2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
2KG6A 2KORA 3NY7B 4H2WC 2FHSC 2CGQA 2FACA 3LMOA 2L22A 2X2BA 2GDXA 4BPFA 2LIWA 2MVUA 1VKUA 2KOSA 1DV5A 2FAEA 2LIUA 2JGPA 2KOPA 2GDWA 2N6ZA 2CQ8A 4BPGA 2N5HA 2KW2A 3RG2A 4DG9A 1L0HA 3GZMA 2L9FA 2N6YA 4H2YC 2KGAA 1HQBA 5KP6B 2FQ2A 2K93A 2DNWA 1F80D 2K2QA 4IZ6A 2KOOA 2MD9A 4R0MA 2VSQA 1DNYA 2KG8A 2KGDA 2XZ1C 2KG9A 1AF8A 2ROQA 5EJDA 1HY8A 5CZDB 2JQ4A 2PNGA 2AFDA 2K94A 2KWLA 1NQ4A 3EJBA 3GZLA 4NEOA 2N5IA 2N98A 2FQ0A 2KGEA 2MVVA 2KOQA 2FVAA 2K92A 3CE7A 2L4BA 2QNWA 2LOLA 2GDYA 2CG5B 4HKGA 2LKIA 2M5RA 2MF4A 2MR8A 2XZ0D 1T8KA 1L0IA 4PWVB 2LPKA 2L0QA 2LMLA 5KP8B 2K0XA 2CNRA 2EHSA 2LL8A 2N50A 2KR5A 2JU2A 2FVFA 3EJEA 2EHTA 4H2XC 2JU1A 2K0YA 1ACPA 2MY5A 1OR5A 4CA3A 2FADA 2AFEA 2MR7A 2AF8A 4BPHA 2FQ1A 1KLPA 5HVCA 5KP7B 2AVAA 2KGCA 4MRTC 2FVEA 2LTEA 3EJDA 5HV8A 4PXHB 1X3OA
chains in the Genus database with same CATH superfamily
3CC4P 4H2WC 1KQSO 1ZMBA 3CMAP 1W2BO 2QA4P 2GZEA 2FACA 2X2BA 2GDXA 4BPFA 2LIWA 3U43A 1DV5A 3DS5A 1FR2A 2N6ZA 3DTJA 1L0HA 2PEIA 1YJWP 1AYIA 1VQOP 2FQ2A 2GZJA 4U0FA 3H0DA 4IZ6A 2KOOA 2MD9A 2KGDA 2XZ1C 1JJ2O 1AF8A 4U0EA 2XXMA 2AFDA 3LRYA 2KWLA 3CC7P 1M1KQ 1N8RQ 3EJBA 3I55P 3G28A 2MVVA 3CE7A 3G0VA 1EOQA 2QNWA 2LOLA 2GDYA 4PH0A 1D1DA 2MF4A 2XZ0D 1T8KA 1A43A 5EW5E 1YI2P 2LMLA 5KP8B 1UJZA 2N50A 1RNIA 2JU1A 2LF4A 1VQ6P 1ACPA 1KD1Q 2VLOA 1VQ9P 2NO8A 5HGMA 2BUOA 2K5XA 3CCSP 3HYBA 2GZGA 1BAJA 2FVEA 1Z6MA 3EJDA 2Z45A 3DPHA 4PXHB 4XFZA 3G1IA 4COPA 2KG6A 3CCQP 4GR6A 2CGQA 1BXIA 5F2NA 1K8AQ 1YIJP 2PEMA 4XFXA 2ONTA 1VKUA 2FAEA 2LIUA 4GR2A 3VRLC 3DS0A 2CQ8A 2KW2A 3DS1A 4DG9A 3GZMA 1YJNP 2JAZA 2N6YA 2KGAA 2QEXP 1HQBA 1IMQA 2KODA 5KP6B 1IUQA 3E2DA 2DNWA 2GZIA 2K2QA 3CCUP 5BS2A 2ERHA 4U0AA 2KG8A 1M6EX 1M90Q 2EG5A 2EFJA 2ROQA 1VQMP 5EJDA 3G71P 3HZQA 3DS4A 5CZDB 2JQ4A 1VQ7P 4M0IA 1KC8Q 2E1MA 3Q20A 2N98A 1YITP 1K30A 3OW2O 4XFYA 2LKIA 1RO2A 1K9MQ 4PWVB 1EIAA 2L0QA 1ZNVA 4U0BA 2EHSA 2K0DX 2P9XA 2JU2A 2FVFA 3M1MA 2MY5A 2GZFA 1OR5A 3CCMP 2MR7A 4BPHA 3H47A 1KLPA 3CCRP 2WPTA 2PEQA 3MGEA 3G1GA 2LTEA 2VLNA 1K73Q 2BHVA 2KORA 1QVGO 2FHSC 2VLPA 1QVFO 3LMOA 1E0HA 2OTLP 3I56P 1VHNA 2PENA 2KOSA 2KOPA 4BPGA 2N5HA 2JBGA 4H2YC 3CPWO 1GPJA 3GKLC 1F80D 3DS2A 4R0MA 2VSQA 5HGNA 1EMVA 1M74A 3CCEP 3CMEP 2KG9A 2EIAA 2M8LA 2PEKA 5DCKA 2K94A 5BS1A 3CCLP 3GZLA 3CCVP 4NEOA 2N5IA 2FQ0A 2L4BA 1A8OA 2CG5B 4HKGA 2PY8A 2MR8A 1L0IA 5HGLA 3DS3A 2K0XA 1IMPA 1VQPP 4PH1A 2CNRA 2LL8A 1S72P 2KR5A 4WYMA 3WBHA 2JYLA 4U0DA 5F2OA 3CXCO 3RG6C 2OARA 1VQKP 1GXGA 3G21A 1GXHA 2XV6A 2FQ1A 7CEIA 5HVCA 5KP7B 2AVAA 3B5IA 4MRTC 2XT1A 5HV8A 4F37A 4IPYA 3G26A 2PEJA 3CD6P 3NY7B 1VQ8P 2L22A 1E6JP 3H4EA 3B4QA 2MVUA 1CEIA 2JGPA 2GDWA 3RG2A 2L9FA 1QRJA 4QKOA 5F2KA 2K93A 2JO0A 3NTEA 1Q81Q 2M8PA 1VQNP 1Q82Q 1DNYA 5HGOA 5JPAA 1YJ9P 1RO0A 2VLQA 1VQ5P 1HY8A 2OTJP 1Q86Q 2CWOA 3G29A 2PNGA 3GJNA 3G4SP 3G6EP 1UNKA 1NQ4A 1Q7YQ 4COCA 2KGEA 2KOQA 2DGYA 2FVAA 2K92A 2L6EA 2M5RA 2PEOA 4XRQA 1YHQP 3CCJP 2LPKA 4U0CA 4QNBA 5I4TG 4UHPB 2JYGA 4XROA 1AUMA 2M8NA 2EHTA 3EJEA 4H2XC 1NJIQ 2K0YA 1VQLP 1M6NA 4CA3A 2GYKA 2FADA 2AFEA 3CC2P 2AF8A 2JB0A 3P05A 2KGCA 2Z46A 1MZ8A 1VQ4P 1X3OA 2Z44A
chains in the Genus database with same CATH topology
2KG6A 2KORA 3NY7B 4H2WC 2FHSC 2CGQA 2FACA 3LMOA 2L22A 2X2BA 2GDXA 4BPFA 2LIWA 2MVUA 1VKUA 2KOSA 1DV5A 2FAEA 2LIUA 2JGPA 2KOPA 2GDWA 2N6ZA 2CQ8A 4BPGA 2N5HA 2KW2A 3RG2A 4DG9A 1L0HA 3GZMA 2L9FA 2N6YA 4H2YC 2KGAA 1HQBA 5KP6B 2FQ2A 2K93A 2DNWA 1F80D 2K2QA 4IZ6A 2KOOA 2MD9A 4R0MA 2VSQA 1DNYA 2KG8A 2KGDA 2XZ1C 2KG9A 1AF8A 2ROQA 5EJDA 1HY8A 5CZDB 2JQ4A 2PNGA 2AFDA 2K94A 2KWLA 1NQ4A 3EJBA 3GZLA 4NEOA 2N5IA 2N98A 2FQ0A 2KGEA 2MVVA 2KOQA 2FVAA 2K92A 3CE7A 2L4BA 2QNWA 2LOLA 2GDYA 2CG5B 4HKGA 2LKIA 2M5RA 2MF4A 2MR8A 2XZ0D 1T8KA 1L0IA 4PWVB 2LPKA 2L0QA 2LMLA 5KP8B 2K0XA 2CNRA 2EHSA 2LL8A 2N50A 2KR5A 2JU2A 2FVFA 3EJEA 2EHTA 4H2XC 2JU1A 2K0YA 1ACPA 2MY5A 1OR5A 4CA3A 2FADA 2AFEA 2MR7A 2AF8A 4BPHA 2FQ1A 1KLPA 5HVCA 5KP7B 2AVAA 2KGCA 4MRTC 2FVEA 2LTEA 3EJDA 5HV8A 4PXHB 1X3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  2KOR A;  3NY7 B;  4H2W C;  2FHS C;  2CGQ A;  2FAC A;  3LMO A;  2L22 A;  2X2B A;  2GDX A;  4BPF A;  2LIW A;  2MVU A;  1VKU A;  2KOS A;  1DV5 A;  2FAE A;  2LIU A;  2JGP A;  2KOP A;  2GDW A;  2N6Z A;  2CQ8 A;  4BPG A;  2N5H A;  2KW2 A;  3RG2 A;  4DG9 A;  1L0H A;  3GZM A;  2L9F A;  2N6Y A;  4H2Y C;  2KGA A;  1HQB A;  5KP6 B;  2FQ2 A;  2K93 A;  2DNW A;  1F80 D;  2K2Q A;  4IZ6 A;  2KOO A;  2MD9 A;  4R0M A;  2VSQ A;  1DNY A;  2KG8 A;  2KGD A;  2XZ1 C;  2KG9 A;  1AF8 A;  2ROQ A;  5EJD A;  1HY8 A;  5CZD B;  2JQ4 A;  2PNG A;  2AFD A;  2K94 A;  2KWL A;  1NQ4 A;  3EJB A;  3GZL A;  4NEO A;  2N5I A;  2N98 A;  2FQ0 A;  2KGE A;  2MVV A;  2KOQ A;  2FVA A;  2K92 A;  3CE7 A;  2L4B A;  2QNW A;  2LOL A;  2GDY A;  2CG5 B;  4HKG A;  2LKI A;  2M5R A;  2MF4 A;  2MR8 A;  2XZ0 D;  1T8K A;  1L0I A;  4PWV B;  2LPK A;  2L0Q A;  2LML A;  5KP8 B;  2K0X A;  2CNR A;  2EHS A;  2LL8 A;  2N50 A;  2KR5 A;  2JU2 A;  2FVF A;  3EJE A;  2EHT A;  4H2X C;  2JU1 A;  2K0Y A;  1ACP A;  2MY5 A;  1OR5 A;  4CA3 A;  2FAD A;  2AFE A;  2MR7 A;  2AF8 A;  4BPH A;  2FQ1 A;  1KLP A;  5HVC A;  5KP7 B;  2AVA A;  2KGC A;  4MRT C;  2FVE A;  2LTE A;  3EJD A;  5HV8 A;  4PXH B;  1X3O A; 
#chains in the Genus database with same CATH topology
 3CC4 P;  4H2W C;  1KQS O;  1ZMB A;  3CMA P;  1W2B O;  2QA4 P;  2GZE A;  2FAC A;  2X2B A;  2GDX A;  4BPF A;  2LIW A;  3U43 A;  1DV5 A;  3DS5 A;  1FR2 A;  2N6Z A;  3DTJ A;  1L0H A;  2PEI A;  1YJW P;  1AYI A;  1VQO P;  2FQ2 A;  2GZJ A;  4U0F A;  3H0D A;  4IZ6 A;  2KOO A;  2MD9 A;  2KGD A;  2XZ1 C;  1JJ2 O;  1AF8 A;  4U0E A;  2XXM A;  2AFD A;  3LRY A;  2KWL A;  3CC7 P;  1M1K Q;  1N8R Q;  3EJB A;  3I55 P;  3G28 A;  2MVV A;  3CE7 A;  3G0V A;  1EOQ A;  2QNW A;  2LOL A;  2GDY A;  4PH0 A;  1D1D A;  2MF4 A;  2XZ0 D;  1T8K A;  1A43 A;  5EW5 E;  1YI2 P;  2LML A;  5KP8 B;  1UJZ A;  2N50 A;  1RNI A;  2JU1 A;  2LF4 A;  1VQ6 P;  1ACP A;  1KD1 Q;  2VLO A;  1VQ9 P;  2NO8 A;  5HGM A;  2BUO A;  2K5X A;  3CCS P;  3HYB A;  2GZG A;  1BAJ A;  2FVE A;  1Z6M A;  3EJD A;  2Z45 A;  3DPH A;  4PXH B;  4XFZ A;  3G1I A;  4COP A;  2KG6 A;  3CCQ P;  4GR6 A;  2CGQ A;  1BXI A;  5F2N A;  1K8A Q;  1YIJ P;  2PEM A;  4XFX A;  2ONT A;  1VKU A;  2FAE A;  2LIU A;  4GR2 A;  3VRL C;  3DS0 A;  2CQ8 A;  2KW2 A;  3DS1 A;  4DG9 A;  3GZM A;  1YJN P;  2JAZ A;  2N6Y A;  2KGA A;  2QEX P;  1HQB A;  1IMQ A;  2KOD A;  5KP6 B;  1IUQ A;  3E2D A;  2DNW A;  2GZI A;  2K2Q A;  3CCU P;  5BS2 A;  2ERH A;  4U0A A;  2KG8 A;  1M6E X;  1M90 Q;  2EG5 A;  2EFJ A;  2ROQ A;  1VQM P;  5EJD A;  3G71 P;  3HZQ A;  3DS4 A;  5CZD B;  2JQ4 A;  1VQ7 P;  4M0I A;  1KC8 Q;  2E1M A;  3Q20 A;  2N98 A;  1YIT P;  1K30 A;  3OW2 O;  4XFY A;  2LKI A;  1RO2 A;  1K9M Q;  4PWV B;  1EIA A;  2L0Q A;  1ZNV A;  4U0B A;  2EHS A;  2K0D X;  2P9X A;  2JU2 A;  2FVF A;  3M1M A;  2MY5 A;  2GZF A;  1OR5 A;  3CCM P;  2MR7 A;  4BPH A;  3H47 A;  1KLP A;  3CCR P;  2WPT A;  2PEQ A;  3MGE A;  3G1G A;  2LTE A;  2VLN A;  1K73 Q;  2BHV A;  2KOR A;  1QVG O;  2FHS C;  2VLP A;  1QVF O;  3LMO A;  1E0H A;  2OTL P;  3I56 P;  1VHN A;  2PEN A;  2KOS A;  2KOP A;  4BPG A;  2N5H A;  2JBG A;  4H2Y C;  3CPW O;  1GPJ A;  3GKL C;  1F80 D;  3DS2 A;  4R0M A;  2VSQ A;  5HGN A;  1EMV A;  1M74 A;  3CCE P;  3CME P;  2KG9 A;  2EIA A;  2M8L A;  2PEK A;  5DCK A;  2K94 A;  5BS1 A;  3CCL P;  3GZL A;  3CCV P;  4NEO A;  2N5I A;  2FQ0 A;  2L4B A;  1A8O A;  2CG5 B;  4HKG A;  2PY8 A;  2MR8 A;  1L0I A;  5HGL A;  3DS3 A;  2K0X A;  1IMP A;  1VQP P;  4PH1 A;  2CNR A;  2LL8 A;  1S72 P;  2KR5 A;  4WYM A;  3WBH A;  2JYL A;  4U0D A;  5F2O A;  3CXC O;  3RG6 C;  2OAR A;  1VQK P;  1GXG A;  3G21 A;  1GXH A;  2XV6 A;  2FQ1 A;  7CEI A;  5HVC A;  5KP7 B;  2AVA A;  3B5I A;  4MRT C;  2XT1 A;  5HV8 A;  4F37 A;  4IPY A;  3G26 A;  2PEJ A;  3CD6 P;  3NY7 B;  1VQ8 P;  2L22 A;  1E6J P;  3H4E A;  3B4Q A;  2MVU A;  1CEI A;  2JGP A;  2GDW A;  3RG2 A;  2L9F A;  1QRJ A;  4QKO A;  5F2K A;  2K93 A;  2JO0 A;  3NTE A;  1Q81 Q;  2M8P A;  1VQN P;  1Q82 Q;  1DNY A;  5HGO A;  5JPA A;  1YJ9 P;  1RO0 A;  2VLQ A;  1VQ5 P;  1HY8 A;  2OTJ P;  1Q86 Q;  2CWO A;  3G29 A;  2PNG A;  3GJN A;  3G4S P;  3G6E P;  1UNK A;  1NQ4 A;  1Q7Y Q;  4COC A;  2KGE A;  2KOQ A;  2DGY A;  2FVA A;  2K92 A;  2L6E A;  2M5R A;  2PEO A;  4XRQ A;  1YHQ P;  3CCJ P;  2LPK A;  4U0C A;  4QNB A;  5I4T G;  4UHP B;  2JYG A;  4XRO A;  1AUM A;  2M8N A;  2EHT A;  3EJE A;  4H2X C;  1NJI Q;  2K0Y A;  1VQL P;  1M6N A;  4CA3 A;  2GYK A;  2FAD A;  2AFE A;  3CC2 P;  2AF8 A;  2JB0 A;  3P05 A;  2KGC A;  2Z46 A;  1MZ8 A;  1VQ4 P;  1X3O A;  2Z44 A; 
#chains in the Genus database with same CATH homology
 2KG6 A;  2KOR A;  3NY7 B;  4H2W C;  2FHS C;  2CGQ A;  2FAC A;  3LMO A;  2L22 A;  2X2B A;  2GDX A;  4BPF A;  2LIW A;  2MVU A;  1VKU A;  2KOS A;  1DV5 A;  2FAE A;  2LIU A;  2JGP A;  2KOP A;  2GDW A;  2N6Z A;  2CQ8 A;  4BPG A;  2N5H A;  2KW2 A;  3RG2 A;  4DG9 A;  1L0H A;  3GZM A;  2L9F A;  2N6Y A;  4H2Y C;  2KGA A;  1HQB A;  5KP6 B;  2FQ2 A;  2K93 A;  2DNW A;  1F80 D;  2K2Q A;  4IZ6 A;  2KOO A;  2MD9 A;  4R0M A;  2VSQ A;  1DNY A;  2KG8 A;  2KGD A;  2XZ1 C;  2KG9 A;  1AF8 A;  2ROQ A;  5EJD A;  1HY8 A;  5CZD B;  2JQ4 A;  2PNG A;  2AFD A;  2K94 A;  2KWL A;  1NQ4 A;  3EJB A;  3GZL A;  4NEO A;  2N5I A;  2N98 A;  2FQ0 A;  2KGE A;  2MVV A;  2KOQ A;  2FVA A;  2K92 A;  3CE7 A;  2L4B A;  2QNW A;  2LOL A;  2GDY A;  2CG5 B;  4HKG A;  2LKI A;  2M5R A;  2MF4 A;  2MR8 A;  2XZ0 D;  1T8K A;  1L0I A;  4PWV B;  2LPK A;  2L0Q A;  2LML A;  5KP8 B;  2K0X A;  2CNR A;  2EHS A;  2LL8 A;  2N50 A;  2KR5 A;  2JU2 A;  2FVF A;  3EJE A;  2EHT A;  4H2X C;  2JU1 A;  2K0Y A;  1ACP A;  2MY5 A;  1OR5 A;  4CA3 A;  2FAD A;  2AFE A;  2MR7 A;  2AF8 A;  4BPH A;  2FQ1 A;  1KLP A;  5HVC A;  5KP7 B;  2AVA A;  2KGC A;  4MRT C;  2FVE A;  2LTE A;  3EJD A;  5HV8 A;  4PXH B;  1X3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...