2KR5A

Solution structure of an acyl carrier protein domain from fungal type i polyketide synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
AMAKGVGVSNEKLDAVMRVVSEESGIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALKDFMLGSGDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Solution structure of an acyl carrier protein domain from a fungal type I polyketide synthase.
pubmed doi rcsb
source organism Aspergillus parasiticus
molecule tags Transport protein
total genus 20
structure length 89
sequence length 89
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kr5A01
4MRTC 4DG9A 2FVFA 2FADA 2FVEA 2KOOA 5HV8A 2DNWA 2FQ1A 2KWLA 3RG2A 4BPHA 1L0IA 2K94A 4BPFA 2MD9A 4H2WC 2MR7A 2CNRA 2LPKA 2KGEA 1X3OA 2MVUA 2K93A 2N6ZA 2N5HA 5KP7B 2KG6A 2LMLA 4PXHB 2XZ1C 4H2XC 2JQ4A 2KG9A 1DNYA 2FVAA 2K0XA 2K2QA 2AFEA 2KOPA 2N6YA 4IZ6A 5CZDB 1HQBA 2L9FA 2MF4A 2FQ2A 1L0HA 4CA3A 2L4BA 3NY7B 2FAEA 2GDYA 2N5IA 2ROQA 2MVVA 2LIWA 2KOQA 2AFDA 2N98A 2AVAA 2JU1A 1VKUA 2LOLA 2JU2A 2KGCA 1NQ4A 2EHTA 2FQ0A 2L0QA 2LL8A 2LIUA 2KW2A 2KR5A 3GZLA 3LMOA 2M5RA 2JGPA 2GDXA 2K0YA 4HKGA 2K92A 3GZMA 2CQ8A 2MY5A 3EJBA 2PNGA 2FHSC 2XZ0D 1DV5A 3EJDA 5HVCA 2LTEA 2X2BA 4NEOA 2KGDA 2KOSA 4H2YC 2QNWA 1ACPA 1F80D 2FACA 1KLPA 2AF8A 4PWVB 5KP6B 2KG8A 3CE7A 4R0MA 1OR5A 1T8KA 5EJDA 2KGAA 2L22A 3EJEA 2VSQA 2MR8A 2N50A 1AF8A 2CG5B 2GDWA 5KP8B 2EHSA 1HY8A 2CGQA 2KORA 2LKIA 4BPGA
chains in the Genus database with same CATH superfamily
3U43A 2FVFA 5BS1A 2KOOA 5HV8A 5HGOA 3DS2A 2CNRA 1VQOP 4UHPB 5EW5E 3WBHA 2K93A 1EOQA 1IMQA 5HGLA 3DS0A 3G71P 4H2XC 2VLNA 2FVAA 4GR6A 4QNBA 3I55P 2FQ2A 1ZNVA 2PEOA 4XFYA 2BUOA 2GDYA 1VQ6P 1KQSO 1VQ8P 2EFJA 2KOQA 2E1MA 2AVAA 2LOLA 4COCA 3G1GA 1BAJA 2PY8A 1YI2P 2JAZA 3B4QA 2OARA 1IUQA 2OTJP 2KW2A 2M8PA 1EIAA 2GDXA 2K0YA 2KODA 2M8LA 2K92A 3GZMA 3CCSP 3CC2P 2MY5A 2XXMA 1DV5A 3EJDA 5HVCA 2LTEA 2KGDA 4PH0A 2KOSA 2XT1A 2EIAA 3DS4A 2KG8A 1NJIQ 3DS3A 5EJDA 3P05A 2K0DX 4COPA 1AF8A 2CG5B 2GDWA 2L6EA 3CCVP 1YIJP 1K30A 1K8AQ 4XFXA 2GZJA 3CC7P 1VQNP 1VQ9P 2FVEA 2KWLA 7CEIA 1L0IA 4BPFA 3Q20A 1GPJA 2MD9A 1A43A 1N8RQ 2VLQA 2MR7A 2KGEA 2Z45A 1UJZA 1AUMA 2KG6A 4PXHB 1Q7YQ 2XZ1C 1DNYA 1M1KQ 3CCEP 1VQ7P 3CCMP 2K2QA 4U0DA 2AFEA 1RNIA 1YJWP 2KOPA 2N6YA 1EMVA 1HQBA 2LF4A 2MF4A 3E2DA 1M6EX 5HGNA 4CA3A 2L4BA 3CD6P 2N5IA 2N98A 1A8OA 1NQ4A 3GKLC 1K73Q 3B5IA 5F2NA 3LMOA 1AYIA 2JBGA 2VLOA 4U0BA 1D1DA 1E0HA 2JGPA 3RG6C 4HKGA 3DS1A 1Z6MA 3MGEA 4NEOA 3CMEP 1Q86Q 2PEKA 1F80D 4XROA 5KP6B 2GYKA 4R0MA 1OR5A 2GZEA 2Z44A 1YITP 5BS2A 2QEXP 2GZGA 1M74A 5KP8B 1UNKA 1YHQP 2PEMA 2KORA 3OW2O 4BPGA 3G29A 1FR2A 1W2BO 2XV6A 5DCKA 3G4SP 3CCLP 1GXHA 1X3OA 2N6ZA 5KP7B 5I4TG 2ERHA 2LMLA 3CCQP 3VRLC 1RO2A 2JQ4A 2KG9A 3H47A 1S72P 5CZDB 3I56P 3HZQA 2L9FA 2P9XA 3NY7B 2FAEA 1YJNP 3CCRP 1QRJA 4M0IA 1M90Q 2K5XA 2LIWA 2AFDA 3CPWO 2JU1A 1VKUA 1Q82Q 2JU2A 1E6JP 2KGCA 1RO0A 2JYLA 1MZ8A 1IMPA 2L0QA 2LL8A 2LIUA 2KR5A 1M6NA 2EG5A 2M5RA 2M8NA 2WPTA 3G21A 1KC8Q 3CXCO 1VQKP 3EJBA 2FHSC 2XZ0D 3DPHA 2BHVA 1Q81Q 3LRYA 3G0VA 3DS5A 2QNWA 3CCUP 3GJNA 4PWVB 5JPAA 3CE7A 1T8KA 4F37A 3G28A 3EJEA 2VSQA 2MR8A 1JJ2O 2ONTA 3NTEA 1KD1Q 2EHSA 5F2OA 2CGQA 1VQLP 2PEQA 4QKOA 1YJ9P 4MRTC 4DG9A 4BPHA 2FADA 3RG2A 2DNWA 2FQ1A 2K94A 3HYBA 4XFZA 2Z46A 4GR2A 2JYGA 4U0FA 3G1IA 2PEJA 4H2WC 3CC4P 2LPKA 5HGMA 2MVUA 3CCJP 1BXIA 2NO8A 1CEIA 2N5HA 1K9MQ 2PENA 2QA4P 3CMAP 3G26A 2K0XA 1VQPP 4WYMA 4IZ6A 2GZIA 1L0HA 3M1MA 2JO0A 2ROQA 2MVVA 4IPYA 3H4EA 1ZMBA 2EHTA 2FQ0A 3G6EP 3GZLA 2DGYA 4PH1A 3DTJA 4U0AA 1VQ4P 2CQ8A 1VQ5P 2CWOA 2PNGA 1VHNA 2X2BA 4U0CA 2GZFA 2JB0A 2VLPA 4H2YC 1ACPA 2FACA 1KLPA 2AF8A 2PEIA 4U0EA 1QVGO 2KGAA 2L22A 5F2KA 1GXGA 1QVFO 2N50A 1VQMP 3H0DA 1HY8A 4XRQA 2OTLP 2LKIA
chains in the Genus database with same CATH topology
4MRTC 4DG9A 2FVFA 2FADA 2FVEA 2KOOA 5HV8A 2DNWA 2FQ1A 2KWLA 3RG2A 4BPHA 1L0IA 2K94A 4BPFA 2MD9A 4H2WC 2MR7A 2CNRA 2LPKA 2KGEA 1X3OA 2MVUA 2K93A 2N6ZA 2N5HA 5KP7B 2KG6A 2LMLA 4PXHB 2XZ1C 4H2XC 2JQ4A 2KG9A 1DNYA 2FVAA 2K0XA 2K2QA 2AFEA 2KOPA 2N6YA 4IZ6A 5CZDB 1HQBA 2L9FA 2MF4A 2FQ2A 1L0HA 4CA3A 2L4BA 3NY7B 2FAEA 2GDYA 2N5IA 2ROQA 2MVVA 2LIWA 2KOQA 2AFDA 2N98A 2AVAA 2JU1A 1VKUA 2LOLA 2JU2A 2KGCA 1NQ4A 2EHTA 2FQ0A 2L0QA 2LL8A 2LIUA 2KW2A 2KR5A 3GZLA 3LMOA 2M5RA 2JGPA 2GDXA 2K0YA 4HKGA 2K92A 3GZMA 2CQ8A 2MY5A 3EJBA 2PNGA 2FHSC 2XZ0D 1DV5A 3EJDA 5HVCA 2LTEA 2X2BA 4NEOA 2KGDA 2KOSA 4H2YC 2QNWA 1ACPA 1F80D 2FACA 1KLPA 2AF8A 4PWVB 5KP6B 2KG8A 3CE7A 4R0MA 1OR5A 1T8KA 5EJDA 2KGAA 2L22A 3EJEA 2VSQA 2MR8A 2N50A 1AF8A 2CG5B 2GDWA 5KP8B 2EHSA 1HY8A 2CGQA 2KORA 2LKIA 4BPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRT C;  4DG9 A;  2FVF A;  2FAD A;  2FVE A;  2KOO A;  5HV8 A;  2DNW A;  2FQ1 A;  2KWL A;  3RG2 A;  4BPH A;  1L0I A;  2K94 A;  4BPF A;  2MD9 A;  4H2W C;  2MR7 A;  2CNR A;  2LPK A;  2KGE A;  1X3O A;  2MVU A;  2K93 A;  2N6Z A;  2N5H A;  5KP7 B;  2KG6 A;  2LML A;  4PXH B;  2XZ1 C;  4H2X C;  2JQ4 A;  2KG9 A;  1DNY A;  2FVA A;  2K0X A;  2K2Q A;  2AFE A;  2KOP A;  2N6Y A;  4IZ6 A;  5CZD B;  1HQB A;  2L9F A;  2MF4 A;  2FQ2 A;  1L0H A;  4CA3 A;  2L4B A;  3NY7 B;  2FAE A;  2GDY A;  2N5I A;  2ROQ A;  2MVV A;  2LIW A;  2KOQ A;  2AFD A;  2N98 A;  2AVA A;  2JU1 A;  1VKU A;  2LOL A;  2JU2 A;  2KGC A;  1NQ4 A;  2EHT A;  2FQ0 A;  2L0Q A;  2LL8 A;  2LIU A;  2KW2 A;  2KR5 A;  3GZL A;  3LMO A;  2M5R A;  2JGP A;  2GDX A;  2K0Y A;  4HKG A;  2K92 A;  3GZM A;  2CQ8 A;  2MY5 A;  3EJB A;  2PNG A;  2FHS C;  2XZ0 D;  1DV5 A;  3EJD A;  5HVC A;  2LTE A;  2X2B A;  4NEO A;  2KGD A;  2KOS A;  4H2Y C;  2QNW A;  1ACP A;  1F80 D;  2FAC A;  1KLP A;  2AF8 A;  4PWV B;  5KP6 B;  2KG8 A;  3CE7 A;  4R0M A;  1OR5 A;  1T8K A;  5EJD A;  2KGA A;  2L22 A;  3EJE A;  2VSQ A;  2MR8 A;  2N50 A;  1AF8 A;  2CG5 B;  2GDW A;  5KP8 B;  2EHS A;  1HY8 A;  2CGQ A;  2KOR A;  2LKI A;  4BPG A; 
#chains in the Genus database with same CATH topology
 3U43 A;  2FVF A;  5BS1 A;  2KOO A;  5HV8 A;  5HGO A;  3DS2 A;  2CNR A;  1VQO P;  4UHP B;  5EW5 E;  3WBH A;  2K93 A;  1EOQ A;  1IMQ A;  5HGL A;  3DS0 A;  3G71 P;  4H2X C;  2VLN A;  2FVA A;  4GR6 A;  4QNB A;  3I55 P;  2FQ2 A;  1ZNV A;  2PEO A;  4XFY A;  2BUO A;  2GDY A;  1VQ6 P;  1KQS O;  1VQ8 P;  2EFJ A;  2KOQ A;  2E1M A;  2AVA A;  2LOL A;  4COC A;  3G1G A;  1BAJ A;  2PY8 A;  1YI2 P;  2JAZ A;  3B4Q A;  2OAR A;  1IUQ A;  2OTJ P;  2KW2 A;  2M8P A;  1EIA A;  2GDX A;  2K0Y A;  2KOD A;  2M8L A;  2K92 A;  3GZM A;  3CCS P;  3CC2 P;  2MY5 A;  2XXM A;  1DV5 A;  3EJD A;  5HVC A;  2LTE A;  2KGD A;  4PH0 A;  2KOS A;  2XT1 A;  2EIA A;  3DS4 A;  2KG8 A;  1NJI Q;  3DS3 A;  5EJD A;  3P05 A;  2K0D X;  4COP A;  1AF8 A;  2CG5 B;  2GDW A;  2L6E A;  3CCV P;  1YIJ P;  1K30 A;  1K8A Q;  4XFX A;  2GZJ A;  3CC7 P;  1VQN P;  1VQ9 P;  2FVE A;  2KWL A;  7CEI A;  1L0I A;  4BPF A;  3Q20 A;  1GPJ A;  2MD9 A;  1A43 A;  1N8R Q;  2VLQ A;  2MR7 A;  2KGE A;  2Z45 A;  1UJZ A;  1AUM A;  2KG6 A;  4PXH B;  1Q7Y Q;  2XZ1 C;  1DNY A;  1M1K Q;  3CCE P;  1VQ7 P;  3CCM P;  2K2Q A;  4U0D A;  2AFE A;  1RNI A;  1YJW P;  2KOP A;  2N6Y A;  1EMV A;  1HQB A;  2LF4 A;  2MF4 A;  3E2D A;  1M6E X;  5HGN A;  4CA3 A;  2L4B A;  3CD6 P;  2N5I A;  2N98 A;  1A8O A;  1NQ4 A;  3GKL C;  1K73 Q;  3B5I A;  5F2N A;  3LMO A;  1AYI A;  2JBG A;  2VLO A;  4U0B A;  1D1D A;  1E0H A;  2JGP A;  3RG6 C;  4HKG A;  3DS1 A;  1Z6M A;  3MGE A;  4NEO A;  3CME P;  1Q86 Q;  2PEK A;  1F80 D;  4XRO A;  5KP6 B;  2GYK A;  4R0M A;  1OR5 A;  2GZE A;  2Z44 A;  1YIT P;  5BS2 A;  2QEX P;  2GZG A;  1M74 A;  5KP8 B;  1UNK A;  1YHQ P;  2PEM A;  2KOR A;  3OW2 O;  4BPG A;  3G29 A;  1FR2 A;  1W2B O;  2XV6 A;  5DCK A;  3G4S P;  3CCL P;  1GXH A;  1X3O A;  2N6Z A;  5KP7 B;  5I4T G;  2ERH A;  2LML A;  3CCQ P;  3VRL C;  1RO2 A;  2JQ4 A;  2KG9 A;  3H47 A;  1S72 P;  5CZD B;  3I56 P;  3HZQ A;  2L9F A;  2P9X A;  3NY7 B;  2FAE A;  1YJN P;  3CCR P;  1QRJ A;  4M0I A;  1M90 Q;  2K5X A;  2LIW A;  2AFD A;  3CPW O;  2JU1 A;  1VKU A;  1Q82 Q;  2JU2 A;  1E6J P;  2KGC A;  1RO0 A;  2JYL A;  1MZ8 A;  1IMP A;  2L0Q A;  2LL8 A;  2LIU A;  2KR5 A;  1M6N A;  2EG5 A;  2M5R A;  2M8N A;  2WPT A;  3G21 A;  1KC8 Q;  3CXC O;  1VQK P;  3EJB A;  2FHS C;  2XZ0 D;  3DPH A;  2BHV A;  1Q81 Q;  3LRY A;  3G0V A;  3DS5 A;  2QNW A;  3CCU P;  3GJN A;  4PWV B;  5JPA A;  3CE7 A;  1T8K A;  4F37 A;  3G28 A;  3EJE A;  2VSQ A;  2MR8 A;  1JJ2 O;  2ONT A;  3NTE A;  1KD1 Q;  2EHS A;  5F2O A;  2CGQ A;  1VQL P;  2PEQ A;  4QKO A;  1YJ9 P;  4MRT C;  4DG9 A;  4BPH A;  2FAD A;  3RG2 A;  2DNW A;  2FQ1 A;  2K94 A;  3HYB A;  4XFZ A;  2Z46 A;  4GR2 A;  2JYG A;  4U0F A;  3G1I A;  2PEJ A;  4H2W C;  3CC4 P;  2LPK A;  5HGM A;  2MVU A;  3CCJ P;  1BXI A;  2NO8 A;  1CEI A;  2N5H A;  1K9M Q;  2PEN A;  2QA4 P;  3CMA P;  3G26 A;  2K0X A;  1VQP P;  4WYM A;  4IZ6 A;  2GZI A;  1L0H A;  3M1M A;  2JO0 A;  2ROQ A;  2MVV A;  4IPY A;  3H4E A;  1ZMB A;  2EHT A;  2FQ0 A;  3G6E P;  3GZL A;  2DGY A;  4PH1 A;  3DTJ A;  4U0A A;  1VQ4 P;  2CQ8 A;  1VQ5 P;  2CWO A;  2PNG A;  1VHN A;  2X2B A;  4U0C A;  2GZF A;  2JB0 A;  2VLP A;  4H2Y C;  1ACP A;  2FAC A;  1KLP A;  2AF8 A;  2PEI A;  4U0E A;  1QVG O;  2KGA A;  2L22 A;  5F2K A;  1GXG A;  1QVF O;  2N50 A;  1VQM P;  3H0D A;  1HY8 A;  4XRQ A;  2OTL P;  2LKI A; 
#chains in the Genus database with same CATH homology
 4MRT C;  4DG9 A;  2FVF A;  2FAD A;  2FVE A;  2KOO A;  5HV8 A;  2DNW A;  2FQ1 A;  2KWL A;  3RG2 A;  4BPH A;  1L0I A;  2K94 A;  4BPF A;  2MD9 A;  4H2W C;  2MR7 A;  2CNR A;  2LPK A;  2KGE A;  1X3O A;  2MVU A;  2K93 A;  2N6Z A;  2N5H A;  5KP7 B;  2KG6 A;  2LML A;  4PXH B;  2XZ1 C;  4H2X C;  2JQ4 A;  2KG9 A;  1DNY A;  2FVA A;  2K0X A;  2K2Q A;  2AFE A;  2KOP A;  2N6Y A;  4IZ6 A;  5CZD B;  1HQB A;  2L9F A;  2MF4 A;  2FQ2 A;  1L0H A;  4CA3 A;  2L4B A;  3NY7 B;  2FAE A;  2GDY A;  2N5I A;  2ROQ A;  2MVV A;  2LIW A;  2KOQ A;  2AFD A;  2N98 A;  2AVA A;  2JU1 A;  1VKU A;  2LOL A;  2JU2 A;  2KGC A;  1NQ4 A;  2EHT A;  2FQ0 A;  2L0Q A;  2LL8 A;  2LIU A;  2KW2 A;  2KR5 A;  3GZL A;  3LMO A;  2M5R A;  2JGP A;  2GDX A;  2K0Y A;  4HKG A;  2K92 A;  3GZM A;  2CQ8 A;  2MY5 A;  3EJB A;  2PNG A;  2FHS C;  2XZ0 D;  1DV5 A;  3EJD A;  5HVC A;  2LTE A;  2X2B A;  4NEO A;  2KGD A;  2KOS A;  4H2Y C;  2QNW A;  1ACP A;  1F80 D;  2FAC A;  1KLP A;  2AF8 A;  4PWV B;  5KP6 B;  2KG8 A;  3CE7 A;  4R0M A;  1OR5 A;  1T8K A;  5EJD A;  2KGA A;  2L22 A;  3EJE A;  2VSQ A;  2MR8 A;  2N50 A;  1AF8 A;  2CG5 B;  2GDW A;  5KP8 B;  2EHS A;  1HY8 A;  2CGQ A;  2KOR A;  2LKI A;  4BPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...