2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10-formyltetrahydrofolate dehydrogenase
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
1T8KA 2JU1A 2KW2A 2LMLA 2KOPA 4HKGA 2GDWA 2MVUA 1ACPA 3CE7A 5EJDA 2FADA 2KOQA 1AF8A 2L0QA 2CG5B 2KORA 2MD9A 2L22A 2X2BA 3EJEA 4DG9A 2N5IA 5KP6B 2LIWA 1VKUA 2N5HA 1F80D 2CNRA 4R0MA 2FVAA 2LPKA 2LOLA 5HV8A 2M5RA 1DNYA 1KLPA 2CGQA 3GZMA 5CZDB 4H2WC 5HVCA 2CQ8A 2GDXA 2FHSC 2KOSA 2K0YA 4CA3A 1HY8A 2MR7A 1HQBA 2FQ1A 2XZ0D 2KGDA 2MVVA 2K0XA 2JGPA 3LMOA 2KGCA 2AVAA 2AF8A 2KGAA 2EHTA 2KG6A 2KG9A 2LKIA 2ROQA 1OR5A 2VSQA 2N6ZA 1X3OA 4NEOA 2FVFA 2K93A 2MF4A 4PWVB 2FVEA 2PNGA 2FQ2A 2AFDA 2KOOA 4BPHA 2QNWA 1L0IA 2DNWA 3NY7B 2EHSA 2K94A 2K2QA 2KG8A 2XZ1C 4H2XC 2GDYA 4MRTC 4BPGA 2N50A 5KP7B 3RG2A 2KWLA 3EJBA 2L4BA 4BPFA 2JQ4A 2LTEA 2N98A 2LL8A 1NQ4A 2FAEA 4H2YC 2JU2A 4PXHB 3EJDA 2L9FA 4IZ6A 2N6YA 2MY5A 2K92A 2KGEA 1L0HA 5KP8B 1DV5A 2LIUA 2FACA 2KR5A 2FQ0A 2AFEA 3GZLA 2MR8A
chains in the Genus database with same CATH superfamily
1T8KA 2JU1A 4UHPB 2E1MA 1YJNP 1ACPA 2PENA 2GZJA 4COPA 1VQPP 2JYLA 1VQ9P 3I55P 4QKOA 1A8OA 2KORA 4IPYA 3CCJP 2ERHA 1VKUA 2N5HA 2LPKA 1NJIQ 2PEMA 3B5IA 3I56P 1VQ5P 4U0CA 1DNYA 2PEJA 1Q81Q 3H0DA 4PH0A 4COCA 2CGQA 2GYKA 5CZDB 2CQ8A 3VRLC 4CA3A 2GZIA 1M6EX 2XXMA 1RO0A 3CC2P 2EHTA 2PEKA 5HGLA 2ROQA 1OR5A 1AYIA 3CC7P 2FVFA 2K93A 2FVEA 2AFDA 4BPHA 1IMQA 2QNWA 2EHSA 3NTEA 4XRQA 2QA4P 3G28A 2Z44A 2KODA 4BPFA 1K9MQ 2LL8A 1NQ4A 4QNBA 2L9FA 3HZQA 2Z46A 2KGEA 3CCEP 4XROA 3G29A 2LIUA 4M0IA 2AFEA 2JO0A 3CCUP 3CXCO 1Z6MA 1VQ6P 3DS5A 3DTJA 1K8AQ 1VHNA 4F37A 1GXHA 3P05A 4HKGA 2JB0A 2PY8A 2VLQA 3CE7A 4GR6A 1QVGO 1YJWP 1MZ8A 4WYMA 2FADA 2KOQA 3CCMP 3DPHA 2K5XA 3H4EA 2CG5B 2EG5A 2NO8A 1BAJA 2L22A 5BS1A 5HGOA 2N5IA 5KP6B 2LIWA 2M8NA 1UJZA 2M5RA 3G6EP 1AUMA 3G1GA 5HVCA 2K0YA 1HY8A 2MR7A 1E0HA 2XZ0D 2KGDA 2MVVA 3G0VA 2N6ZA 2VLNA 2QEXP 3OW2O 2L6EA 2CWOA 2FQ2A 1L0IA 3G1IA 2KG8A 1ZNVA 2GDYA 4BPGA 5KP7B 2KWLA 2JQ4A 3G4SP 1VQNP 1BXIA 1EOQA 4H2YC 2EFJA 3EJDA 2JBGA 1KC8Q 2N6YA 2K92A 4U0FA 4U0EA 1QRJA 1DV5A 1VQOP 2VLPA 2KR5A 4U0DA 3G21A 2FQ0A 2VLOA 2MR8A 1Q82Q 4U0AA 2KW2A 1N8RQ 1A43A 2P9XA 1S72P 5DCKA 2MVUA 5EJDA 2L0QA 1IMPA 1VQMP 5HGNA 2GZEA 5F2KA 2OTLP 2FVAA 1VQ7P 5JPAA 5F2OA 4H2WC 2K0DX 2DGYA 3G26A 2JGPA 1JJ2O 3LMOA 2PEQA 2AVAA 2KGAA 3CCVP 2KG6A 2WPTA 3U43A 2KG9A 3MGEA 2VSQA 3CCRP 1CEIA 1VQLP 2JYGA 5EW5E 1IUQA 3DS0A 2DNWA 1ZMBA 3NY7B 4GR2A 2K94A 3RG6C 5F2NA 2OARA 1W2BO 4XFZA 5HGMA 4MRTC 3EJBA 1KD1Q 1EIAA 2M8PA 2LTEA 1Q86Q 1M6NA 1K73Q 2GZGA 4IZ6A 1M74A 2MY5A 1K30A 3CCLP 3CCSP 5KP8B 3LRYA 7CEIA 2LOLA 1UNKA 2LMLA 2EIAA 2M8LA 2KOPA 3Q20A 4PH1A 3CD6P 3B4QA 4U0BA 2GDWA 1GPJA 2BHVA 1AF8A 2XT1A 3GKLC 3H47A 3WBHA 1D1DA 2Z45A 2MD9A 2X2BA 3EJEA 4DG9A 2PEIA 1F80D 2CNRA 1YI2P 3M1MA 4R0MA 3DS3A 5HV8A 1M90Q 3CPWO 1KLPA 3GZMA 3DS2A 2GDXA 2FHSC 1RO2A 2KOSA 1M1KQ 1HQBA 3CC4P 2FQ1A 2BUOA 2K0XA 1Q7YQ 2KGCA 2AF8A 3GJNA 1VQ4P 3HYBA 2PEOA 2LKIA 1X3OA 4NEOA 3G71P 3E2DA 5BS2A 2MF4A 4XFXA 3DS4A 3CMAP 2ONTA 1YITP 1VQKP 4PWVB 1YJ9P 2PNGA 2KOOA 2GZFA 3DS1A 1VQ8P 2K2QA 1EMVA 3CMEP 2XZ1C 2XV6A 4H2XC 3CCQP 2N50A 3RG2A 2LF4A 2OTJP 2L4BA 1RNIA 1KQSO 2N98A 1YIJP 1YHQP 2FAEA 2JU2A 4PXHB 1QVFO 5I4TG 4XFYA 1FR2A 2JAZA 1E6JP 1L0HA 2FACA 1GXGA 3GZLA
chains in the Genus database with same CATH topology
1T8KA 2JU1A 2KW2A 2LMLA 2KOPA 4HKGA 2GDWA 2MVUA 1ACPA 3CE7A 5EJDA 2FADA 2KOQA 1AF8A 2L0QA 2CG5B 2KORA 2MD9A 2L22A 2X2BA 3EJEA 4DG9A 2N5IA 5KP6B 2LIWA 1VKUA 2N5HA 1F80D 2CNRA 4R0MA 2FVAA 2LPKA 2LOLA 5HV8A 2M5RA 1DNYA 1KLPA 2CGQA 3GZMA 5CZDB 4H2WC 5HVCA 2CQ8A 2GDXA 2FHSC 2KOSA 2K0YA 4CA3A 1HY8A 2MR7A 1HQBA 2FQ1A 2XZ0D 2KGDA 2MVVA 2K0XA 2JGPA 3LMOA 2KGCA 2AVAA 2AF8A 2KGAA 2EHTA 2KG6A 2KG9A 2LKIA 2ROQA 1OR5A 2VSQA 2N6ZA 1X3OA 4NEOA 2FVFA 2K93A 2MF4A 4PWVB 2FVEA 2PNGA 2FQ2A 2AFDA 2KOOA 4BPHA 2QNWA 1L0IA 2DNWA 3NY7B 2EHSA 2K94A 2K2QA 2KG8A 2XZ1C 4H2XC 2GDYA 4MRTC 4BPGA 2N50A 5KP7B 3RG2A 2KWLA 3EJBA 2L4BA 4BPFA 2JQ4A 2LTEA 2N98A 2LL8A 1NQ4A 2FAEA 4H2YC 2JU2A 4PXHB 3EJDA 2L9FA 4IZ6A 2N6YA 2MY5A 2K92A 2KGEA 1L0HA 5KP8B 1DV5A 2LIUA 2FACA 2KR5A 2FQ0A 2AFEA 3GZLA 2MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8K A;  2JU1 A;  2KW2 A;  2LML A;  2KOP A;  4HKG A;  2GDW A;  2MVU A;  1ACP A;  3CE7 A;  5EJD A;  2FAD A;  2KOQ A;  1AF8 A;  2L0Q A;  2CG5 B;  2KOR A;  2MD9 A;  2L22 A;  2X2B A;  3EJE A;  4DG9 A;  2N5I A;  5KP6 B;  2LIW A;  1VKU A;  2N5H A;  1F80 D;  2CNR A;  4R0M A;  2FVA A;  2LPK A;  2LOL A;  5HV8 A;  2M5R A;  1DNY A;  1KLP A;  2CGQ A;  3GZM A;  5CZD B;  4H2W C;  5HVC A;  2CQ8 A;  2GDX A;  2FHS C;  2KOS A;  2K0Y A;  4CA3 A;  1HY8 A;  2MR7 A;  1HQB A;  2FQ1 A;  2XZ0 D;  2KGD A;  2MVV A;  2K0X A;  2JGP A;  3LMO A;  2KGC A;  2AVA A;  2AF8 A;  2KGA A;  2EHT A;  2KG6 A;  2KG9 A;  2LKI A;  2ROQ A;  1OR5 A;  2VSQ A;  2N6Z A;  1X3O A;  4NEO A;  2FVF A;  2K93 A;  2MF4 A;  4PWV B;  2FVE A;  2PNG A;  2FQ2 A;  2AFD A;  2KOO A;  4BPH A;  2QNW A;  1L0I A;  2DNW A;  3NY7 B;  2EHS A;  2K94 A;  2K2Q A;  2KG8 A;  2XZ1 C;  4H2X C;  2GDY A;  4MRT C;  4BPG A;  2N50 A;  5KP7 B;  3RG2 A;  2KWL A;  3EJB A;  2L4B A;  4BPF A;  2JQ4 A;  2LTE A;  2N98 A;  2LL8 A;  1NQ4 A;  2FAE A;  4H2Y C;  2JU2 A;  4PXH B;  3EJD A;  2L9F A;  4IZ6 A;  2N6Y A;  2MY5 A;  2K92 A;  2KGE A;  1L0H A;  5KP8 B;  1DV5 A;  2LIU A;  2FAC A;  2KR5 A;  2FQ0 A;  2AFE A;  3GZL A;  2MR8 A; 
#chains in the Genus database with same CATH topology
 1T8K A;  2JU1 A;  4UHP B;  2E1M A;  1YJN P;  1ACP A;  2PEN A;  2GZJ A;  4COP A;  1VQP P;  2JYL A;  1VQ9 P;  3I55 P;  4QKO A;  1A8O A;  2KOR A;  4IPY A;  3CCJ P;  2ERH A;  1VKU A;  2N5H A;  2LPK A;  1NJI Q;  2PEM A;  3B5I A;  3I56 P;  1VQ5 P;  4U0C A;  1DNY A;  2PEJ A;  1Q81 Q;  3H0D A;  4PH0 A;  4COC A;  2CGQ A;  2GYK A;  5CZD B;  2CQ8 A;  3VRL C;  4CA3 A;  2GZI A;  1M6E X;  2XXM A;  1RO0 A;  3CC2 P;  2EHT A;  2PEK A;  5HGL A;  2ROQ A;  1OR5 A;  1AYI A;  3CC7 P;  2FVF A;  2K93 A;  2FVE A;  2AFD A;  4BPH A;  1IMQ A;  2QNW A;  2EHS A;  3NTE A;  4XRQ A;  2QA4 P;  3G28 A;  2Z44 A;  2KOD A;  4BPF A;  1K9M Q;  2LL8 A;  1NQ4 A;  4QNB A;  2L9F A;  3HZQ A;  2Z46 A;  2KGE A;  3CCE P;  4XRO A;  3G29 A;  2LIU A;  4M0I A;  2AFE A;  2JO0 A;  3CCU P;  3CXC O;  1Z6M A;  1VQ6 P;  3DS5 A;  3DTJ A;  1K8A Q;  1VHN A;  4F37 A;  1GXH A;  3P05 A;  4HKG A;  2JB0 A;  2PY8 A;  2VLQ A;  3CE7 A;  4GR6 A;  1QVG O;  1YJW P;  1MZ8 A;  4WYM A;  2FAD A;  2KOQ A;  3CCM P;  3DPH A;  2K5X A;  3H4E A;  2CG5 B;  2EG5 A;  2NO8 A;  1BAJ A;  2L22 A;  5BS1 A;  5HGO A;  2N5I A;  5KP6 B;  2LIW A;  2M8N A;  1UJZ A;  2M5R A;  3G6E P;  1AUM A;  3G1G A;  5HVC A;  2K0Y A;  1HY8 A;  2MR7 A;  1E0H A;  2XZ0 D;  2KGD A;  2MVV A;  3G0V A;  2N6Z A;  2VLN A;  2QEX P;  3OW2 O;  2L6E A;  2CWO A;  2FQ2 A;  1L0I A;  3G1I A;  2KG8 A;  1ZNV A;  2GDY A;  4BPG A;  5KP7 B;  2KWL A;  2JQ4 A;  3G4S P;  1VQN P;  1BXI A;  1EOQ A;  4H2Y C;  2EFJ A;  3EJD A;  2JBG A;  1KC8 Q;  2N6Y A;  2K92 A;  4U0F A;  4U0E A;  1QRJ A;  1DV5 A;  1VQO P;  2VLP A;  2KR5 A;  4U0D A;  3G21 A;  2FQ0 A;  2VLO A;  2MR8 A;  1Q82 Q;  4U0A A;  2KW2 A;  1N8R Q;  1A43 A;  2P9X A;  1S72 P;  5DCK A;  2MVU A;  5EJD A;  2L0Q A;  1IMP A;  1VQM P;  5HGN A;  2GZE A;  5F2K A;  2OTL P;  2FVA A;  1VQ7 P;  5JPA A;  5F2O A;  4H2W C;  2K0D X;  2DGY A;  3G26 A;  2JGP A;  1JJ2 O;  3LMO A;  2PEQ A;  2AVA A;  2KGA A;  3CCV P;  2KG6 A;  2WPT A;  3U43 A;  2KG9 A;  3MGE A;  2VSQ A;  3CCR P;  1CEI A;  1VQL P;  2JYG A;  5EW5 E;  1IUQ A;  3DS0 A;  2DNW A;  1ZMB A;  3NY7 B;  4GR2 A;  2K94 A;  3RG6 C;  5F2N A;  2OAR A;  1W2B O;  4XFZ A;  5HGM A;  4MRT C;  3EJB A;  1KD1 Q;  1EIA A;  2M8P A;  2LTE A;  1Q86 Q;  1M6N A;  1K73 Q;  2GZG A;  4IZ6 A;  1M74 A;  2MY5 A;  1K30 A;  3CCL P;  3CCS P;  5KP8 B;  3LRY A;  7CEI A;  2LOL A;  1UNK A;  2LML A;  2EIA A;  2M8L A;  2KOP A;  3Q20 A;  4PH1 A;  3CD6 P;  3B4Q A;  4U0B A;  2GDW A;  1GPJ A;  2BHV A;  1AF8 A;  2XT1 A;  3GKL C;  3H47 A;  3WBH A;  1D1D A;  2Z45 A;  2MD9 A;  2X2B A;  3EJE A;  4DG9 A;  2PEI A;  1F80 D;  2CNR A;  1YI2 P;  3M1M A;  4R0M A;  3DS3 A;  5HV8 A;  1M90 Q;  3CPW O;  1KLP A;  3GZM A;  3DS2 A;  2GDX A;  2FHS C;  1RO2 A;  2KOS A;  1M1K Q;  1HQB A;  3CC4 P;  2FQ1 A;  2BUO A;  2K0X A;  1Q7Y Q;  2KGC A;  2AF8 A;  3GJN A;  1VQ4 P;  3HYB A;  2PEO A;  2LKI A;  1X3O A;  4NEO A;  3G71 P;  3E2D A;  5BS2 A;  2MF4 A;  4XFX A;  3DS4 A;  3CMA P;  2ONT A;  1YIT P;  1VQK P;  4PWV B;  1YJ9 P;  2PNG A;  2KOO A;  2GZF A;  3DS1 A;  1VQ8 P;  2K2Q A;  1EMV A;  3CME P;  2XZ1 C;  2XV6 A;  4H2X C;  3CCQ P;  2N50 A;  3RG2 A;  2LF4 A;  2OTJ P;  2L4B A;  1RNI A;  1KQS O;  2N98 A;  1YIJ P;  1YHQ P;  2FAE A;  2JU2 A;  4PXH B;  1QVF O;  5I4T G;  4XFY A;  1FR2 A;  2JAZ A;  1E6J P;  1L0H A;  2FAC A;  1GXG A;  3GZL A; 
#chains in the Genus database with same CATH homology
 1T8K A;  2JU1 A;  2KW2 A;  2LML A;  2KOP A;  4HKG A;  2GDW A;  2MVU A;  1ACP A;  3CE7 A;  5EJD A;  2FAD A;  2KOQ A;  1AF8 A;  2L0Q A;  2CG5 B;  2KOR A;  2MD9 A;  2L22 A;  2X2B A;  3EJE A;  4DG9 A;  2N5I A;  5KP6 B;  2LIW A;  1VKU A;  2N5H A;  1F80 D;  2CNR A;  4R0M A;  2FVA A;  2LPK A;  2LOL A;  5HV8 A;  2M5R A;  1DNY A;  1KLP A;  2CGQ A;  3GZM A;  5CZD B;  4H2W C;  5HVC A;  2CQ8 A;  2GDX A;  2FHS C;  2KOS A;  2K0Y A;  4CA3 A;  1HY8 A;  2MR7 A;  1HQB A;  2FQ1 A;  2XZ0 D;  2KGD A;  2MVV A;  2K0X A;  2JGP A;  3LMO A;  2KGC A;  2AVA A;  2AF8 A;  2KGA A;  2EHT A;  2KG6 A;  2KG9 A;  2LKI A;  2ROQ A;  1OR5 A;  2VSQ A;  2N6Z A;  1X3O A;  4NEO A;  2FVF A;  2K93 A;  2MF4 A;  4PWV B;  2FVE A;  2PNG A;  2FQ2 A;  2AFD A;  2KOO A;  4BPH A;  2QNW A;  1L0I A;  2DNW A;  3NY7 B;  2EHS A;  2K94 A;  2K2Q A;  2KG8 A;  2XZ1 C;  4H2X C;  2GDY A;  4MRT C;  4BPG A;  2N50 A;  5KP7 B;  3RG2 A;  2KWL A;  3EJB A;  2L4B A;  4BPF A;  2JQ4 A;  2LTE A;  2N98 A;  2LL8 A;  1NQ4 A;  2FAE A;  4H2Y C;  2JU2 A;  4PXH B;  3EJD A;  2L9F A;  4IZ6 A;  2N6Y A;  2MY5 A;  2K92 A;  2KGE A;  1L0H A;  5KP8 B;  1DV5 A;  2LIU A;  2FAC A;  2KR5 A;  2FQ0 A;  2AFE A;  3GZL A;  2MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...