2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
2MR8A 2N5IA 2N6YA 2MVUA 3EJEA 2CGQA 4BPGA 1VKUA 2LIUA 4DG9A 2FACA 4BPHA 3NY7B 3EJBA 2GDYA 4PXHB 2N6ZA 2FQ2A 2MVVA 2N98A 2K2QA 2L0QA 2DNWA 1T8KA 2KGAA 2KGEA 2FQ0A 1F80D 2JU2A 2VSQA 5HVCA 2K93A 2LKIA 2KG8A 2XZ0D 2MY5A 3GZMA 3RG2A 2XZ1C 1DV5A 2CNRA 1L0HA 3GZLA 3LMOA 2KOOA 5EJDA 2AFDA 2L9FA 2FAEA 2K0YA 2FQ1A 2FADA 4NEOA 4MRTC 2EHSA 1HQBA 5KP8B 1DNYA 2MD9A 2KOPA 5KP6B 4H2YC 2CG5B 4HKGA 2N50A 1HY8A 1X3OA 2M5RA 2PNGA 2AFEA 2KGCA 2KG9A 2KOQA 2KOSA 2GDWA 2L4BA 4H2XC 2CQ8A 2JU1A 1OR5A 2AF8A 2ROQA 4PWVB 2AVAA 2JGPA 2LTEA 5HV8A 2LL8A 2KW2A 4CA3A 3CE7A 2GDXA 2LPKA 2FVEA 5CZDB 2LOLA 5KP7B 2KG6A 3EJDA 2L22A 2EHTA 2QNWA 1L0IA 1ACPA 2N5HA 2KORA 2FHSC 2X2BA 2K0XA 2FVFA 4H2WC 2K94A 2KGDA 1KLPA 4R0MA 2FVAA 2LMLA 2JQ4A 1NQ4A 2K92A 4BPFA 2MF4A 2KR5A 2KWLA 2LIWA 2MR7A 1AF8A 4IZ6A
chains in the Genus database with same CATH superfamily
1EMVA 2N6YA 1VQOP 1EOQA 1VKUA 4DG9A 2FACA 4BPHA 1Z6MA 2GDYA 3G28A 4PXHB 2N6ZA 3LRYA 2FQ2A 2K2QA 2L0QA 3CCLP 1T8KA 2KGAA 4U0CA 2VSQA 2JU2A 2EFJA 5HVCA 2VLPA 1YJ9P 2WPTA 3B5IA 3CC2P 3Q20A 3U43A 2ERHA 1BXIA 3GZMA 3RG2A 2XZ1C 1VQ8P 2QA4P 1QRJA 1RNIA 1L0HA 1VQ6P 1Q81Q 5EJDA 2AFDA 2K0YA 2FQ1A 1K9MQ 2GZIA 2JYLA 1IUQA 2EHSA 1YITP 1UNKA 3G29A 5KP6B 4H2YC 2CG5B 4HKGA 2K0DX 2AFEA 2KGCA 2L4BA 1N8RQ 5BS2A 2NO8A 3CPWO 1NJIQ 2LTEA 4CA3A 2LPKA 3CCVP 1Q86Q 2KG6A 3G0VA 2EHTA 5EW5E 2QNWA 2VLQA 5DCKA 2FHSC 2Z44A 3MGEA 1M74A 3VRLC 1VQ9P 4R0MA 2LMLA 4U0FA 1ZMBA 2JQ4A 4XROA 1NQ4A 4BPFA 2BHVA 2JBGA 3GKLC 3G6EP 4QNBA 2KR5A 2KWLA 4U0EA 2CWOA 4F37A 2GYKA 1YI2P 1W2BO 4BPGA 2EG5A 1ZNVA 2MVVA 5F2KA 2FQ0A 3E2DA 2PY8A 1YHQP 1QVFO 2XZ0D 1S72P 2KODA 1YIJP 3M1MA 1RO0A 3CCRP 3DS0A 1K8AQ 1Q82Q 2L9FA 2FAEA 3I56P 4PH0A 4COPA 5HGNA 1BAJA 3CD6P 1IMPA 2EIAA 2MD9A 1KQSO 2M5RA 1X3OA 3H4EA 4GR2A 5HGMA 2CQ8A 2PEIA 1YJWP 1VQ5P 4PWVB 1UJZA 3CMAP 2KW2A 1D1DA 2OTJP 2GDXA 2M8PA 2XXMA 3B4QA 4COCA 2L22A 4WYMA 5F2OA 4U0BA 3WBHA 1ACPA 2N5HA 2OARA 1YJNP 4PH1A 2MR7A 1AF8A 4IZ6A 3DS1A 5F2NA 1JJ2O 2VLNA 2QEXP 2MVUA 3DS4A 1GXHA 1M6NA 3H0DA 2DGYA 2N98A 3CMEP 2DNWA 1E0HA 1IMQA 1F80D 2K93A 4U0AA 2JYGA 1GXGA 2KG8A 2GZGA 2LF4A 2OTLP 2Z45A 1VQNP 4IPYA 2CNRA 4M0IA 3GZLA 3CC4P 3LMOA 3G4SP 1Q7YQ 1VQMP 2FADA 3DS2A 3HYBA 4MRTC 2M8LA 1HQBA 5KP8B 1DNYA 1A43A 2P9XA 2K5XA 1RO2A 2BUOA 2N50A 1HY8A 2PNGA 3I55P 2KG9A 4UHPB 4XFXA 4QKOA 3DS3A 2AF8A 2ROQA 3DS5A 3G1IA 2JGPA 2LL8A 2PEJA 3CCEP 3CE7A 1M90Q 1M1KQ 7CEIA 5CZDB 2LOLA 5HGLA 2E1MA 4GR6A 2PEMA 3H47A 1VQLP 2L6EA 1L0IA 2KORA 2X2BA 4XFYA 3G26A 1QVGO 3OW2O 2PEKA 2FVFA 4H2WC 2PEOA 1E6JP 2KGDA 3GJNA 5HGOA 2FVAA 2K92A 2MR8A 1VQKP 3DPHA 2PENA 3CCMP 1KD1Q 2N5IA 3EJEA 5JPAA 2CGQA 3CXCO 2LIUA 3NY7B 3EJBA 2GZFA 3DTJA 1K30A 2JO0A 2KGEA 1GPJA 2JB0A 1CEIA 1KC8Q 1EIAA 1VQPP 2LKIA 2MY5A 1VHNA 2GZEA 1AYIA 3CCUP 2VLOA 1DV5A 2KOOA 4NEOA 2ONTA 3G21A 3CCQP 1VQ7P 2M8NA 1M6EX 2KOPA 4U0DA 3HZQA 2KOQA 2KOSA 2GDWA 4XFZA 4H2XC 3G1GA 2JU1A 2JAZA 1OR5A 2XV6A 2AVAA 5HV8A 5I4TG 2XT1A 2FVEA 2GZJA 1VQ4P 3CC7P 3CCJP 5KP7B 3EJDA 1K73Q 2PEQA 1AUMA 2K0XA 2Z46A 3NTEA 1A8OA 2K94A 1KLPA 3CCSP 3G71P 1FR2A 3RG6C 2MF4A 3P05A 1MZ8A 2LIWA 4XRQA 5BS1A
chains in the Genus database with same CATH topology
2MR8A 2N5IA 2N6YA 2MVUA 3EJEA 2CGQA 4BPGA 1VKUA 2LIUA 4DG9A 2FACA 4BPHA 3NY7B 3EJBA 2GDYA 4PXHB 2N6ZA 2FQ2A 2MVVA 2N98A 2K2QA 2L0QA 2DNWA 1T8KA 2KGAA 2KGEA 2FQ0A 1F80D 2JU2A 2VSQA 5HVCA 2K93A 2LKIA 2KG8A 2XZ0D 2MY5A 3GZMA 3RG2A 2XZ1C 1DV5A 2CNRA 1L0HA 3GZLA 3LMOA 2KOOA 5EJDA 2AFDA 2L9FA 2FAEA 2K0YA 2FQ1A 2FADA 4NEOA 4MRTC 2EHSA 1HQBA 5KP8B 1DNYA 2MD9A 2KOPA 5KP6B 4H2YC 2CG5B 4HKGA 2N50A 1HY8A 1X3OA 2M5RA 2PNGA 2AFEA 2KGCA 2KG9A 2KOQA 2KOSA 2GDWA 2L4BA 4H2XC 2CQ8A 2JU1A 1OR5A 2AF8A 2ROQA 4PWVB 2AVAA 2JGPA 2LTEA 5HV8A 2LL8A 2KW2A 4CA3A 3CE7A 2GDXA 2LPKA 2FVEA 5CZDB 2LOLA 5KP7B 2KG6A 3EJDA 2L22A 2EHTA 2QNWA 1L0IA 1ACPA 2N5HA 2KORA 2FHSC 2X2BA 2K0XA 2FVFA 4H2WC 2K94A 2KGDA 1KLPA 4R0MA 2FVAA 2LMLA 2JQ4A 1NQ4A 2K92A 4BPFA 2MF4A 2KR5A 2KWLA 2LIWA 2MR7A 1AF8A 4IZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MR8 A;  2N5I A;  2N6Y A;  2MVU A;  3EJE A;  2CGQ A;  4BPG A;  1VKU A;  2LIU A;  4DG9 A;  2FAC A;  4BPH A;  3NY7 B;  3EJB A;  2GDY A;  4PXH B;  2N6Z A;  2FQ2 A;  2MVV A;  2N98 A;  2K2Q A;  2L0Q A;  2DNW A;  1T8K A;  2KGA A;  2KGE A;  2FQ0 A;  1F80 D;  2JU2 A;  2VSQ A;  5HVC A;  2K93 A;  2LKI A;  2KG8 A;  2XZ0 D;  2MY5 A;  3GZM A;  3RG2 A;  2XZ1 C;  1DV5 A;  2CNR A;  1L0H A;  3GZL A;  3LMO A;  2KOO A;  5EJD A;  2AFD A;  2L9F A;  2FAE A;  2K0Y A;  2FQ1 A;  2FAD A;  4NEO A;  4MRT C;  2EHS A;  1HQB A;  5KP8 B;  1DNY A;  2MD9 A;  2KOP A;  5KP6 B;  4H2Y C;  2CG5 B;  4HKG A;  2N50 A;  1HY8 A;  1X3O A;  2M5R A;  2PNG A;  2AFE A;  2KGC A;  2KG9 A;  2KOQ A;  2KOS A;  2GDW A;  2L4B A;  4H2X C;  2CQ8 A;  2JU1 A;  1OR5 A;  2AF8 A;  2ROQ A;  4PWV B;  2AVA A;  2JGP A;  2LTE A;  5HV8 A;  2LL8 A;  2KW2 A;  4CA3 A;  3CE7 A;  2GDX A;  2LPK A;  2FVE A;  5CZD B;  2LOL A;  5KP7 B;  2KG6 A;  3EJD A;  2L22 A;  2EHT A;  2QNW A;  1L0I A;  1ACP A;  2N5H A;  2KOR A;  2FHS C;  2X2B A;  2K0X A;  2FVF A;  4H2W C;  2K94 A;  2KGD A;  1KLP A;  4R0M A;  2FVA A;  2LML A;  2JQ4 A;  1NQ4 A;  2K92 A;  4BPF A;  2MF4 A;  2KR5 A;  2KWL A;  2LIW A;  2MR7 A;  1AF8 A;  4IZ6 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  2N6Y A;  1VQO P;  1EOQ A;  1VKU A;  4DG9 A;  2FAC A;  4BPH A;  1Z6M A;  2GDY A;  3G28 A;  4PXH B;  2N6Z A;  3LRY A;  2FQ2 A;  2K2Q A;  2L0Q A;  3CCL P;  1T8K A;  2KGA A;  4U0C A;  2VSQ A;  2JU2 A;  2EFJ A;  5HVC A;  2VLP A;  1YJ9 P;  2WPT A;  3B5I A;  3CC2 P;  3Q20 A;  3U43 A;  2ERH A;  1BXI A;  3GZM A;  3RG2 A;  2XZ1 C;  1VQ8 P;  2QA4 P;  1QRJ A;  1RNI A;  1L0H A;  1VQ6 P;  1Q81 Q;  5EJD A;  2AFD A;  2K0Y A;  2FQ1 A;  1K9M Q;  2GZI A;  2JYL A;  1IUQ A;  2EHS A;  1YIT P;  1UNK A;  3G29 A;  5KP6 B;  4H2Y C;  2CG5 B;  4HKG A;  2K0D X;  2AFE A;  2KGC A;  2L4B A;  1N8R Q;  5BS2 A;  2NO8 A;  3CPW O;  1NJI Q;  2LTE A;  4CA3 A;  2LPK A;  3CCV P;  1Q86 Q;  2KG6 A;  3G0V A;  2EHT A;  5EW5 E;  2QNW A;  2VLQ A;  5DCK A;  2FHS C;  2Z44 A;  3MGE A;  1M74 A;  3VRL C;  1VQ9 P;  4R0M A;  2LML A;  4U0F A;  1ZMB A;  2JQ4 A;  4XRO A;  1NQ4 A;  4BPF A;  2BHV A;  2JBG A;  3GKL C;  3G6E P;  4QNB A;  2KR5 A;  2KWL A;  4U0E A;  2CWO A;  4F37 A;  2GYK A;  1YI2 P;  1W2B O;  4BPG A;  2EG5 A;  1ZNV A;  2MVV A;  5F2K A;  2FQ0 A;  3E2D A;  2PY8 A;  1YHQ P;  1QVF O;  2XZ0 D;  1S72 P;  2KOD A;  1YIJ P;  3M1M A;  1RO0 A;  3CCR P;  3DS0 A;  1K8A Q;  1Q82 Q;  2L9F A;  2FAE A;  3I56 P;  4PH0 A;  4COP A;  5HGN A;  1BAJ A;  3CD6 P;  1IMP A;  2EIA A;  2MD9 A;  1KQS O;  2M5R A;  1X3O A;  3H4E A;  4GR2 A;  5HGM A;  2CQ8 A;  2PEI A;  1YJW P;  1VQ5 P;  4PWV B;  1UJZ A;  3CMA P;  2KW2 A;  1D1D A;  2OTJ P;  2GDX A;  2M8P A;  2XXM A;  3B4Q A;  4COC A;  2L22 A;  4WYM A;  5F2O A;  4U0B A;  3WBH A;  1ACP A;  2N5H A;  2OAR A;  1YJN P;  4PH1 A;  2MR7 A;  1AF8 A;  4IZ6 A;  3DS1 A;  5F2N A;  1JJ2 O;  2VLN A;  2QEX P;  2MVU A;  3DS4 A;  1GXH A;  1M6N A;  3H0D A;  2DGY A;  2N98 A;  3CME P;  2DNW A;  1E0H A;  1IMQ A;  1F80 D;  2K93 A;  4U0A A;  2JYG A;  1GXG A;  2KG8 A;  2GZG A;  2LF4 A;  2OTL P;  2Z45 A;  1VQN P;  4IPY A;  2CNR A;  4M0I A;  3GZL A;  3CC4 P;  3LMO A;  3G4S P;  1Q7Y Q;  1VQM P;  2FAD A;  3DS2 A;  3HYB A;  4MRT C;  2M8L A;  1HQB A;  5KP8 B;  1DNY A;  1A43 A;  2P9X A;  2K5X A;  1RO2 A;  2BUO A;  2N50 A;  1HY8 A;  2PNG A;  3I55 P;  2KG9 A;  4UHP B;  4XFX A;  4QKO A;  3DS3 A;  2AF8 A;  2ROQ A;  3DS5 A;  3G1I A;  2JGP A;  2LL8 A;  2PEJ A;  3CCE P;  3CE7 A;  1M90 Q;  1M1K Q;  7CEI A;  5CZD B;  2LOL A;  5HGL A;  2E1M A;  4GR6 A;  2PEM A;  3H47 A;  1VQL P;  2L6E A;  1L0I A;  2KOR A;  2X2B A;  4XFY A;  3G26 A;  1QVG O;  3OW2 O;  2PEK A;  2FVF A;  4H2W C;  2PEO A;  1E6J P;  2KGD A;  3GJN A;  5HGO A;  2FVA A;  2K92 A;  2MR8 A;  1VQK P;  3DPH A;  2PEN A;  3CCM P;  1KD1 Q;  2N5I A;  3EJE A;  5JPA A;  2CGQ A;  3CXC O;  2LIU A;  3NY7 B;  3EJB A;  2GZF A;  3DTJ A;  1K30 A;  2JO0 A;  2KGE A;  1GPJ A;  2JB0 A;  1CEI A;  1KC8 Q;  1EIA A;  1VQP P;  2LKI A;  2MY5 A;  1VHN A;  2GZE A;  1AYI A;  3CCU P;  2VLO A;  1DV5 A;  2KOO A;  4NEO A;  2ONT A;  3G21 A;  3CCQ P;  1VQ7 P;  2M8N A;  1M6E X;  2KOP A;  4U0D A;  3HZQ A;  2KOQ A;  2KOS A;  2GDW A;  4XFZ A;  4H2X C;  3G1G A;  2JU1 A;  2JAZ A;  1OR5 A;  2XV6 A;  2AVA A;  5HV8 A;  5I4T G;  2XT1 A;  2FVE A;  2GZJ A;  1VQ4 P;  3CC7 P;  3CCJ P;  5KP7 B;  3EJD A;  1K73 Q;  2PEQ A;  1AUM A;  2K0X A;  2Z46 A;  3NTE A;  1A8O A;  2K94 A;  1KLP A;  3CCS P;  3G71 P;  1FR2 A;  3RG6 C;  2MF4 A;  3P05 A;  1MZ8 A;  2LIW A;  4XRQ A;  5BS1 A; 
#chains in the Genus database with same CATH homology
 2MR8 A;  2N5I A;  2N6Y A;  2MVU A;  3EJE A;  2CGQ A;  4BPG A;  1VKU A;  2LIU A;  4DG9 A;  2FAC A;  4BPH A;  3NY7 B;  3EJB A;  2GDY A;  4PXH B;  2N6Z A;  2FQ2 A;  2MVV A;  2N98 A;  2K2Q A;  2L0Q A;  2DNW A;  1T8K A;  2KGA A;  2KGE A;  2FQ0 A;  1F80 D;  2JU2 A;  2VSQ A;  5HVC A;  2K93 A;  2LKI A;  2KG8 A;  2XZ0 D;  2MY5 A;  3GZM A;  3RG2 A;  2XZ1 C;  1DV5 A;  2CNR A;  1L0H A;  3GZL A;  3LMO A;  2KOO A;  5EJD A;  2AFD A;  2L9F A;  2FAE A;  2K0Y A;  2FQ1 A;  2FAD A;  4NEO A;  4MRT C;  2EHS A;  1HQB A;  5KP8 B;  1DNY A;  2MD9 A;  2KOP A;  5KP6 B;  4H2Y C;  2CG5 B;  4HKG A;  2N50 A;  1HY8 A;  1X3O A;  2M5R A;  2PNG A;  2AFE A;  2KGC A;  2KG9 A;  2KOQ A;  2KOS A;  2GDW A;  2L4B A;  4H2X C;  2CQ8 A;  2JU1 A;  1OR5 A;  2AF8 A;  2ROQ A;  4PWV B;  2AVA A;  2JGP A;  2LTE A;  5HV8 A;  2LL8 A;  2KW2 A;  4CA3 A;  3CE7 A;  2GDX A;  2LPK A;  2FVE A;  5CZD B;  2LOL A;  5KP7 B;  2KG6 A;  3EJD A;  2L22 A;  2EHT A;  2QNW A;  1L0I A;  1ACP A;  2N5H A;  2KOR A;  2FHS C;  2X2B A;  2K0X A;  2FVF A;  4H2W C;  2K94 A;  2KGD A;  1KLP A;  4R0M A;  2FVA A;  2LML A;  2JQ4 A;  1NQ4 A;  2K92 A;  4BPF A;  2MF4 A;  2KR5 A;  2KWL A;  2LIW A;  2MR7 A;  1AF8 A;  4IZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...