2KR5A

Solution structure of an acyl carrier protein domain from fungal type i polyketide synthase
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
AMAKGVGVSNEKLDAVMRVVSEESGIALEELTDDSNFADMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALKDFMLGSGDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Aflatoxin biosynthesis polyketide synthase
publication title Solution structure of an acyl carrier protein domain from a fungal type I polyketide synthase.
pubmed doi rcsb
source organism Aspergillus parasiticus
total genus 20
structure length 89
sequence length 89
ec nomenclature ec 2.3.1.221: Noranthrone synthase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kr5A01
2K93A 1OR5A 2FHSC 2N98A 2GDYA 3GZMA 2KWLA 2GDWA 3EJEA 2EHTA 2K94A 2AF8A 1X3OA 2PNGA 2FVEA 2X2BA 4H2YC 2KOPA 5CZDB 2LOLA 2LIWA 5KP6B 2K2QA 2MVVA 2DNWA 2MR7A 1VKUA 5HV8A 2FQ1A 1DNYA 2AFDA 2N6ZA 2N5IA 1F80D 5EJDA 2K92A 1L0HA 1HY8A 2KOQA 1NQ4A 2MR8A 5KP7B 4HKGA 2LTEA 3EJBA 2KG9A 2LPKA 2JU2A 2K0YA 2N5HA 2XZ1C 2KGDA 1L0IA 1T8KA 2N6YA 2FACA 2EHSA 4BPHA 4PWVB 4NEOA 2FVAA 2FADA 2L4BA 2KG6A 2KGEA 4H2WC 1DV5A 2ROQA 2KOOA 2KGCA 2LMLA 3CE7A 2CNRA 4MRTC 2AVAA 2CGQA 5KP8B 1AF8A 4R0MA 4BPFA 2KR5A 3LMOA 2MD9A 1ACPA 2LIUA 3EJDA 2K0XA 2VSQA 4PXHB 2FVFA 2MY5A 2L0QA 3GZLA 2N50A 2FAEA 2FQ0A 4BPGA 2CQ8A 2KGAA 2LKIA 2KORA 2GDXA 2JGPA 2XZ0D 5HVCA 2CG5B 2MVUA 2MF4A 4CA3A 1KLPA 2JQ4A 2FQ2A 2M5RA 3NY7B 1HQBA 4H2XC 2LL8A 3RG2A 2QNWA 2L22A 2KOSA 2KG8A 2JU1A 2KW2A 4IZ6A 4DG9A 2L9FA 2AFEA
chains in the Genus database with same CATH superfamily
1OR5A 2FHSC 1VQOP 3G6EP 1M6NA 2GDWA 1EIAA 4PH0A 4XFZA 1K8AQ 5EW5E 3CCRP 1Q82Q 2X2BA 1JJ2O 2Z44A 2LOLA 2WPTA 2JO0A 2LIWA 3CCLP 2K2QA 4QKOA 2XV6A 1M74A 3CCEP 1IUQA 4XROA 2ERHA 1L0HA 1HY8A 3CCUP 3I55P 2LF4A 4HKGA 1T8KA 2M8NA 4PWVB 2FVAA 1BAJA 2FADA 1ZMBA 2KG6A 2KGEA 3CCVP 1DV5A 1EOQA 2ROQA 2KOOA 1KC8Q 2AVAA 1M90Q 4R0MA 4U0FA 3H4EA 3HZQA 3LMOA 1VQ7P 2JYLA 2VLOA 3EJDA 1VQLP 1VQ8P 2VSQA 2FVFA 3CC7P 4QNBA 1QVFO 1A8OA 1VHNA 4GR6A 3CC2P 2FQ0A 2KGAA 2NO8A 3G1GA 7CEIA 3CXCO 2GDXA 2M8LA 2GZGA 1VQ5P 2XZ0D 1KD1Q 1IMQA 2MVUA 3NY7B 3RG2A 2QNWA 2L22A 5BS2A 2KG8A 2KW2A 3DPHA 1K73Q 2PENA 2K0DX 2GZJA 3CMAP 2XXMA 4F37A 2QA4P 3EJEA 2K94A 1Q86Q 2PNGA 3OW2O 5BS1A 5KP6B 5HGOA 3DS5A 2FQ1A 3M1MA 2BHVA 2AFDA 2EG5A 1YI2P 2XT1A 1F80D 2GZFA 5EJDA 2K92A 3DS2A 1VQ6P 2KOQA 4UHPB 4IPYA 1NJIQ 2LTEA 2PY8A 2LPKA 3G4SP 1E6JP 2XZ1C 2KGDA 1L0IA 3CCSP 2GYKA 4BPHA 2OTLP 5HGNA 4H2WC 3U43A 2VLPA 3CE7A 1VQKP 2CNRA 4MRTC 2CGQA 5KP8B 1YJ9P 4BPFA 1GXGA 1BXIA 2LIUA 1Q81Q 2L0QA 1E0HA 1M6EX 3CCMP 5HVCA 3DS0A 2CG5B 2JBGA 1YJWP 2JQ4A 2FQ2A 1W2BO 1QRJA 4IZ6A 4DG9A 3G21A 1Q7YQ 3GZMA 2EFJA 2EHTA 2OTJP 2AF8A 2P9XA 1VQ9P 2PEKA 5CZDB 5I4TG 2DNWA 1EMVA 2MVVA 3B5IA 1YHQP 2MR7A 4M0IA 2JYGA 2N6ZA 1AYIA 2M8PA 4U0DA 3CPWO 1A43A 5HGLA 5KP7B 2PEIA 2KG9A 2K0YA 2BUOA 2Z45A 2OARA 2N6YA 2FACA 4NEOA 1YIJP 2KGCA 2LMLA 1M1KQ 1ZNVA 3H47A 1RO0A 3DS1A 4XFXA 1AF8A 3Q20A 1ACPA 2E1MA 2MY5A 4WYMA 4U0AA 2ONTA 3G0VA 3G26A 5F2OA 4XRQA 2CQ8A 2L6EA 4BPGA 2LKIA 1K9MQ 2KORA 2JGPA 4XFYA 2VLNA 3MGEA 4CA3A 1KLPA 1VQ4P 1Z6MA 1HQBA 5DCKA 5JPAA 4GR2A 1UNKA 2KOSA 3DS4A 3E2DA 4U0EA 3VRLC 2Z46A 2L9FA 2AFEA 3I56P 4PH1A 1VQNP 3G28A 2K93A 3RG6C 3CCJP 3NTEA 2N98A 2GDYA 2JAZA 2KWLA 1YJNP 1X3OA 3CCQP 2FVEA 3H0DA 4H2YC 2KOPA 1N8RQ 2PEQA 3DTJA 1VKUA 5HV8A 3GKLC 3P05A 1DNYA 2GZIA 1UJZA 2PEJA 2N5IA 1IMPA 1VQPP 2VLQA 1NQ4A 2MR8A 3EJBA 2JU2A 2N5HA 2KODA 2PEOA 2JB0A 3B4QA 1KQSO 2DGYA 2EHSA 4U0BA 1FR2A 2L4BA 1QVGO 5F2KA 4COCA 4COPA 2GZEA 1GPJA 3G1IA 1RO2A 1MZ8A 1GXHA 2KR5A 2K5XA 3WBHA 1S72P 2MD9A 5F2NA 3HYBA 2K0XA 1RNIA 4PXHB 3DS3A 3LRYA 3GZLA 2N50A 2FAEA 1CEIA 1K30A 5HGMA 3CMEP 4U0CA 3CC4P 2MF4A 2QEXP 2M5RA 2PEMA 1D1DA 4H2XC 2LL8A 1VQMP 3G29A 2JU1A 1YITP 2EIAA 2CWOA 1AUMA 3GJNA 3G71P 3CD6P
chains in the Genus database with same CATH topology
2K93A 1OR5A 2FHSC 2N98A 2GDYA 3GZMA 2KWLA 2GDWA 3EJEA 2EHTA 2K94A 2AF8A 1X3OA 2PNGA 2FVEA 2X2BA 4H2YC 2KOPA 5CZDB 2LOLA 2LIWA 5KP6B 2K2QA 2MVVA 2DNWA 2MR7A 1VKUA 5HV8A 2FQ1A 1DNYA 2AFDA 2N6ZA 2N5IA 1F80D 5EJDA 2K92A 1L0HA 1HY8A 2KOQA 1NQ4A 2MR8A 5KP7B 4HKGA 2LTEA 3EJBA 2KG9A 2LPKA 2JU2A 2K0YA 2N5HA 2XZ1C 2KGDA 1L0IA 1T8KA 2N6YA 2FACA 2EHSA 4BPHA 4PWVB 4NEOA 2FVAA 2FADA 2L4BA 2KG6A 2KGEA 4H2WC 1DV5A 2ROQA 2KOOA 2KGCA 2LMLA 3CE7A 2CNRA 4MRTC 2AVAA 2CGQA 5KP8B 1AF8A 4R0MA 4BPFA 2KR5A 3LMOA 2MD9A 1ACPA 2LIUA 3EJDA 2K0XA 2VSQA 4PXHB 2FVFA 2MY5A 2L0QA 3GZLA 2N50A 2FAEA 2FQ0A 4BPGA 2CQ8A 2KGAA 2LKIA 2KORA 2GDXA 2JGPA 2XZ0D 5HVCA 2CG5B 2MVUA 2MF4A 4CA3A 1KLPA 2JQ4A 2FQ2A 2M5RA 3NY7B 1HQBA 4H2XC 2LL8A 3RG2A 2QNWA 2L22A 2KOSA 2KG8A 2JU1A 2KW2A 4IZ6A 4DG9A 2L9FA 2AFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  1OR5 A;  2FHS C;  2N98 A;  2GDY A;  3GZM A;  2KWL A;  2GDW A;  3EJE A;  2EHT A;  2K94 A;  2AF8 A;  1X3O A;  2PNG A;  2FVE A;  2X2B A;  4H2Y C;  2KOP A;  5CZD B;  2LOL A;  2LIW A;  5KP6 B;  2K2Q A;  2MVV A;  2DNW A;  2MR7 A;  1VKU A;  5HV8 A;  2FQ1 A;  1DNY A;  2AFD A;  2N6Z A;  2N5I A;  1F80 D;  5EJD A;  2K92 A;  1L0H A;  1HY8 A;  2KOQ A;  1NQ4 A;  2MR8 A;  5KP7 B;  4HKG A;  2LTE A;  3EJB A;  2KG9 A;  2LPK A;  2JU2 A;  2K0Y A;  2N5H A;  2XZ1 C;  2KGD A;  1L0I A;  1T8K A;  2N6Y A;  2FAC A;  2EHS A;  4BPH A;  4PWV B;  4NEO A;  2FVA A;  2FAD A;  2L4B A;  2KG6 A;  2KGE A;  4H2W C;  1DV5 A;  2ROQ A;  2KOO A;  2KGC A;  2LML A;  3CE7 A;  2CNR A;  4MRT C;  2AVA A;  2CGQ A;  5KP8 B;  1AF8 A;  4R0M A;  4BPF A;  2KR5 A;  3LMO A;  2MD9 A;  1ACP A;  2LIU A;  3EJD A;  2K0X A;  2VSQ A;  4PXH B;  2FVF A;  2MY5 A;  2L0Q A;  3GZL A;  2N50 A;  2FAE A;  2FQ0 A;  4BPG A;  2CQ8 A;  2KGA A;  2LKI A;  2KOR A;  2GDX A;  2JGP A;  2XZ0 D;  5HVC A;  2CG5 B;  2MVU A;  2MF4 A;  4CA3 A;  1KLP A;  2JQ4 A;  2FQ2 A;  2M5R A;  3NY7 B;  1HQB A;  4H2X C;  2LL8 A;  3RG2 A;  2QNW A;  2L22 A;  2KOS A;  2KG8 A;  2JU1 A;  2KW2 A;  4IZ6 A;  4DG9 A;  2L9F A;  2AFE A; 
#chains in the Genus database with same CATH topology
 1OR5 A;  2FHS C;  1VQO P;  3G6E P;  1M6N A;  2GDW A;  1EIA A;  4PH0 A;  4XFZ A;  1K8A Q;  5EW5 E;  3CCR P;  1Q82 Q;  2X2B A;  1JJ2 O;  2Z44 A;  2LOL A;  2WPT A;  2JO0 A;  2LIW A;  3CCL P;  2K2Q A;  4QKO A;  2XV6 A;  1M74 A;  3CCE P;  1IUQ A;  4XRO A;  2ERH A;  1L0H A;  1HY8 A;  3CCU P;  3I55 P;  2LF4 A;  4HKG A;  1T8K A;  2M8N A;  4PWV B;  2FVA A;  1BAJ A;  2FAD A;  1ZMB A;  2KG6 A;  2KGE A;  3CCV P;  1DV5 A;  1EOQ A;  2ROQ A;  2KOO A;  1KC8 Q;  2AVA A;  1M90 Q;  4R0M A;  4U0F A;  3H4E A;  3HZQ A;  3LMO A;  1VQ7 P;  2JYL A;  2VLO A;  3EJD A;  1VQL P;  1VQ8 P;  2VSQ A;  2FVF A;  3CC7 P;  4QNB A;  1QVF O;  1A8O A;  1VHN A;  4GR6 A;  3CC2 P;  2FQ0 A;  2KGA A;  2NO8 A;  3G1G A;  7CEI A;  3CXC O;  2GDX A;  2M8L A;  2GZG A;  1VQ5 P;  2XZ0 D;  1KD1 Q;  1IMQ A;  2MVU A;  3NY7 B;  3RG2 A;  2QNW A;  2L22 A;  5BS2 A;  2KG8 A;  2KW2 A;  3DPH A;  1K73 Q;  2PEN A;  2K0D X;  2GZJ A;  3CMA P;  2XXM A;  4F37 A;  2QA4 P;  3EJE A;  2K94 A;  1Q86 Q;  2PNG A;  3OW2 O;  5BS1 A;  5KP6 B;  5HGO A;  3DS5 A;  2FQ1 A;  3M1M A;  2BHV A;  2AFD A;  2EG5 A;  1YI2 P;  2XT1 A;  1F80 D;  2GZF A;  5EJD A;  2K92 A;  3DS2 A;  1VQ6 P;  2KOQ A;  4UHP B;  4IPY A;  1NJI Q;  2LTE A;  2PY8 A;  2LPK A;  3G4S P;  1E6J P;  2XZ1 C;  2KGD A;  1L0I A;  3CCS P;  2GYK A;  4BPH A;  2OTL P;  5HGN A;  4H2W C;  3U43 A;  2VLP A;  3CE7 A;  1VQK P;  2CNR A;  4MRT C;  2CGQ A;  5KP8 B;  1YJ9 P;  4BPF A;  1GXG A;  1BXI A;  2LIU A;  1Q81 Q;  2L0Q A;  1E0H A;  1M6E X;  3CCM P;  5HVC A;  3DS0 A;  2CG5 B;  2JBG A;  1YJW P;  2JQ4 A;  2FQ2 A;  1W2B O;  1QRJ A;  4IZ6 A;  4DG9 A;  3G21 A;  1Q7Y Q;  3GZM A;  2EFJ A;  2EHT A;  2OTJ P;  2AF8 A;  2P9X A;  1VQ9 P;  2PEK A;  5CZD B;  5I4T G;  2DNW A;  1EMV A;  2MVV A;  3B5I A;  1YHQ P;  2MR7 A;  4M0I A;  2JYG A;  2N6Z A;  1AYI A;  2M8P A;  4U0D A;  3CPW O;  1A43 A;  5HGL A;  5KP7 B;  2PEI A;  2KG9 A;  2K0Y A;  2BUO A;  2Z45 A;  2OAR A;  2N6Y A;  2FAC A;  4NEO A;  1YIJ P;  2KGC A;  2LML A;  1M1K Q;  1ZNV A;  3H47 A;  1RO0 A;  3DS1 A;  4XFX A;  1AF8 A;  3Q20 A;  1ACP A;  2E1M A;  2MY5 A;  4WYM A;  4U0A A;  2ONT A;  3G0V A;  3G26 A;  5F2O A;  4XRQ A;  2CQ8 A;  2L6E A;  4BPG A;  2LKI A;  1K9M Q;  2KOR A;  2JGP A;  4XFY A;  2VLN A;  3MGE A;  4CA3 A;  1KLP A;  1VQ4 P;  1Z6M A;  1HQB A;  5DCK A;  5JPA A;  4GR2 A;  1UNK A;  2KOS A;  3DS4 A;  3E2D A;  4U0E A;  3VRL C;  2Z46 A;  2L9F A;  2AFE A;  3I56 P;  4PH1 A;  1VQN P;  3G28 A;  2K93 A;  3RG6 C;  3CCJ P;  3NTE A;  2N98 A;  2GDY A;  2JAZ A;  2KWL A;  1YJN P;  1X3O A;  3CCQ P;  2FVE A;  3H0D A;  4H2Y C;  2KOP A;  1N8R Q;  2PEQ A;  3DTJ A;  1VKU A;  5HV8 A;  3GKL C;  3P05 A;  1DNY A;  2GZI A;  1UJZ A;  2PEJ A;  2N5I A;  1IMP A;  1VQP P;  2VLQ A;  1NQ4 A;  2MR8 A;  3EJB A;  2JU2 A;  2N5H A;  2KOD A;  2PEO A;  2JB0 A;  3B4Q A;  1KQS O;  2DGY A;  2EHS A;  4U0B A;  1FR2 A;  2L4B A;  1QVG O;  5F2K A;  4COC A;  4COP A;  2GZE A;  1GPJ A;  3G1I A;  1RO2 A;  1MZ8 A;  1GXH A;  2KR5 A;  2K5X A;  3WBH A;  1S72 P;  2MD9 A;  5F2N A;  3HYB A;  2K0X A;  1RNI A;  4PXH B;  3DS3 A;  3LRY A;  3GZL A;  2N50 A;  2FAE A;  1CEI A;  1K30 A;  5HGM A;  3CME P;  4U0C A;  3CC4 P;  2MF4 A;  2QEX P;  2M5R A;  2PEM A;  1D1D A;  4H2X C;  2LL8 A;  1VQM P;  3G29 A;  2JU1 A;  1YIT P;  2EIA A;  2CWO A;  1AUM A;  3GJN A;  3G71 P;  3CD6 P; 
#chains in the Genus database with same CATH homology
 2K93 A;  1OR5 A;  2FHS C;  2N98 A;  2GDY A;  3GZM A;  2KWL A;  2GDW A;  3EJE A;  2EHT A;  2K94 A;  2AF8 A;  1X3O A;  2PNG A;  2FVE A;  2X2B A;  4H2Y C;  2KOP A;  5CZD B;  2LOL A;  2LIW A;  5KP6 B;  2K2Q A;  2MVV A;  2DNW A;  2MR7 A;  1VKU A;  5HV8 A;  2FQ1 A;  1DNY A;  2AFD A;  2N6Z A;  2N5I A;  1F80 D;  5EJD A;  2K92 A;  1L0H A;  1HY8 A;  2KOQ A;  1NQ4 A;  2MR8 A;  5KP7 B;  4HKG A;  2LTE A;  3EJB A;  2KG9 A;  2LPK A;  2JU2 A;  2K0Y A;  2N5H A;  2XZ1 C;  2KGD A;  1L0I A;  1T8K A;  2N6Y A;  2FAC A;  2EHS A;  4BPH A;  4PWV B;  4NEO A;  2FVA A;  2FAD A;  2L4B A;  2KG6 A;  2KGE A;  4H2W C;  1DV5 A;  2ROQ A;  2KOO A;  2KGC A;  2LML A;  3CE7 A;  2CNR A;  4MRT C;  2AVA A;  2CGQ A;  5KP8 B;  1AF8 A;  4R0M A;  4BPF A;  2KR5 A;  3LMO A;  2MD9 A;  1ACP A;  2LIU A;  3EJD A;  2K0X A;  2VSQ A;  4PXH B;  2FVF A;  2MY5 A;  2L0Q A;  3GZL A;  2N50 A;  2FAE A;  2FQ0 A;  4BPG A;  2CQ8 A;  2KGA A;  2LKI A;  2KOR A;  2GDX A;  2JGP A;  2XZ0 D;  5HVC A;  2CG5 B;  2MVU A;  2MF4 A;  4CA3 A;  1KLP A;  2JQ4 A;  2FQ2 A;  2M5R A;  3NY7 B;  1HQB A;  4H2X C;  2LL8 A;  3RG2 A;  2QNW A;  2L22 A;  2KOS A;  2KG8 A;  2JU1 A;  2KW2 A;  4IZ6 A;  4DG9 A;  2L9F A;  2AFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...