QA 2L9FA 4QNBA 2K93A 2NO8A 2L22A 5HGOA 2M8PA 1KD1Q 2JQ4A 3G26A 1AYIA 1YIJP 4WYMA 3CCQP 1VQNP 3CXCO 1VQMP 2CQ8A 2PEOA 3G6EP 3VRLC 2Z45A 3CD6P 2MF4A 2MVUA 1BAJA 1IMQA 1ZNVA 2AVAA 1L0HA 1IUQA 2X2BA 4PH1A 3G28A 1Q86Q 1VQ6P 4F37A 2FQ2A 3DS5A 5F2NA 1QRJA 3CCJP 2VLOA 5CZDB 3CC2P 3HZQA 5KP7B 5BS1A 1EOQA 5F2KA 4PXHB 3EJEA 2EHSA 1AUMA 1VQ4P 2JYGA 1A43A 3CCEP 2XV6A 2MVVA 2K5XA
chains in the Genus database with same CATH topology
4NEOA 2FAEA 2KOQA 2FVEA 4DG9A 3GZMA 3RG2A 3EJDA 5KP6B 4MRTC 2JU2A 1ACPA 2KR5A 2LIWA 2MR7A 1OR5A 2KOSA 2CGQA 2FVAA 1VKUA 4PWVB 1X3OA 2KOPA 3CE7A 2AFEA 2GDWA 1L0IA 2K94A 2K2QA 2CG5B 2L9FA 2LIUA 4BPHA 2K93A 2L22A 1DNYA 2FHSC 2XZ0D 2JQ4A 2MY5A 2PNGA 1T8KA 1NQ4A 2K92A 4CA3A 2XZ1C 2CQ8A 5EJDA 1DV5A 2KG6A 4BPGA 2N6YA 2FVFA 2DNWA 2N6ZA 2QNWA 2MD9A 2KWLA 2GDXA 2MR8A 2FADA 1KLPA 2K0YA 1F80D 2KOOA 2MF4A 5HV8A 2MVUA 2ROQA 2AF8A 2AVAA 4R0MA 1L0HA 2LMLA 2LOLA 2N5HA 4H2WC 4BPFA 2K0XA 2LTEA 2KG9A 2X2BA 3NY7B 3LMOA 2KGEA 2AFDA 2EHTA 2KORA 2FQ2A 2KW2A 2VSQA 4IZ6A 5CZDB 2M5RA 4H2YC 5HVCA 2KG8A 5KP7B 2LPKA 1HQBA 2LKIA 2GDYA 2KGCA 2LL8A 2N50A 5KP8B 3EJBA 1HY8A 2KGDA 3GZLA 4PXHB 3EJEA 2EHSA 2L0QA 2FACA 2JU1A 2FQ1A 2N5IA 4HKGA 2KGAA 2N98A 2CNRA 2FQ0A 2JGPA 4H2XC 2MVVA 2L4BA 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEO A;  2FAE A;  2KOQ A;  2FVE A;  4DG9 A;  3GZM A;  3RG2 A;  3EJD A;  5KP6 B;  4MRT C;  2JU2 A;  1ACP A;  2KR5 A;  2LIW A;  2MR7 A;  1OR5 A;  2KOS A;  2CGQ A;  2FVA A;  1VKU A;  4PWV B;  1X3O A;  2KOP A;  3CE7 A;  2AFE A;  2GDW A;  1L0I A;  2K94 A;  2K2Q A;  2CG5 B;  2L9F A;  2LIU A;  4BPH A;  2K93 A;  2L22 A;  1DNY A;  2FHS C;  2XZ0 D;  2JQ4 A;  2MY5 A;  2PNG A;  1T8K A;  1NQ4 A;  2K92 A;  4CA3 A;  2XZ1 C;  2CQ8 A;  5EJD A;  1DV5 A;  2KG6 A;  4BPG A;  2N6Y A;  2FVF A;  2DNW A;  2N6Z A;  2QNW A;  2MD9 A;  2KWL A;  2GDX A;  2MR8 A;  2FAD A;  1KLP A;  2K0Y A;  1F80 D;  2KOO A;  2MF4 A;  5HV8 A;  2MVU A;  2ROQ A;  2AF8 A;  2AVA A;  4R0M A;  1L0H A;  2LML A;  2LOL A;  2N5H A;  4H2W C;  4BPF A;  2K0X A;  2LTE A;  2KG9 A;  2X2B A;  3NY7 B;  3LMO A;  2KGE A;  2AFD A;  2EHT A;  2KOR A;  2FQ2 A;  2KW2 A;  2VSQ A;  4IZ6 A;  5CZD B;  2M5R A;  4H2Y C;  5HVC A;  2KG8 A;  5KP7 B;  2LPK A;  1HQB A;  2LKI A;  2GDY A;  2KGC A;  2LL8 A;  2N50 A;  5KP8 B;  3EJB A;  1HY8 A;  2KGD A;  3GZL A;  4PXH B;  3EJE A;  2EHS A;  2L0Q A;  2FAC A;  2JU1 A;  2FQ1 A;  2N5I A;  4HKG A;  2KGA A;  2N98 A;  2CNR A;  2FQ0 A;  2JGP A;  4H2X C;  2MVV A;  2L4B A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 2PEQ A;  3CCU P;  1M74 A;  3CCR P;  3DS1 A;  3GZM A;  5BS2 A;  1M6E X;  1Q7Y Q;  2M8N A;  4MRT C;  1ACP A;  2KR5 A;  2PEJ A;  2CGQ A;  2FVA A;  2JBG A;  3MGE A;  3E2D A;  3G1I A;  4PWV B;  3CC7 P;  1M1K Q;  1MZ8 A;  3G21 A;  1DNY A;  2JO0 A;  2FHS C;  2DGY A;  2K92 A;  2LF4 A;  5F2O A;  2K0D X;  2XZ1 C;  5I4T G;  4BPG A;  3DS4 A;  2N6Z A;  2QNW A;  2MR8 A;  2L6E A;  1EIA A;  5HV8 A;  3CCM P;  4BPF A;  4H2W C;  1Q82 Q;  3DS3 A;  1YJ9 P;  4XRO A;  1UNK A;  2KGE A;  2ERH A;  2KOR A;  2GZG A;  2P9X A;  4U0A A;  3G1G A;  2VSQ A;  4IZ6 A;  2M5R A;  4H2Y C;  1Q81 Q;  1VQ5 P;  2KG8 A;  1K8A Q;  2LPK A;  5DCK A;  2LKI A;  3U43 A;  3CME P;  3DPH A;  3G4S P;  3I56 P;  2E1M A;  5JPA A;  2KGD A;  1Z6M A;  5HGL A;  1VQ9 P;  2QA4 P;  2L0Q A;  1VQ8 P;  2JU1 A;  2KGA A;  2CNR A;  1YIT P;  3RG6 C;  2L4B A;  1BXI A;  3LRY A;  2FAE A;  1VQ7 P;  2KOQ A;  2FVE A;  1YJN P;  1K30 A;  3DTJ A;  2EFJ A;  1S72 P;  2LIW A;  1M90 Q;  1VQK P;  2JB0 A;  2GZJ A;  2PEI A;  3CPW O;  2KOS A;  2VLQ A;  3CC4 P;  1NJI Q;  1X3O A;  2KOP A;  2AFE A;  2GDW A;  1L0I A;  2K94 A;  3P05 A;  2CG5 B;  3B4Q A;  2EG5 A;  2LIU A;  3GKL C;  1KC8 Q;  3CMA P;  1E6J P;  2PNG A;  1T8K A;  4U0C A;  1ZMB A;  1IMP A;  4CA3 A;  2Z46 A;  5EJD A;  1DV5 A;  2N6Y A;  2OAR A;  2MD9 A;  2GYK A;  2GDX A;  2PY8 A;  2FAD A;  2K0Y A;  2VLP A;  1YI2 P;  2CWO A;  2LML A;  2K0X A;  2GZI A;  2LTE A;  2KG9 A;  3Q20 A;  2XXM A;  3H0D A;  2EHT A;  3NTE A;  3CCV P;  2KW2 A;  1CEI A;  2EIA A;  4XFY A;  3G71 P;  1N8R Q;  4XRQ A;  5HVC A;  1VQL P;  3DS2 A;  4GR2 A;  1HQB A;  5HGN A;  4QKO A;  2KGC A;  3M1M A;  7CEI A;  3CCL P;  2VLN A;  1HY8 A;  4PH0 A;  3HYB A;  3GZL A;  1RO2 A;  2FQ1 A;  2N5I A;  3CCS P;  2N98 A;  2FQ0 A;  2JGP A;  2PEK A;  4H2X C;  1QVF O;  3G0V A;  4NEO A;  1E0H A;  3RG2 A;  2M8L A;  4U0E A;  5KP6 B;  1KQS O;  4GR6 A;  1VQO P;  2BUO A;  2MR7 A;  2Z44 A;  1OR5 A;  3H47 A;  4XFX A;  3OW2 O;  1YJW P;  1JJ2 O;  4BPH A;  3B5I A;  3GJN A;  1GXH A;  2XZ0 D;  2GZF A;  3I55 P;  2MY5 A;  4U0D A;  1NQ4 A;  2GZE A;  2KG6 A;  1GPJ A;  2FVF A;  2DNW A;  2XT1 A;  2PEN A;  4IPY A;  2KWL A;  1KLP A;  1F80 D;  2KOO A;  2ROQ A;  2AF8 A;  4U0B A;  4M0I A;  1K9M Q;  4R0M A;  2N5H A;  2LOL A;  2WPT A;  3NY7 B;  1FR2 A;  3LMO A;  2PEM A;  2AFD A;  2OTJ P;  1EMV A;  2BHV A;  2OTL P;  4COC A;  1A8O A;  1QVG O;  4XFZ A;  2GDY A;  4U0F A;  2LL8 A;  2N50 A;  4COP A;  1RNI A;  5KP8 B;  3EJB A;  1VHN A;  2KOD A;  1VQP P;  3WBH A;  1YHQ P;  2FAC A;  4HKG A;  2QEX P;  1GXG A;  2JAZ A;  1AF8 A;  1M6N A;  1UJZ A;  4UHP B;  4DG9 A;  2ONT A;  3EJD A;  1D1D A;  1RO0 A;  3H4E A;  2JU2 A;  5HGM A;  3DS0 A;  2JYL A;  3G29 A;  5EW5 E;  1VKU A;  3CE7 A;  1W2B O;  1K73 Q;  2K2Q A;  2L9F A;  4QNB A;  2K93 A;  2NO8 A;  2L22 A;  5HGO A;  2M8P A;  1KD1 Q;  2JQ4 A;  3G26 A;  1AYI A;  1YIJ P;  4WYM A;  3CCQ P;  1VQN P;  3CXC O;  1VQM P;  2CQ8 A;  2PEO A;  3G6E P;  3VRL C;  2Z45 A;  3CD6 P;  2MF4 A;  2MVU A;  1BAJ A;  1IMQ A;  1ZNV A;  2AVA A;  1L0H A;  1IUQ A;  2X2B A;  4PH1 A;  3G28 A;  1Q86 Q;  1VQ6 P;  4F37 A;  2FQ2 A;  3DS5 A;  5F2N A;  1QRJ A;  3CCJ P;  2VLO A;  5CZD B;  3CC2 P;  3HZQ A;  5KP7 B;  5BS1 A;  1EOQ A;  5F2K A;  4PXH B;  3EJE A;  2EHS A;  1AUM A;  1VQ4 P;  2JYG A;  1A43 A;  3CCE P;  2XV6 A;  2MVV A;  2K5X A; 
#chains in the Genus database with same CATH homology
 4NEO A;  2FAE A;  2KOQ A;  2FVE A;  4DG9 A;  3GZM A;  3RG2 A;  3EJD A;  5KP6 B;  4MRT C;  2JU2 A;  1ACP A;  2KR5 A;  2LIW A;  2MR7 A;  1OR5 A;  2KOS A;  2CGQ A;  2FVA A;  1VKU A;  4PWV B;  1X3O A;  2KOP A;  3CE7 A;  2AFE A;  2GDW A;  1L0I A;  2K94 A;  2K2Q A;  2CG5 B;  2L9F A;  2LIU A;  4BPH A;  2K93 A;  2L22 A;  1DNY A;  2FHS C;  2XZ0 D;  2JQ4 A;  2MY5 A;  2PNG A;  1T8K A;  1NQ4 A;  2K92 A;  4CA3 A;  2XZ1 C;  2CQ8 A;  5EJD A;  1DV5 A;  2KG6 A;  4BPG A;  2N6Y A;  2FVF A;  2DNW A;  2N6Z A;  2QNW A;  2MD9 A;  2KWL A;  2GDX A;  2MR8 A;  2FAD A;  1KLP A;  2K0Y A;  1F80 D;  2KOO A;  2MF4 A;  5HV8 A;  2MVU A;  2ROQ A;  2AF8 A;  2AVA A;  4R0M A;  1L0H A;  2LML A;  2LOL A;  2N5H A;  4H2W C;  4BPF A;  2K0X A;  2LTE A;  2KG9 A;  2X2B A;  3NY7 B;  3LMO A;  2KGE A;  2AFD A;  2EHT A;  2KOR A;  2FQ2 A;  2KW2 A;  2VSQ A;  4IZ6 A;  5CZD B;  2M5R A;  4H2Y C;  5HVC A;  2KG8 A;  5KP7 B;  2LPK A;  1HQB A;  2LKI A;  2GDY A;  2KGC A;  2LL8 A;  2N50 A;  5KP8 B;  3EJB A;  1HY8 A;  2KGD A;  3GZL A;  4PXH B;  3EJE A;  2EHS A;  2L0Q A;  2FAC A;  2JU1 A;  2FQ1 A;  2N5I A;  4HKG A;  2KGA A;  2N98 A;  2CNR A;  2FQ0 A;  2JGP A;  4H2X C;  2MVV A;  2L4B A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...