2CQ8A

Solution structure of rsgi ruh-033, a pp-binding domain of 10-fthfdh from human cdna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
110
structure length
110
Chain Sequence
GSSGSSGFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-033, a pp-binding domain of 10-FTHFDH from human cDNA
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 10-formyltetrahydrofolate dehydrogenase
total genus 23
structure length 110
sequence length 110
ec nomenclature ec 1.5.1.6: Formyltetrahydrofolate dehydrogenase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2cq8A01
2MY5A 2FADA 1F80D 2KR5A 5HVCA 3EJBA 2MR7A 1AF8A 2FHSC 1T8KA 2KW2A 2MD9A 2LTEA 1L0HA 1DV5A 1OR5A 1ACPA 4MRTC 5CZDB 2KOPA 2N5HA 2FVFA 2PNGA 1DNYA 2LKIA 2KOQA 2N98A 2KGAA 1HQBA 3GZMA 2K2QA 4IZ6A 2JGPA 2FVEA 2GDXA 2FQ1A 4H2YC 2KG6A 4H2XC 5KP6B 2MVVA 2L9FA 2KGEA 2AFEA 4BPHA 2ROQA 2MR8A 2LMLA 2AF8A 2KOSA 5HV8A 4PXHB 2AVAA 2FQ2A 4HKGA 2VSQA 2N5IA 2LIUA 3EJDA 5KP8B 2JU2A 2LL8A 2LIWA 3NY7B 5EJDA 3LMOA 2EHTA 4NEOA 2QNWA 4DG9A 5KP7B 2FVAA 2KWLA 2XZ1C 2CQ8A 2KG9A 2L22A 4BPFA 2CGQA 2KGCA 2N6YA 1X3OA 2XZ0D 2CG5B 1HY8A 3EJEA 2CNRA 4H2WC 2MF4A 2KORA 2DNWA 2LOLA 2GDYA 4PWVB 2GDWA 2L0QA 1VKUA 2FAEA 2JQ4A 2K0YA 3RG2A 2K93A 2X2BA 2FQ0A 2N6ZA 2MVUA 2FACA 2K92A 2EHSA 4BPGA 2K0XA 2LPKA 3GZLA 4R0MA 2KG8A 2KGDA 1L0IA 2L4BA 2K94A 4CA3A 1NQ4A 2KOOA 3CE7A 2JU1A 2N50A 2M5RA 1KLPA 2AFDA
chains in the Genus database with same CATH superfamily
3B4QA 3G26A 2PEMA 2MY5A 5HGLA 2BUOA 3GJNA 3RG6C 1AF8A 3CPWO 3B5IA 2FHSC 1S72P 2PENA 1M1KQ 1YHQP 1YJNP 1BXIA 1M74A 3I56P 1Q82Q 4U0BA 1IMPA 2KOPA 5HGMA 1DNYA 2KOQA 1K30A 3CCMP 3M1MA 3GZMA 3G29A 4H2YC 2KG6A 2KGEA 1EIAA 4BPHA 2MR8A 1AUMA 2LMLA 5HV8A 4PXHB 2AVAA 2EIAA 4QKOA 1Q7YQ 4WYMA 2JU2A 2LL8A 3LMOA 2QA4P 1YI2P 2PEIA 1K8AQ 1EMVA 2Z46A 4COPA 2CQ8A 2KG9A 2QEXP 1X3OA 3CMAP 2MF4A 2KORA 2LOLA 2GDWA 2L0QA 2FAEA 3CCVP 1VQOP 2MVUA 1A43A 2FACA 2K92A 2EHSA 1GXHA 4BPGA 2K0XA 2LPKA 4R0MA 1VQLP 1VQKP 3CXCO 2ERHA 3CE7A 3DS1A 2N50A 2AFDA 2OARA 4UHPB 1F80D 2MR7A 2KW2A 2LTEA 1L0HA 3G1GA 3G1IA 3DS3A 3DTJA 2Z44A 4MRTC 1KD1Q 1VQ9P 2JBGA 2L6EA 2K0DX 2VLQA 4XFXA 2GZEA 1E0HA 4IZ6A 2JGPA 3CD6P 1Q81Q 2GDXA 2FQ1A 2KODA 5DCKA 2M8PA 1NJIQ 4U0CA 3P05A 3U43A 2KOSA 2JYLA 3HZQA 2FQ2A 3CC2P 1VQ6P 1VQ5P 1ZNVA 2N5IA 3LRYA 4PH1A 1Z6MA 2FVAA 2XV6A 3I55P 4U0AA 5F2OA 2N6YA 1VQ7P 2XZ0D 3NTEA 3CCLP 1YIJP 1KC8Q 4PWVB 3Q20A 1Q86Q 1VQ8P 1JJ2O 1W2BO 2PEQA 1ZMBA 5JPAA 1QVFO 3HYBA 2KG8A 1L0IA 2L4BA 4CA3A 1YITP 2M5RA 1KLPA 2OTLP 3DS0A 2GZJA 1GXGA 1IMQA 2Z45A 3CCJP 1VQNP 3DS5A 4GR6A 1VHNA 1DV5A 1YJWP 1IUQA 3H0DA 2K5XA 4U0DA 5EW5E 1M6EX 5CZDB 1N8RQ 1AYIA 2N5HA 3DS2A 2FVFA 3DPHA 3G6EP 2N98A 2KGAA 2XXMA 2M8NA 5F2KA 4XRQA 4COCA 3G28A 5KP6B 1RO2A 2MVVA 2L9FA 2AFEA 2GZFA 1CEIA 2ROQA 1EOQA 2AF8A 5F2NA 1BAJA 3CC4P 2XT1A 3G4SP 2VSQA 3EJDA 2VLPA 3CCUP 2CWOA 5KP8B 2LIWA 3NY7B 5EJDA 1M6NA 2EHTA 2QNWA 2JYGA 2GYKA 4DG9A 5KP7B 2WPTA 3DS4A 2L22A 4BPFA 3CCEP 2CGQA 1K73Q 2KGCA 1M90Q 2CG5B 3WBHA 4H2WC 1E6JP 2DGYA 2DNWA 2GDYA 4F37A 2E1MA 1UJZA 1VKUA 2JQ4A 2P9XA 2K93A 2PEJA 2FQ0A 2N6ZA 2JO0A 1A8OA 1VQPP 1VQ4P 3GZLA 4XFYA 1FR2A 2KOOA 2XZ1C 4U0FA 4M0IA 3VRLC 2FADA 1YJ9P 2KR5A 5HVCA 3EJBA 5I4TG 1T8KA 2JAZA 2MD9A 1OR5A 1ACPA 1RO0A 4PH0A 4GR2A 2PNGA 2LKIA 3GKLC 3MGEA 4QNBA 1HQBA 2K2QA 2GZIA 3OW2O 1QRJA 2FVEA 3H4EA 4U0EA 3CCSP 4H2XC 3G21A 2ONTA 4IPYA 3G0VA 4HKGA 2NO8A 5HGOA 2LIUA 3CCQP 3H47A 3CCRP 4NEOA 7CEIA 2LF4A 2KWLA 1MZ8A 2VLOA 2BHVA 3CMEP 1HY8A 3EJEA 2CNRA 1QVGO 2EG5A 2PY8A 2EFJA 1KQSO 2PEKA 2JB0A 2M8LA 2K0YA 3RG2A 3G71P 1D1DA 2X2BA 1GPJA 5HGNA 5BS2A 2GZGA 1VQMP 2OTJP 1UNKA 1RNIA 5BS1A 2KGDA 3E2DA 2VLNA 2K94A 1NQ4A 4XFZA 4XROA 2JU1A 2PEOA 3CC7P 1K9MQ
chains in the Genus database with same CATH topology
2MY5A 2FADA 1F80D 2KR5A 5HVCA 3EJBA 2MR7A 1AF8A 2FHSC 1T8KA 2KW2A 2MD9A 2LTEA 1L0HA 1DV5A 1OR5A 1ACPA 4MRTC 5CZDB 2KOPA 2N5HA 2FVFA 2PNGA 1DNYA 2LKIA 2KOQA 2N98A 2KGAA 1HQBA 3GZMA 2K2QA 4IZ6A 2JGPA 2FVEA 2GDXA 2FQ1A 4H2YC 2KG6A 4H2XC 5KP6B 2MVVA 2L9FA 2KGEA 2AFEA 4BPHA 2ROQA 2MR8A 2LMLA 2AF8A 2KOSA 5HV8A 4PXHB 2AVAA 2FQ2A 4HKGA 2VSQA 2N5IA 2LIUA 3EJDA 5KP8B 2JU2A 2LL8A 2LIWA 3NY7B 5EJDA 3LMOA 2EHTA 4NEOA 2QNWA 4DG9A 5KP7B 2FVAA 2KWLA 2XZ1C 2CQ8A 2KG9A 2L22A 4BPFA 2CGQA 2KGCA 2N6YA 1X3OA 2XZ0D 2CG5B 1HY8A 3EJEA 2CNRA 4H2WC 2MF4A 2KORA 2DNWA 2LOLA 2GDYA 4PWVB 2GDWA 2L0QA 1VKUA 2FAEA 2JQ4A 2K0YA 3RG2A 2K93A 2X2BA 2FQ0A 2N6ZA 2MVUA 2FACA 2K92A 2EHSA 4BPGA 2K0XA 2LPKA 3GZLA 4R0MA 2KG8A 2KGDA 1L0IA 2L4BA 2K94A 4CA3A 1NQ4A 2KOOA 3CE7A 2JU1A 2N50A 2M5RA 1KLPA 2AFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  2FAD A;  1F80 D;  2KR5 A;  5HVC A;  3EJB A;  2MR7 A;  1AF8 A;  2FHS C;  1T8K A;  2KW2 A;  2MD9 A;  2LTE A;  1L0H A;  1DV5 A;  1OR5 A;  1ACP A;  4MRT C;  5CZD B;  2KOP A;  2N5H A;  2FVF A;  2PNG A;  1DNY A;  2LKI A;  2KOQ A;  2N98 A;  2KGA A;  1HQB A;  3GZM A;  2K2Q A;  4IZ6 A;  2JGP A;  2FVE A;  2GDX A;  2FQ1 A;  4H2Y C;  2KG6 A;  4H2X C;  5KP6 B;  2MVV A;  2L9F A;  2KGE A;  2AFE A;  4BPH A;  2ROQ A;  2MR8 A;  2LML A;  2AF8 A;  2KOS A;  5HV8 A;  4PXH B;  2AVA A;  2FQ2 A;  4HKG A;  2VSQ A;  2N5I A;  2LIU A;  3EJD A;  5KP8 B;  2JU2 A;  2LL8 A;  2LIW A;  3NY7 B;  5EJD A;  3LMO A;  2EHT A;  4NEO A;  2QNW A;  4DG9 A;  5KP7 B;  2FVA A;  2KWL A;  2XZ1 C;  2CQ8 A;  2KG9 A;  2L22 A;  4BPF A;  2CGQ A;  2KGC A;  2N6Y A;  1X3O A;  2XZ0 D;  2CG5 B;  1HY8 A;  3EJE A;  2CNR A;  4H2W C;  2MF4 A;  2KOR A;  2DNW A;  2LOL A;  2GDY A;  4PWV B;  2GDW A;  2L0Q A;  1VKU A;  2FAE A;  2JQ4 A;  2K0Y A;  3RG2 A;  2K93 A;  2X2B A;  2FQ0 A;  2N6Z A;  2MVU A;  2FAC A;  2K92 A;  2EHS A;  4BPG A;  2K0X A;  2LPK A;  3GZL A;  4R0M A;  2KG8 A;  2KGD A;  1L0I A;  2L4B A;  2K94 A;  4CA3 A;  1NQ4 A;  2KOO A;  3CE7 A;  2JU1 A;  2N50 A;  2M5R A;  1KLP A;  2AFD A; 
#chains in the Genus database with same CATH topology
 3B4Q A;  3G26 A;  2PEM A;  2MY5 A;  5HGL A;  2BUO A;  3GJN A;  3RG6 C;  1AF8 A;  3CPW O;  3B5I A;  2FHS C;  1S72 P;  2PEN A;  1M1K Q;  1YHQ P;  1YJN P;  1BXI A;  1M74 A;  3I56 P;  1Q82 Q;  4U0B A;  1IMP A;  2KOP A;  5HGM A;  1DNY A;  2KOQ A;  1K30 A;  3CCM P;  3M1M A;  3GZM A;  3G29 A;  4H2Y C;  2KG6 A;  2KGE A;  1EIA A;  4BPH A;  2MR8 A;  1AUM A;  2LML A;  5HV8 A;  4PXH B;  2AVA A;  2EIA A;  4QKO A;  1Q7Y Q;  4WYM A;  2JU2 A;  2LL8 A;  3LMO A;  2QA4 P;  1YI2 P;  2PEI A;  1K8A Q;  1EMV A;  2Z46 A;  4COP A;  2CQ8 A;  2KG9 A;  2QEX P;  1X3O A;  3CMA P;  2MF4 A;  2KOR A;  2LOL A;  2GDW A;  2L0Q A;  2FAE A;  3CCV P;  1VQO P;  2MVU A;  1A43 A;  2FAC A;  2K92 A;  2EHS A;  1GXH A;  4BPG A;  2K0X A;  2LPK A;  4R0M A;  1VQL P;  1VQK P;  3CXC O;  2ERH A;  3CE7 A;  3DS1 A;  2N50 A;  2AFD A;  2OAR A;  4UHP B;  1F80 D;  2MR7 A;  2KW2 A;  2LTE A;  1L0H A;  3G1G A;  3G1I A;  3DS3 A;  3DTJ A;  2Z44 A;  4MRT C;  1KD1 Q;  1VQ9 P;  2JBG A;  2L6E A;  2K0D X;  2VLQ A;  4XFX A;  2GZE A;  1E0H A;  4IZ6 A;  2JGP A;  3CD6 P;  1Q81 Q;  2GDX A;  2FQ1 A;  2KOD A;  5DCK A;  2M8P A;  1NJI Q;  4U0C A;  3P05 A;  3U43 A;  2KOS A;  2JYL A;  3HZQ A;  2FQ2 A;  3CC2 P;  1VQ6 P;  1VQ5 P;  1ZNV A;  2N5I A;  3LRY A;  4PH1 A;  1Z6M A;  2FVA A;  2XV6 A;  3I55 P;  4U0A A;  5F2O A;  2N6Y A;  1VQ7 P;  2XZ0 D;  3NTE A;  3CCL P;  1YIJ P;  1KC8 Q;  4PWV B;  3Q20 A;  1Q86 Q;  1VQ8 P;  1JJ2 O;  1W2B O;  2PEQ A;  1ZMB A;  5JPA A;  1QVF O;  3HYB A;  2KG8 A;  1L0I A;  2L4B A;  4CA3 A;  1YIT P;  2M5R A;  1KLP A;  2OTL P;  3DS0 A;  2GZJ A;  1GXG A;  1IMQ A;  2Z45 A;  3CCJ P;  1VQN P;  3DS5 A;  4GR6 A;  1VHN A;  1DV5 A;  1YJW P;  1IUQ A;  3H0D A;  2K5X A;  4U0D A;  5EW5 E;  1M6E X;  5CZD B;  1N8R Q;  1AYI A;  2N5H A;  3DS2 A;  2FVF A;  3DPH A;  3G6E P;  2N98 A;  2KGA A;  2XXM A;  2M8N A;  5F2K A;  4XRQ A;  4COC A;  3G28 A;  5KP6 B;  1RO2 A;  2MVV A;  2L9F A;  2AFE A;  2GZF A;  1CEI A;  2ROQ A;  1EOQ A;  2AF8 A;  5F2N A;  1BAJ A;  3CC4 P;  2XT1 A;  3G4S P;  2VSQ A;  3EJD A;  2VLP A;  3CCU P;  2CWO A;  5KP8 B;  2LIW A;  3NY7 B;  5EJD A;  1M6N A;  2EHT A;  2QNW A;  2JYG A;  2GYK A;  4DG9 A;  5KP7 B;  2WPT A;  3DS4 A;  2L22 A;  4BPF A;  3CCE P;  2CGQ A;  1K73 Q;  2KGC A;  1M90 Q;  2CG5 B;  3WBH A;  4H2W C;  1E6J P;  2DGY A;  2DNW A;  2GDY A;  4F37 A;  2E1M A;  1UJZ A;  1VKU A;  2JQ4 A;  2P9X A;  2K93 A;  2PEJ A;  2FQ0 A;  2N6Z A;  2JO0 A;  1A8O A;  1VQP P;  1VQ4 P;  3GZL A;  4XFY A;  1FR2 A;  2KOO A;  2XZ1 C;  4U0F A;  4M0I A;  3VRL C;  2FAD A;  1YJ9 P;  2KR5 A;  5HVC A;  3EJB A;  5I4T G;  1T8K A;  2JAZ A;  2MD9 A;  1OR5 A;  1ACP A;  1RO0 A;  4PH0 A;  4GR2 A;  2PNG A;  2LKI A;  3GKL C;  3MGE A;  4QNB A;  1HQB A;  2K2Q A;  2GZI A;  3OW2 O;  1QRJ A;  2FVE A;  3H4E A;  4U0E A;  3CCS P;  4H2X C;  3G21 A;  2ONT A;  4IPY A;  3G0V A;  4HKG A;  2NO8 A;  5HGO A;  2LIU A;  3CCQ P;  3H47 A;  3CCR P;  4NEO A;  7CEI A;  2LF4 A;  2KWL A;  1MZ8 A;  2VLO A;  2BHV A;  3CME P;  1HY8 A;  3EJE A;  2CNR A;  1QVG O;  2EG5 A;  2PY8 A;  2EFJ A;  1KQS O;  2PEK A;  2JB0 A;  2M8L A;  2K0Y A;  3RG2 A;  3G71 P;  1D1D A;  2X2B A;  1GPJ A;  5HGN A;  5BS2 A;  2GZG A;  1VQM P;  2OTJ P;  1UNK A;  1RNI A;  5BS1 A;  2KGD A;  3E2D A;  2VLN A;  2K94 A;  1NQ4 A;  4XFZ A;  4XRO A;  2JU1 A;  2PEO A;  3CC7 P;  1K9M Q; 
#chains in the Genus database with same CATH homology
 2MY5 A;  2FAD A;  1F80 D;  2KR5 A;  5HVC A;  3EJB A;  2MR7 A;  1AF8 A;  2FHS C;  1T8K A;  2KW2 A;  2MD9 A;  2LTE A;  1L0H A;  1DV5 A;  1OR5 A;  1ACP A;  4MRT C;  5CZD B;  2KOP A;  2N5H A;  2FVF A;  2PNG A;  1DNY A;  2LKI A;  2KOQ A;  2N98 A;  2KGA A;  1HQB A;  3GZM A;  2K2Q A;  4IZ6 A;  2JGP A;  2FVE A;  2GDX A;  2FQ1 A;  4H2Y C;  2KG6 A;  4H2X C;  5KP6 B;  2MVV A;  2L9F A;  2KGE A;  2AFE A;  4BPH A;  2ROQ A;  2MR8 A;  2LML A;  2AF8 A;  2KOS A;  5HV8 A;  4PXH B;  2AVA A;  2FQ2 A;  4HKG A;  2VSQ A;  2N5I A;  2LIU A;  3EJD A;  5KP8 B;  2JU2 A;  2LL8 A;  2LIW A;  3NY7 B;  5EJD A;  3LMO A;  2EHT A;  4NEO A;  2QNW A;  4DG9 A;  5KP7 B;  2FVA A;  2KWL A;  2XZ1 C;  2CQ8 A;  2KG9 A;  2L22 A;  4BPF A;  2CGQ A;  2KGC A;  2N6Y A;  1X3O A;  2XZ0 D;  2CG5 B;  1HY8 A;  3EJE A;  2CNR A;  4H2W C;  2MF4 A;  2KOR A;  2DNW A;  2LOL A;  2GDY A;  4PWV B;  2GDW A;  2L0Q A;  1VKU A;  2FAE A;  2JQ4 A;  2K0Y A;  3RG2 A;  2K93 A;  2X2B A;  2FQ0 A;  2N6Z A;  2MVU A;  2FAC A;  2K92 A;  2EHS A;  4BPG A;  2K0X A;  2LPK A;  3GZL A;  4R0M A;  2KG8 A;  2KGD A;  1L0I A;  2L4B A;  2K94 A;  4CA3 A;  1NQ4 A;  2KOO A;  3CE7 A;  2JU1 A;  2N50 A;  2M5R A;  1KLP A;  2AFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...