2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
2KOSA 2GDXA 4CA3A 2EHTA 2AFEA 2LTEA 2K94A 4BPFA 1T8KA 4H2WC 5KP6B 2KGCA 2N6YA 2MF4A 2ROQA 2KWLA 2KORA 4IZ6A 2N5IA 4BPGA 2MD9A 2FVEA 1L0IA 5KP7B 2KG6A 2GDWA 1DV5A 2AF8A 1VKUA 1HQBA 2LMLA 2FACA 2CGQA 1ACPA 2FVAA 1OR5A 3NY7B 2QNWA 2KGEA 2JGPA 2JU1A 5HVCA 2LOLA 2FQ2A 4HKGA 2L9FA 5HV8A 2XZ1C 2M5RA 5KP8B 5EJDA 2LKIA 2LPKA 2N50A 3GZMA 1HY8A 2MVVA 2FQ1A 2KG8A 2K2QA 3EJEA 2AVAA 2N98A 4BPHA 2LIWA 2L0QA 2X2BA 2FQ0A 2KGDA 4H2XC 2AFDA 2N5HA 4NEOA 1NQ4A 1L0HA 2K0YA 2KR5A 2LIUA 2MY5A 3RG2A 2VSQA 1F80D 2CNRA 3CE7A 4MRTC 2XZ0D 1KLPA 2KGAA 4PWVB 1DNYA 2CG5B 3LMOA 2K92A 2K93A 2KOOA 2N6ZA 2KG9A 2FADA 2FVFA 4DG9A 2L4BA 4H2YC 2KOPA 2DNWA 2LL8A 2PNGA 2KW2A 2MR7A 3EJDA 2KOQA 2MR8A 2EHSA 2JQ4A 4PXHB 1X3OA 2MVUA 2FHSC 2K0XA 3EJBA 2L22A 2CQ8A 4R0MA 5CZDB 2FAEA 3GZLA 1AF8A 2GDYA 2JU2A
chains in the Genus database with same CATH superfamily
2VLQA 2GDXA 1YI2P 3CCLP 2OARA 2JBGA 1VQKP 3OW2O 2MF4A 2N5IA 1VQ6P 1GXHA 1VQ8P 5KP7B 2M8LA 1HQBA 1VKUA 3RG6C 1RO0A 2LMLA 3Q20A 3GKLC 4COCA 1M74A 2QA4P 1Z6MA 3G21A 5HGOA 2M5RA 2PEKA 2KODA 3G4SP 3DS0A 2LKIA 4U0FA 4UHPB 2LPKA 1Q86Q 2N50A 3GZMA 3CXCO 2N98A 4BPHA 1MZ8A 2WPTA 1EIAA 2DGYA 2ONTA 4XFYA 2XV6A 2GYKA 1CEIA 2PEMA 2XXMA 1NQ4A 1L0HA 2MY5A 3U43A 3CCSP 1F80D 2PEOA 2XZ0D 4IPYA 2EFJA 2CG5B 3LMOA 3CCUP 1IMPA 1IMQA 1ZMBA 2KOOA 4DG9A 3CCVP 1Q7YQ 3DS2A 2PEIA 3CCEP 1K73Q 1M1KQ 2KOQA 2BUOA 2PEQA 2JYGA 2M8NA 1YHQP 2FHSC 5CZDB 5JPAA 4WYMA 3G71P 1BXIA 2FAEA 3GZLA 1AF8A 3CD6P 3LRYA 1IUQA 4QNBA 5KP6B 3NTEA 1GXGA 2KGCA 1UJZA 2N6YA 3CMAP 5HGMA 2JYLA 1VQNP 2MD9A 4U0BA 1L0IA 2KG6A 2GDWA 1A43A 2AF8A 3P05A 2Z45A 2CGQA 1ACPA 3G28A 3G29A 2QNWA 3DS5A 2JU1A 2JO0A 2LOLA 1K8AQ 5BS2A 3CCRP 2XZ1C 1UNKA 3DPHA 1M6NA 1HY8A 1YJWP 1RO2A 2K2QA 3EJEA 1FR2A 2QEXP 2LIWA 4XFZA 1D1DA 2K5XA 4XROA 1KD1Q 2JAZA 2N5HA 4NEOA 1KQSO 2KR5A 2VSQA 2CNRA 1KLPA 4XFXA 1EOQA 1VQOP 2K92A 2K93A 1AUMA 2N6ZA 1Q81Q 5HGLA 4H2YC 2PNGA 3EJDA 4U0EA 3GJNA 2EHSA 3HYBA 1X3OA 2PENA 5DCKA 3EJBA 2L22A 3I56P 1E0HA 2KOSA 7CEIA 4U0CA 4CA3A 3DTJA 3HZQA 2AFEA 2LTEA 2K94A 2VLPA 4BPFA 1T8KA 4H2WC 2BHVA 2ROQA 2KORA 4IZ6A 3DS1A 1DV5A 1VQ7P 4F37A 2FACA 3VRLC 2GZJA 3NY7B 2KGEA 5HVCA 2FQ2A 4HKGA 3G1IA 2L9FA 4XRQA 5HV8A 1VQ5P 5KP8B 5EJDA 2VLOA 2NO8A 3I55P 3G6EP 2GZEA 2KG8A 1S72P 2AVAA 3CCMP 3E2DA 2ERHA 2L0QA 2X2BA 3MGEA 1NJIQ 1YITP 3B4QA 2EG5A 3H47A 1KC8Q 2LF4A 1AYIA 1EMVA 3CE7A 3WBHA 1E6JP 1GPJA 3CC4P 2KG9A 4PH0A 2OTJP 4GR2A 2FVFA 2L4BA 2LL8A 1K30A 3G26A 3B5IA 2M8PA 2KW2A 2MR7A 1YJNP 4QKOA 3DS3A 3CCJP 2XT1A 3CC7P 2JQ4A 2GZIA 1JJ2O 5BS1A 1RNIA 2K0XA 2E1MA 2CQ8A 1QVGO 1A8OA 2GDYA 3CC2P 2K0DX 1VQ9P 3DS4A 3CCQP 1Q82Q 1VHNA 2Z46A 1M90Q 2EHTA 1W2BO 5EW5E 2OTLP 2KWLA 4BPGA 1YJ9P 2FVEA 1BAJA 4M0IA 1VQLP 5I4TG 1N8RQ 2FVAA 1OR5A 2JGPA 1ZNVA 5HGNA 4COPA 2P9XA 1QVFO 2MVVA 2FQ1A 4PH1A 1YIJP 1VQMP 3G1GA 2FQ0A 2KGDA 4H2XC 1VQ4P 3CPWO 2AFDA 3CMEP 3H0DA 2K0YA 2LIUA 3RG2A 3H4EA 3M1MA 4MRTC 2KGAA 2PY8A 4PWVB 1M6EX 1DNYA 5F2KA 1K9MQ 3G0VA 2GZGA 2FADA 4U0AA 2KOPA 2DNWA 2VLNA 4U0DA 1QRJA 2PEJA 1VQPP 2MR8A 4GR6A 4PXHB 2MVUA 5F2OA 2CWOA 2JB0A 2Z44A 4R0MA 2L6EA 2EIAA 5F2NA 2GZFA 2JU2A
chains in the Genus database with same CATH topology
2KOSA 2GDXA 4CA3A 2EHTA 2AFEA 2LTEA 2K94A 4BPFA 1T8KA 4H2WC 5KP6B 2KGCA 2N6YA 2MF4A 2ROQA 2KWLA 2KORA 4IZ6A 2N5IA 4BPGA 2MD9A 2FVEA 1L0IA 5KP7B 2KG6A 2GDWA 1DV5A 2AF8A 1VKUA 1HQBA 2LMLA 2FACA 2CGQA 1ACPA 2FVAA 1OR5A 3NY7B 2QNWA 2KGEA 2JGPA 2JU1A 5HVCA 2LOLA 2FQ2A 4HKGA 2L9FA 5HV8A 2XZ1C 2M5RA 5KP8B 5EJDA 2LKIA 2LPKA 2N50A 3GZMA 1HY8A 2MVVA 2FQ1A 2KG8A 2K2QA 3EJEA 2AVAA 2N98A 4BPHA 2LIWA 2L0QA 2X2BA 2FQ0A 2KGDA 4H2XC 2AFDA 2N5HA 4NEOA 1NQ4A 1L0HA 2K0YA 2KR5A 2LIUA 2MY5A 3RG2A 2VSQA 1F80D 2CNRA 3CE7A 4MRTC 2XZ0D 1KLPA 2KGAA 4PWVB 1DNYA 2CG5B 3LMOA 2K92A 2K93A 2KOOA 2N6ZA 2KG9A 2FADA 2FVFA 4DG9A 2L4BA 4H2YC 2KOPA 2DNWA 2LL8A 2PNGA 2KW2A 2MR7A 3EJDA 2KOQA 2MR8A 2EHSA 2JQ4A 4PXHB 1X3OA 2MVUA 2FHSC 2K0XA 3EJBA 2L22A 2CQ8A 4R0MA 5CZDB 2FAEA 3GZLA 1AF8A 2GDYA 2JU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  2GDX A;  4CA3 A;  2EHT A;  2AFE A;  2LTE A;  2K94 A;  4BPF A;  1T8K A;  4H2W C;  5KP6 B;  2KGC A;  2N6Y A;  2MF4 A;  2ROQ A;  2KWL A;  2KOR A;  4IZ6 A;  2N5I A;  4BPG A;  2MD9 A;  2FVE A;  1L0I A;  5KP7 B;  2KG6 A;  2GDW A;  1DV5 A;  2AF8 A;  1VKU A;  1HQB A;  2LML A;  2FAC A;  2CGQ A;  1ACP A;  2FVA A;  1OR5 A;  3NY7 B;  2QNW A;  2KGE A;  2JGP A;  2JU1 A;  5HVC A;  2LOL A;  2FQ2 A;  4HKG A;  2L9F A;  5HV8 A;  2XZ1 C;  2M5R A;  5KP8 B;  5EJD A;  2LKI A;  2LPK A;  2N50 A;  3GZM A;  1HY8 A;  2MVV A;  2FQ1 A;  2KG8 A;  2K2Q A;  3EJE A;  2AVA A;  2N98 A;  4BPH A;  2LIW A;  2L0Q A;  2X2B A;  2FQ0 A;  2KGD A;  4H2X C;  2AFD A;  2N5H A;  4NEO A;  1NQ4 A;  1L0H A;  2K0Y A;  2KR5 A;  2LIU A;  2MY5 A;  3RG2 A;  2VSQ A;  1F80 D;  2CNR A;  3CE7 A;  4MRT C;  2XZ0 D;  1KLP A;  2KGA A;  4PWV B;  1DNY A;  2CG5 B;  3LMO A;  2K92 A;  2K93 A;  2KOO A;  2N6Z A;  2KG9 A;  2FAD A;  2FVF A;  4DG9 A;  2L4B A;  4H2Y C;  2KOP A;  2DNW A;  2LL8 A;  2PNG A;  2KW2 A;  2MR7 A;  3EJD A;  2KOQ A;  2MR8 A;  2EHS A;  2JQ4 A;  4PXH B;  1X3O A;  2MVU A;  2FHS C;  2K0X A;  3EJB A;  2L22 A;  2CQ8 A;  4R0M A;  5CZD B;  2FAE A;  3GZL A;  1AF8 A;  2GDY A;  2JU2 A; 
#chains in the Genus database with same CATH topology
 2VLQ A;  2GDX A;  1YI2 P;  3CCL P;  2OAR A;  2JBG A;  1VQK P;  3OW2 O;  2MF4 A;  2N5I A;  1VQ6 P;  1GXH A;  1VQ8 P;  5KP7 B;  2M8L A;  1HQB A;  1VKU A;  3RG6 C;  1RO0 A;  2LML A;  3Q20 A;  3GKL C;  4COC A;  1M74 A;  2QA4 P;  1Z6M A;  3G21 A;  5HGO A;  2M5R A;  2PEK A;  2KOD A;  3G4S P;  3DS0 A;  2LKI A;  4U0F A;  4UHP B;  2LPK A;  1Q86 Q;  2N50 A;  3GZM A;  3CXC O;  2N98 A;  4BPH A;  1MZ8 A;  2WPT A;  1EIA A;  2DGY A;  2ONT A;  4XFY A;  2XV6 A;  2GYK A;  1CEI A;  2PEM A;  2XXM A;  1NQ4 A;  1L0H A;  2MY5 A;  3U43 A;  3CCS P;  1F80 D;  2PEO A;  2XZ0 D;  4IPY A;  2EFJ A;  2CG5 B;  3LMO A;  3CCU P;  1IMP A;  1IMQ A;  1ZMB A;  2KOO A;  4DG9 A;  3CCV P;  1Q7Y Q;  3DS2 A;  2PEI A;  3CCE P;  1K73 Q;  1M1K Q;  2KOQ A;  2BUO A;  2PEQ A;  2JYG A;  2M8N A;  1YHQ P;  2FHS C;  5CZD B;  5JPA A;  4WYM A;  3G71 P;  1BXI A;  2FAE A;  3GZL A;  1AF8 A;  3CD6 P;  3LRY A;  1IUQ A;  4QNB A;  5KP6 B;  3NTE A;  1GXG A;  2KGC A;  1UJZ A;  2N6Y A;  3CMA P;  5HGM A;  2JYL A;  1VQN P;  2MD9 A;  4U0B A;  1L0I A;  2KG6 A;  2GDW A;  1A43 A;  2AF8 A;  3P05 A;  2Z45 A;  2CGQ A;  1ACP A;  3G28 A;  3G29 A;  2QNW A;  3DS5 A;  2JU1 A;  2JO0 A;  2LOL A;  1K8A Q;  5BS2 A;  3CCR P;  2XZ1 C;  1UNK A;  3DPH A;  1M6N A;  1HY8 A;  1YJW P;  1RO2 A;  2K2Q A;  3EJE A;  1FR2 A;  2QEX P;  2LIW A;  4XFZ A;  1D1D A;  2K5X A;  4XRO A;  1KD1 Q;  2JAZ A;  2N5H A;  4NEO A;  1KQS O;  2KR5 A;  2VSQ A;  2CNR A;  1KLP A;  4XFX A;  1EOQ A;  1VQO P;  2K92 A;  2K93 A;  1AUM A;  2N6Z A;  1Q81 Q;  5HGL A;  4H2Y C;  2PNG A;  3EJD A;  4U0E A;  3GJN A;  2EHS A;  3HYB A;  1X3O A;  2PEN A;  5DCK A;  3EJB A;  2L22 A;  3I56 P;  1E0H A;  2KOS A;  7CEI A;  4U0C A;  4CA3 A;  3DTJ A;  3HZQ A;  2AFE A;  2LTE A;  2K94 A;  2VLP A;  4BPF A;  1T8K A;  4H2W C;  2BHV A;  2ROQ A;  2KOR A;  4IZ6 A;  3DS1 A;  1DV5 A;  1VQ7 P;  4F37 A;  2FAC A;  3VRL C;  2GZJ A;  3NY7 B;  2KGE A;  5HVC A;  2FQ2 A;  4HKG A;  3G1I A;  2L9F A;  4XRQ A;  5HV8 A;  1VQ5 P;  5KP8 B;  5EJD A;  2VLO A;  2NO8 A;  3I55 P;  3G6E P;  2GZE A;  2KG8 A;  1S72 P;  2AVA A;  3CCM P;  3E2D A;  2ERH A;  2L0Q A;  2X2B A;  3MGE A;  1NJI Q;  1YIT P;  3B4Q A;  2EG5 A;  3H47 A;  1KC8 Q;  2LF4 A;  1AYI A;  1EMV A;  3CE7 A;  3WBH A;  1E6J P;  1GPJ A;  3CC4 P;  2KG9 A;  4PH0 A;  2OTJ P;  4GR2 A;  2FVF A;  2L4B A;  2LL8 A;  1K30 A;  3G26 A;  3B5I A;  2M8P A;  2KW2 A;  2MR7 A;  1YJN P;  4QKO A;  3DS3 A;  3CCJ P;  2XT1 A;  3CC7 P;  2JQ4 A;  2GZI A;  1JJ2 O;  5BS1 A;  1RNI A;  2K0X A;  2E1M A;  2CQ8 A;  1QVG O;  1A8O A;  2GDY A;  3CC2 P;  2K0D X;  1VQ9 P;  3DS4 A;  3CCQ P;  1Q82 Q;  1VHN A;  2Z46 A;  1M90 Q;  2EHT A;  1W2B O;  5EW5 E;  2OTL P;  2KWL A;  4BPG A;  1YJ9 P;  2FVE A;  1BAJ A;  4M0I A;  1VQL P;  5I4T G;  1N8R Q;  2FVA A;  1OR5 A;  2JGP A;  1ZNV A;  5HGN A;  4COP A;  2P9X A;  1QVF O;  2MVV A;  2FQ1 A;  4PH1 A;  1YIJ P;  1VQM P;  3G1G A;  2FQ0 A;  2KGD A;  4H2X C;  1VQ4 P;  3CPW O;  2AFD A;  3CME P;  3H0D A;  2K0Y A;  2LIU A;  3RG2 A;  3H4E A;  3M1M A;  4MRT C;  2KGA A;  2PY8 A;  4PWV B;  1M6E X;  1DNY A;  5F2K A;  1K9M Q;  3G0V A;  2GZG A;  2FAD A;  4U0A A;  2KOP A;  2DNW A;  2VLN A;  4U0D A;  1QRJ A;  2PEJ A;  1VQP P;  2MR8 A;  4GR6 A;  4PXH B;  2MVU A;  5F2O A;  2CWO A;  2JB0 A;  2Z44 A;  4R0M A;  2L6E A;  2EIA A;  5F2N A;  2GZF A;  2JU2 A; 
#chains in the Genus database with same CATH homology
 2KOS A;  2GDX A;  4CA3 A;  2EHT A;  2AFE A;  2LTE A;  2K94 A;  4BPF A;  1T8K A;  4H2W C;  5KP6 B;  2KGC A;  2N6Y A;  2MF4 A;  2ROQ A;  2KWL A;  2KOR A;  4IZ6 A;  2N5I A;  4BPG A;  2MD9 A;  2FVE A;  1L0I A;  5KP7 B;  2KG6 A;  2GDW A;  1DV5 A;  2AF8 A;  1VKU A;  1HQB A;  2LML A;  2FAC A;  2CGQ A;  1ACP A;  2FVA A;  1OR5 A;  3NY7 B;  2QNW A;  2KGE A;  2JGP A;  2JU1 A;  5HVC A;  2LOL A;  2FQ2 A;  4HKG A;  2L9F A;  5HV8 A;  2XZ1 C;  2M5R A;  5KP8 B;  5EJD A;  2LKI A;  2LPK A;  2N50 A;  3GZM A;  1HY8 A;  2MVV A;  2FQ1 A;  2KG8 A;  2K2Q A;  3EJE A;  2AVA A;  2N98 A;  4BPH A;  2LIW A;  2L0Q A;  2X2B A;  2FQ0 A;  2KGD A;  4H2X C;  2AFD A;  2N5H A;  4NEO A;  1NQ4 A;  1L0H A;  2K0Y A;  2KR5 A;  2LIU A;  2MY5 A;  3RG2 A;  2VSQ A;  1F80 D;  2CNR A;  3CE7 A;  4MRT C;  2XZ0 D;  1KLP A;  2KGA A;  4PWV B;  1DNY A;  2CG5 B;  3LMO A;  2K92 A;  2K93 A;  2KOO A;  2N6Z A;  2KG9 A;  2FAD A;  2FVF A;  4DG9 A;  2L4B A;  4H2Y C;  2KOP A;  2DNW A;  2LL8 A;  2PNG A;  2KW2 A;  2MR7 A;  3EJD A;  2KOQ A;  2MR8 A;  2EHS A;  2JQ4 A;  4PXH B;  1X3O A;  2MVU A;  2FHS C;  2K0X A;  3EJB A;  2L22 A;  2CQ8 A;  4R0M A;  5CZD B;  2FAE A;  3GZL A;  1AF8 A;  2GDY A;  2JU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...