1YJWP

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjwP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjwP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjwP02
1N8RQ 3OW2O 1KD1Q 1YJNP 3CMAP 1VQ9P 1VQLP 1VQNP 3CD6P 1K8AQ 1Q7YQ 1YITP 1W2BO 1VQMP 1Q82Q 3CCRP 1K9MQ 1QVGO 1K73Q 3CCMP 3CCLP 3I56P 3CXCO 2OTJP 1NJIQ 3I55P 1YI2P 3CMEP 1Q81Q 3CCQP 1VQ5P 3CCSP 1VQ7P 3CCEP 2QEXP 1VQ4P 1S72P 1Q86Q 1YIJP 1VQPP 1YHQP 1YJWP 3CC2P 1M1KQ 3CPWO 3G71P 3G6EP 2QA4P 1KC8Q 1VQKP 1VQOP 3CCVP 1QVFO 3CCJP 3G4SP 2OTLP 1VQ8P 1JJ2O 3CC7P 3CC4P 3CCUP 1VQ6P 1M90Q 1KQSO 1YJ9P
chains in the Genus database with same CATH superfamily
4H2WC 2VLQA 3RK2C 2JR8A 1JMMA 3BRTB 2EG5A 3L74G 1HBWA 2KIKA 1SQPD 1LTJB 1M56D 4WVZA 5CCHC 1MKMA 4F37A 4U0EA 1YBKA 2FADA 4BWNA 1IMPA 1CSBA 4EI2A 3H1JE 2I1KA 2ZXEB 4RO0A 1KB9I 2PFXA 1FU1A 4EYYQ 1HTLC 1S72P 3Q1MA 2WSEH 5KLVD 2C0WA 4D6TE 4W80A 3WUTA 1KILC 2PEKA 1VF5B 2E75C 1AV1A 3PJSK 1NYHA 3OW2O 2ROQA 3DS4A 1NH4A 2N5HA 3TF5A 2QSIA 2A06D 1JCCA 1NHLA 2DGYA 5AW8B 1M1JB 3A5TA 3CPWO 4L75A 2XU6A 3AE2C 4EDFA 2WSCH 3VOPA 2W83C 2EFJA 3MUDC 2R5BA 5APXA 4IFDK 1KILE 3WU2E 3H1HG 3M0DA 1U57A 4NEOA 1YHQP 1M57D 1KLPA 1EZVE 2KB7P 3H1HE 3H1KJ 2ITAA 2WPSA 3KDPB 1YJ9P 2AXTH 3L72G 3TSIA 2ZXXA 2K37A 4C7NA 1SQBK 1T2KC 2Q3IA 3ABVC 4U0DA 1SFCC 5EFWB 1VKUA 2AEJA 1NU1G 1X79B 2E76B 3M91A 3L37A 2QJKC 2NPSA 3CCSP 5AW6B 3AE6C 3L72E 4H0LD 1OWAA 2IYPA 2PRRA 4XFJA 5BS1A 1F80D 3RK3C 3BRVB 5AW5B 2BQ1E 3S9OA 3BASA 4O9BA 3D6YA 3AE4C 5BVZA 3AE5C 1BCCD 5KKZC 1NTMJ 1KQLA 2JDIH 1AQ5A 3NTNA 5TJHA 1SQBJ 2P7JA 5JPAA 1YJWP 3OAKA 1ZR4A 1SQVJ 4OWFA 1RY3A 2OYIA 2ZYDA 1ZMEC 1EMVA 3G1IA 3BATA 2KGEA 1FC2C 3RK3E 1SQQJ 1NTKE 1Q90D 1UIIA 3NY7B 4GKGA 3O6QA 3G6EP 1CI6A 1ZR2A 2JBGA 5KJ7A 1QL1A 1JNMA 2JP3A 3H25A 1JMBA 3L73G 3PH0A 3V2NA 5AVSB 1EZVI 2GZJA 2Z46A 5KAFE 3E2DA 1Q81Q 5AVRB 2H8PD 3AEBC 2RH0A 2Q6QA 2EHTA 3L73E 4PJ0H 1YTZT 1T2KD 3CWBD 1SFCD 3CC7P 3Q20A 4LGDE 1L0LJ 2SPZA 3FX0A 2XKMA 4MN4C 3RL0D 1Q82Q 1VQMP 2K9YA 3KYQA 1FDMA 2R3CA 5K5GB 2YMKA 3FGAD 4H44D 3G71P 1A43A 4YXDC 2B88A 2CPSA 5DCKA 3TNUB 3M06A 3H1ID 1AF8A 2B89A 2GDYA 2OTJP 2K92A 3LW5J 3V6IA 1BGYJ 2O1KA 4JPZB 2YXQB 2QNWA 3JCUE 2CK3H 1TU3F 3HUSA 3KXDA 4DOJA 4GIFA 2L0QA 3M0AA 1GDTA 1CEIA 1M6EX 3E1RA 3HE5A 1ZP0C 4PD4H 3RGUA 3TNUA 5APYA 2ZYAA 3ITKA 2E75B 2YKQA 1FZFA 3GKLC 2N6YA 2Y0EA 2KOSA 3W67A 2QIWA 4JF7A 1GU4A 2KGDA 1P84E 3GLMA 2XDJA 5M1BA 3C9IA 5AW1B 2E74C 1G1IA 4XA4A 2IZ0A 4CPGA 1FR2A 2AFDA 1L0HA 7CEIA 2QEXP 3H1KE 5CHXA 1FZBA 1VHNA 3HZQA 1NQ4A 4U0AA 1EDLA 5BU8B 1FZGA 3VMXA 1A02F 5TISE 2N98A 4OH8B 1JTHB 3AE8C 2WT7B 2EIAA 2CGQA 3TDKA 2BASA 4U0BA 3IAOA 4YTPC 4KT0J 3CMEP 2IBZG 2M5RA 1IFIA 4TLFA 2GZGA 3CI9A 1SFCB 3TGUG 2IBZE 1KQSO 2XZ0D 2GDWA 2MF4A 1KB9H 2O01N 1FDOA 3TGUE 3KZIH 2IPPA 2ZFCA 1RQVA 1GL2D 4ZKUA 3CXHE 1WT6A 2L6EA 4QMAA 3O8ZA 2CG5B 3CCVP 5APTA 3SFDC 5CBOA 1SFCA 3S1KA 2LKMA 3JSVC 3VMYA 3KPEA 2KS1B 4XROA 1OW6A 4HH2A 3ZDMA 2JO0A 1BDCA 1SQXK 1CZQA 1P84I 3RG2A 3H1JJ 1FZCC 4K35A 4GR6A 3A0BH 3CC2P 2FFDA 3EJDA 2KSJA 4TT3H 1BSHA 5AVXB 5E79H 2E1MA 1OFCX 2GZEA 3G21A 4D6TJ 4HB1A 2Y9ZA 1NTMD 4UB8E 4I6MC 2KS1A 2H88C 1N73C 1BXIA 1SQBD 1KFNA 2KOGA 1DD3A 1SQVD 4B86A 1DEEG 1CW5A 2OTLP 3SFEC 2Z5IA 2WSFJ 1H0TB 4H13D 2ZYGA 2MVVA 5AW2B 3H1LG 2ZVOB 1SQQD 5AVUB 2G8YA 2M8RA 3FWNA 2IYOA 1M8OB 4MRTC 1LT1A 1Q2NA 1NU1K 3II6A 2MKVA 1HUCA 2AEFA 3G1GA 1BE3E 4IFFA 3W68A 4RKUJ 3H1HJ 2LTEA 1J1EC 4Y99C 4N78E 1ZRTE 4U3FG 1QEXA 3P8CD 1PP9E 2PP6A 1L0LD 3L72J 4U3FE 1HJBA 1NGMB 1VQ7P 1KD1Q 1VF5D 1M74A 5EJDA 4HJGH 2KW2A 4U7JA 2E43A 1VQ4P 2FAEA 5B5EH 4BXLA 1ZN5A 2K9JB 3C8VA 3B8EB 4GT1A 3HTKB 3H0DA 1X9VA 1FOSE 2OYHC 1EDKA 1BGYD 4IL6X 4PV1C 1GW3A 2QM7A 2XXMA 1GL2A 2E74B 1KC8Q 1IK9A 3CL3D 1QVFO 2K9JA 2YO3A 1AVOA 3D71A 2QRXA 1S9KD 2Q9IA 3HTKA 2FYUK 1L4AD 5B66E 2K1AA 2I8DA 3H32B 1RF1A 3NFQA 2K93A 1RE3A 2HODB 4K3AA 5GTHE 1NKNA 3VTPC 5F2KA 3RBXA 3L73J 1N8RQ 5HGMA 1PPJG 2FHSC 1LTIC 1E5WA 1OVRA 1GD2E 3VMAA 1PPJE 2V7QH 1RF0C 1N7SC 2HODA 1PZQA 3HRNA 3CLQA 3L74E 2ERHA 2J5UA 1YQ3C 1IMQA 2JJLA 3AE7C 1LTBC 3K5BA 1NAFA 1A8OA 3MIWA 5AW0B 1PEOA 5KP6B 2ZAEB 3VRLC 4CA3A 2MR8A 1RO2A 3CCQP 1VQ5P 5BU5A 3QH9A 5I4TG 1LTJA 1YYCA 2L91A 2A45I 2Z4EA 4IL6H 3BCCG 1K05A 1FZCB 3B5ND 1SQXG 2RKLA 2Z5HA 2Z45A 3BCCE 2H89C 1NVOA 4ZMDA 1Y9BA 1SQXE 4JYCA 1DEBA 1J1DC 1N7LA 1J2JB 4OGQC 3G9RA 4IOIH 1N73B 2LKIA 1XTGB 2P1JA 5AW4B 2KOOA 2MVUA 2NO8A 1HWTC 1NOHA 1GK6A 2N1TD 3WBHA 1NAYA 3A0HE 2VLOA 3H1JD 1K30A 4I7ZC 1KYOE 1M7LA 1NWQA 3B5IA 1S5LE 4NPFX 3RK2D 2KUBA 3RBZA 1M1JA 2BEZF 2K0YA 1AQTA 4D6TD 1D7MA 1N73A 1LTTC 5APQA 2FBWC 1L4AB 5AW3B 3DS5A 3DS1A 1OW8A 1QL2A 5CCHD 4RJTA 2UWJE 3G28A 2XV5A 1GXGA 1U7MA 3U1AA 1H8AA 1J1EB 1PV3A 4Y99B 1NU1E 1JCDA 1KORA 1U7JA 4R4MA 1IZNB 3OA7A 3AE3C 1HVVA 2ZJSE 3GHGC 2WTYA 1L4AA 1NO4A 1RE4C 4WB4A 1A02J 2LIUA 1LTSC 1KILD 2KK7A 2E75D 3RL0g 1M1KQ 2JYLA 1IFMA 2FYNB 3TGUJ 5CCGC 2E42A 1JJ2O 1EZVD 2P9XA 3H1HD 2GYKA 2BCCG 2BHVA 2LOLA 1DNYA 2JEEA 1KQGB 3CWBG 1ZXGA 3CX5E 2L5GB 3L71G 1R8EA 2BCCE 5KAIH 3L72D 2LPKA 3UIAA 3L71E 2EHSA 3G4SP 3F89A 1ZOYC 1NTZK 3B5NB 1H89A 1RO0A 3IN6A 1UNKA 3GG2A 1Y47A 1LT9B 2KWLA 2LL8A 1FBMA 4M3LA 4COCA 3SWFA 2R32A 4IFMA 5AVWB 2FXMA 3TYYA 5HV8A 2CPBA 2ZT9C 3E7KA 2KODA 2FYUG 4W7YA 4EIJA 2QJPC 3PRJA 2N1TB 2FVFA 3B5NA 1FAVA 1L0NK 2VLPA 1LT9A 2FYUE 2IFNA 3SSUA 3RK3D 2Z44A 1RNIA 1NTKD 3RK2B 3EFGA 2AVAA 2YKPA 2Y0DA 1R5SA 1G2CB 1GMJA 2CQ8A 5KTBA 2XV6A 4BPFA 1YJNP 2N1TA 1JY3P 4WBAA 1E0HA 1BE3J 2FQ0A 2VLNA 2M8NA 2FVEA 2AXCA 5CZDB 4UB6H 1KMIZ 3L73D 3P7KA 4GOEA 2R44A 2KG8A 4ZKPA 1K04A 1PP9J 2VRSA 1G2CA 3L70G 3GZMA 2R5DA 4U3FJ 5CCHA 1FZEA 5AVQB 5HVCA 1KILB 4I1LA 3WMM0 1EDJA 1SP4A 5C39A 2HPCB 2KI7B 3L70E 1EQ7A 2AXTE 3G0VA 2M8LA 1SQPK 3GJNA 3HD7C 3EJBA 2ZT9D 1JY3O 3LW5H 3IF4A 1KILA 2GA1A 3B4SA 4BRYB 1KFMA 1PEMA 3PLNA 4DCKA 4EOTA 4WY4C 1URQC 1HQBA 1JOCA 2KZIA 4I7ZB 1VPCA 4L74A 2PENA 3L75G 2IX7C 5KLVK 1BAJA 2FXOA 3L75E 1IUQA 2PEJA 4BRYA 1JY2P 3EQ2A 3MUDA 1VQOP 1LNQA 3VP8A 3Q3DA 4WYMA 1YTZI 1T3UA 2M3EA 2QJKB 4OVNF 3LRYA 1GPJA 1P84D 1HY8A 3CCRP 1JTHA 2WT7A 2N6ZA 3RK3B 5KLIC 2GDXA 4QKOA 2O01J 3S4RA 1NTMG 2JYGA 2J58A 3GHGB 2KNCB 3H1KD 1KTMA 2MY5A 1SQVG 5KKZB 1JB0J 2GUSA 3AE1C 3L74J 1YITP 2PEMA 2LF4A 2QM8A 4PJ0E 2JQ4A 3VN0A 3AEDC 1SQQG 2I1JA 4HKGA 5GTIH 2AFEA 1HH0A 1FE6A 1X3OA 3HD7D 2E74D 2OARA 4BPGA 1JY2O 5GTHH 5HGLA 2IBZD 1VQ9P 2IDBA 1URQD 2K2QA 3TGUD 3L4FA 1OIPA 1HGVA 1NTZG 3M0DC 3BCCJ 1T3JA 3P8MC 3CXHD 1HJ0A 1SQXJ 2JO1A 4XFYA 3LIEA 1NTZE 3A7OA 1KN7A 2ZT9B 3MGNA 4LLHA 2D2CC 4XFZA 2QJPB 2HG5D 4U0CA 2IBZI 3C1LA 2JAZA 3H1LE 1JY3N 2CNRA 4PD4E 1PEUA 5DJTB 1L0NG 2DW3A 2NPSC 3MZWB 3H6PA 2JWAA 2PEIA 1VQLP 3AEGC 1H0TA 3AEFC 2YKOA 2K88A 3CXHI 1L0NE 3DS3A 1QVGO 1SLQA 1Y8AA 4JBZA 4WWIA 5KP7B 3MGEA 2E76C 2WSFH 3A2AA 3QWOC 4AUWA 3M1MA 1NU1J 4R4LA 1X0TA 2ZVNB 2WMMA 2R3SA 2OYIC 2YNYA 1DV5A 1L2PA 1SVFA 3HYBA 2LXBA 1ZW0A 3WU2H 2NRGA 3P05A 2L22A 2H7HA 4DT0A 1BDDA 2HYNA 1AJYA 1OXZA 1RQUA 2BEQD 1BE3D 2M3BA 2N50A 5KJ7C 1UJZA 2HLOA 2H43A 1IFJA 2Y9YA 3AECC 4H2YC 4U0FA 4N78D 4I2LC 1ZRTD 5BS2A 2GZFA 1VQPP 5HGOA 2P2UA 1MZ8A 5F2OA 3HD7B 1KB9E 2P67A 2BCCJ 1SQPG 2KLVA 1PP9D 1PGJA 2D2CD 3CWBJ 5HGNA 3GMAA 2LR2A 3KHUA 4U3FD 2KOPA 2O1JA 3L71J 1BSNA 3KZIE 1JY2N 1URQB 1OR5A 1SQPE 2FVAA 2XZ1C 2Q7CA 5CBNA 3GF7A 1JO5A 1E79H 2M8PA 5CJ0A 2P58A 3DS0A 4NPEA 1R5LA 2W27A 3CCUP 1FJPA 5KLVG 3DTJA 1Z6MA 2FQ2A 4JYBA 4IPYA 4PXHB 1URQA 3A0BE 1AA0A 4RESB 5KLVE 3H32A 2FYUJ 3N7NA 2WSEJ 2OYOA 2A06G 1VQKP 5E79E 1QRJA 2JU1A 5H2FE 2KP8A 2QJYC 3HUSC 4AQRD 2WZ7A 2A06E 2CWOA 5KP8B 1USDA 1OW7A 3VMZA 1S2EA 5AW9B 4PH0A 5EW5E 3TK1A 3CCEP 2WVRA 3H1JG 1PGPA 5KAFH 2HFED 2QA4P 2XZRA 5KJ7D 5CMZA 2KZJA 3R4YA 2WSCJ 1KQFB 4H0LC 1RH5B 4PV1D 2QVAA 2HR3A 1FJKA 2W90A 2M0BA 2FQ1A 4D6TG 4DZOA 1LTGC 1MV8A 3SWKA 3Q2YA 2OTKE 1PPJD 3M9HA 2KORA 1T8KA 4N3YB 1QGKB 1X8YA 3GW6A 2E5TA 2RMZA 2XNXA 3FWLA 2GUVA 3L74D 2IZ1A 3L70J 1M90Q 2FACA 1QX8A 2FXPA 2DNWA 3RG6C 1FZCA 3CXCO 4KJMA 4ASVA 2XNDH 1JEKA 2WWWA 4N6JA 3N4XA 1BCCG 1USEA 2AEMA 3PTZA 2D2CB 3JCUH 3VYIA 4C7NB 2OQQA 1PGQA 1BCCE 1N7SD 1EZVG 5B5EE 2NPSB 4GR2A 1W2EA 2LMLA 1NJIQ 2PEOA 1EXJA 3U1CA 3BCCD 1SQXD 3L75J 4YPCA 3FXEA 3SWYA 2MD9A 3V2PA 1NTMK 1LGHB 2G3AA 2JU2A 1M6NA 2NZ2A 2FKWB 1P84H 1SQVK 4NPDA 1AFOA 2LXCB 2WPTA 4H2XC 1T6AA 3LIDA 2PEQA 1KYOD 3R2PA 2BUOA 3RL0C 3IFMA 3B4QA 4R0MA 1IJDB 3AE9C 5AVYB 1SQQK 2OYIB 4JQ0D 2M5AB 1EIAA 2KGCA 4H44C 2YXRB 2FFDC 4PWVB 2JKVA 2GZIA 2LIWA 1GTWA 4OGQD 5TISH 2QE7H 3NXSA 3O6QB 1CI6B 3CWBE 4DJGA 4DG9A 3NMDA 2OYHB 4IZ6A 3GF3A 2Y0CA 1KV4A 1NTKG 3LMOA 4PV1B 1NU1D 1KYOI 2M5AA 1EC5A 2K5XA 2AF8A 1HF9A 1PFIA 3H1IG 1L0LK 4GDOA 1MUUA 1IFNA 1LP1B 1OX3A 4QNBA 3CCJP 2OYHA 3CXHH 2PNGA 3H1IE 5L8RJ 3OJAB 3Q5SA 1XTCC 3G29A 3CX5D 1ZMBA 1VL2A 1NTZJ 3DPHA 4L76A 4ZNCA 2FY8A 2JB0A 1N2DC 2BCCD 4IL6E 2KXPB 2PY8A 2C9LY 2C9NY 2Q5UA 3GZLA 1LP1A 2IFMA 3H1LJ 3L71D 3EJEA 3Q5PA 1PEQA 3CMAP 1VQNP 1N7SB 2KOQA 1K9MQ 1LWUC 2QJYB 1EDIA 3HUSB 2N5IA 5CCGD 2QG4A 4UB8H 1L0NJ 2YMYA 4YXWH 3HE5B 3CX5I 2YO2A 3WUVA 1AUMA 1GXHA 1RF0A 1N7SA 1UIXA 2W8ZA 1K73Q 5AVZB 2FYUD 2W6JH 2KLUA 4PH1A 4H0LB 4L73A 5F2NA 1DD4A 1FDIA 1GL2C 1GK4A 1J1DB 4OGQB 2K0DX 3MD0A 1ZLLA 3I55P 5AVTB 3V5BA 2GM4A 1MFTA 2HPCA 1RF1C 1AYIA 3P32A 1RE3C 2YIUC 2PGDA 3H1KG 2KYVA 1S1CX 1MFZA 3HE4B 1SQPJ 1OVUA 2K94A 1GW4A 3L70D 3VP9A 5CJ4A 1E6JP 2VSQA 2J59M 3H47A 3L36A 3PP5A 2PAJA 1H88A 3FXDA 5APSA 4XFXA 4A7PA 4Y28J 2K0XA 4H13C 5KAIE 3IR9A 3HE4A 3L35A 3USSA 1SS1A 2A45H 1MZ9A 1Z56A 1ZNVA 2V4HA 5AW7B 1SQBG 2Q1KA 1LJ2A 5KLVJ 3DS2A 2W6BA 1X22A 1AVYA 3RL0B 1LTJC 1NTME 3CD6P 2WSSH 1SQBE 1L0IA 1LTAC 1SQVE 3U59A 2N9BA 2C0XA 4H44B 2FFDB 3L75D 1FZAA 2WITA 5B66H 3GHGA 3MP7B 2KNCA 1RE4A 3NTEA 1S3JA 1SQQE 4UHPB 1K8AQ 2ONTA 2B9BA 3I5CA 2N9YB 2E5YA 3CCMP 4WY4D 2W6AA 3V2QA 1S5LX 2XT1A 1YI2P 2O01H 1VF5C 5CCGA 3EWKA 3U43A 2WPVB 4M0IA 1DX7A 1IFPA 3PHLA 3CC4P 2X2BA 1PIXA 1VQ6P 2FYZA 4XRQA 5H2FH 1M1JC 1W2BO 1L0LG 1OMIA 2O3JA 3KQGA 4UB6E 3CE7A 3P8CE 2JWDA 1YIJP 5DJUB 1L0LE 4GODA 2KGAA 3V4WA 3E1IA 1KZUB 4W7ZA 1NKZB 4C7RA 3H4EA 4Z1MH 2WPQA 4AYCA 1PL5A 1PGOA 1G1JA 3AEAC 1BE3G 2K3RA 1BCCJ 1L4AC 3M9BA 3Q5RA 1RHZB 1BGYG 1GZLA 1LWUB 4ASWA 2WPRA 3F5HA 1DIPA 2POHA 3WUUA 2KG9A 1T8ZA 1DH3A 3D6ZA 1BGYE 5APWA 1PP9G 1NTZD 2Q3EA 3JC22 2L9FA 3CCLP 4HYTB 3I56P 4HKZH 4LC1A 2MJZA 3A0HH 1HGZA 1OZHA 3H1LD 1KYOH 1JM0A 1S9KE 3MTUE 1LWUA 1IFDA 4PD4D 1JUNA 1WMKA 1S5LH 3G3ZA 2FYNC 1FOSF 2KG6A 1NTKK 4KHXA 1L0ND 2B87B 3BVHA 1GL2B 4C46A 1IC2A 1WRGA 4GOFA 1Q86Q 3T97B 2WQYC 2A45G 3V4QA 1S4XA 4BPHA 1IO4A 4XE5B 1IK7A 1EXIA 1FS0E 1QLED 2P10A 2MR7A 3B71A 1Q7YQ 4WY4B 1RF1B 4PD4I 2YIUB 5APUA 3B5NC 2NPSD 5APVA 2B87A 1N86A 2V7QJ 1LT9C 3EFFK 3M9QA 1NTKJ 1OVVA 2KSEA 3T97A 1GU5A 2RN0A 3HD7A 4COPA 1VDFA 3MHVA 1W5CE 3D70A 3A3YB 1YQ4C 4WY4A 3H1IJ 5GTIE 1D1DA 3V2RA 2E76D 2KR5A 2N1TC 3CX5H 1ZV8A 2OGUA 1ACPA 3AEEC 5AVVB 2JGPA 3G26A 4H13B 1VQ8P 1KB9D 2L4BA 5KLIB 1EOQA
chains in the Genus database with same CATH topology
1EIAA 1RO0A 5HGLA 1VQ9P 3CD6P 1AUMA 2EIAA 1Q82Q 1VQMP 2EG5A 4COCA 4U0DA 3WBHA 1K73Q 4U0BA 3CCLP 3I56P 1K30A 3CMEP 4PH1A 4U0FA 3CCSP 1PEMA 5BS2A 1VQPP 5HGOA 3B5IA 5F2OA 3G71P 5F2NA 1A43A 5BS1A 2KODA 5F2KA 4U0EA 3G1GA 2PENA 4XFYA 1M90Q 2M8LA 3NTEA 5HGNA 1KQSO 5DCKA 1N8RQ 5HGMA 2BQ1E 3DS5A 1K8AQ 2ONTA 3DS1A 3RG6C 3CCMP 3CXCO 1BAJA 2OTJP 3G28A 4XFZA 2XT1A 3I55P 1YI2P 1IUQA 4U0CA 2Z44A 1RNIA 1S72P 2PEJA 1Q86Q 2M8PA 5JPAA 1YJWP 2L6EA 4M0IA 1VQOP 3CCVP 3DS0A 4QNBA 1PEUA 3CCJP 1M6EX 4WYMA 3CC4P 2PEKA 3CCUP 1VQ6P 2PEIA 1VQ7P 1VQLP 4XRQA 3DTJA 3LRYA 2XV6A 3OW2O 1KD1Q 1YJNP 1M74A 3DS4A 3G1IA 1Q7YQ 1A8OA 1W2BO 4XROA 3CCRP 3DS3A 4IPYA 1QVGO 4GR2A 3G29A 1PEOA 2JO0A 1ZMBA 3VRLC 1NJIQ 3DPHA 2M8NA 2PEOA 1RO2A 3CCQP 1VQ5P 1VQ4P 2JYGA 1YIJP 2DGYA 4GR6A 3CC2P 1M1KQ 2JYLA 3CPWO 5I4TG 3G6EP 1VQKP 2PY8A 1QRJA 3MGEA 1E6JP 3M1MA 1JJ2O 3H47A 2P9XA 4COPA 1M6NA 2BHVA 1PEQA 3H4EA 2E1MA 2EFJA 3H0DA 3CMAP 3G21A 1VQNP 4XFXA 2CWOA 1YITP 2PEMA 1K9MQ 2LF4A 2Z46A 2Z45A 1D1DA 3E2DA 4PH0A 3HYBA 1Q81Q 2XXMA 3CCEP 2QEXP 2PEQA 2BUOA 1YHQP 3P05A 2QA4P 1KC8Q 3G26A 3HZQA 1QVFO 4U0AA 2OARA 3G4SP 1VQ8P 2OTLP 3CC7P 3DS2A 3G0VA 3Q20A 1YJ9P 1EOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R Q;  3OW2 O;  1KD1 Q;  1YJN P;  3CMA P;  1VQ9 P;  1VQL P;  1VQN P;  3CD6 P;  1K8A Q;  1Q7Y Q;  1YIT P;  1W2B O;  1VQM P;  1Q82 Q;  3CCR P;  1K9M Q;  1QVG O;  1K73 Q;  3CCM P;  3CCL P;  3I56 P;  3CXC O;  2OTJ P;  1NJI Q;  3I55 P;  1YI2 P;  3CME P;  1Q81 Q;  3CCQ P;  1VQ5 P;  3CCS P;  1VQ7 P;  3CCE P;  2QEX P;  1VQ4 P;  1S72 P;  1Q86 Q;  1YIJ P;  1VQP P;  1YHQ P;  1YJW P;  3CC2 P;  1M1K Q;  3CPW O;  3G71 P;  3G6E P;  2QA4 P;  1KC8 Q;  1VQK P;  1VQO P;  3CCV P;  1QVF O;  3CCJ P;  3G4S P;  2OTL P;  1VQ8 P;  1JJ2 O;  3CC7 P;  3CC4 P;  3CCU P;  1VQ6 P;  1M90 Q;  1KQS O;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 4H2W C;  2VLQ A;  3RK2 C;  2JR8 A;  1JMM A;  3BRT B;  2EG5 A;  3L74 G;  1HBW A;  2KIK A;  1SQP D;  1LTJ B;  1M56 D;  4WVZ A;  5CCH C;  1MKM A;  4F37 A;  4U0E A;  1YBK A;  2FAD A;  4BWN A;  1IMP A;  1CSB A;  4EI2 A;  3H1J E;  2I1K A;  2ZXE B;  4RO0 A;  1KB9 I;  2PFX A;  1FU1 A;  4EYY Q;  1HTL C;  1S72 P;  3Q1M A;  2WSE H;  5KLV D;  2C0W A;  4D6T E;  4W80 A;  3WUT A;  1KIL C;  2PEK A;  1VF5 B;  2E75 C;  1AV1 A;  3PJS K;  1NYH A;  3OW2 O;  2ROQ A;  3DS4 A;  1NH4 A;  2N5H A;  3TF5 A;  2QSI A;  2A06 D;  1JCC A;  1NHL A;  2DGY A;  5AW8 B;  1M1J B;  3A5T A;  3CPW O;  4L75 A;  2XU6 A;  3AE2 C;  4EDF A;  2WSC H;  3VOP A;  2W83 C;  2EFJ A;  3MUD C;  2R5B A;  5APX A;  4IFD K;  1KIL E;  3WU2 E;  3H1H G;  3M0D A;  1U57 A;  4NEO A;  1YHQ P;  1M57 D;  1KLP A;  1EZV E;  2KB7 P;  3H1H E;  3H1K J;  2ITA A;  2WPS A;  3KDP B;  1YJ9 P;  2AXT H;  3L72 G;  3TSI A;  2ZXX A;  2K37 A;  4C7N A;  1SQB K;  1T2K C;  2Q3I A;  3ABV C;  4U0D A;  1SFC C;  5EFW B;  1VKU A;  2AEJ A;  1NU1 G;  1X79 B;  2E76 B;  3M91 A;  3L37 A;  2QJK C;  2NPS A;  3CCS P;  5AW6 B;  3AE6 C;  3L72 E;  4H0L D;  1OWA A;  2IYP A;  2PRR A;  4XFJ A;  5BS1 A;  1F80 D;  3RK3 C;  3BRV B;  5AW5 B;  2BQ1 E;  3S9O A;  3BAS A;  4O9B A;  3D6Y A;  3AE4 C;  5BVZ A;  3AE5 C;  1BCC D;  5KKZ C;  1NTM J;  1KQL A;  2JDI H;  1AQ5 A;  3NTN A;  5TJH A;  1SQB J;  2P7J A;  5JPA A;  1YJW P;  3OAK A;  1ZR4 A;  1SQV J;  4OWF A;  1RY3 A;  2OYI A;  2ZYD A;  1ZME C;  1EMV A;  3G1I A;  3BAT A;  2KGE A;  1FC2 C;  3RK3 E;  1SQQ J;  1NTK E;  1Q90 D;  1UII A;  3NY7 B;  4GKG A;  3O6Q A;  3G6E P;  1CI6 A;  1ZR2 A;  2JBG A;  5KJ7 A;  1QL1 A;  1JNM A;  2JP3 A;  3H25 A;  1JMB A;  3L73 G;  3PH0 A;  3V2N A;  5AVS B;  1EZV I;  2GZJ A;  2Z46 A;  5KAF E;  3E2D A;  1Q81 Q;  5AVR B;  2H8P D;  3AEB C;  2RH0 A;  2Q6Q A;  2EHT A;  3L73 E;  4PJ0 H;  1YTZ T;  1T2K D;  3CWB D;  1SFC D;  3CC7 P;  3Q20 A;  4LGD E;  1L0L J;  2SPZ A;  3FX0 A;  2XKM A;  4MN4 C;  3RL0 D;  1Q82 Q;  1VQM P;  2K9Y A;  3KYQ A;  1FDM A;  2R3C A;  5K5G B;  2YMK A;  3FGA D;  4H44 D;  3G71 P;  1A43 A;  4YXD C;  2B88 A;  2CPS A;  5DCK A;  3TNU B;  3M06 A;  3H1I D;  1AF8 A;  2B89 A;  2GDY A;  2OTJ P;  2K92 A;  3LW5 J;  3V6I A;  1BGY J;  2O1K A;  4JPZ B;  2YXQ B;  2QNW A;  3JCU E;  2CK3 H;  1TU3 F;  3HUS A;  3KXD A;  4DOJ A;  4GIF A;  2L0Q A;  3M0A A;  1GDT A;  1CEI A;  1M6E X;  3E1R A;  3HE5 A;  1ZP0 C;  4PD4 H;  3RGU A;  3TNU A;  5APY A;  2ZYA A;  3ITK A;  2E75 B;  2YKQ A;  1FZF A;  3GKL C;  2N6Y A;  2Y0E A;  2KOS A;  3W67 A;  2QIW A;  4JF7 A;  1GU4 A;  2KGD A;  1P84 E;  3GLM A;  2XDJ A;  5M1B A;  3C9I A;  5AW1 B;  2E74 C;  1G1I A;  4XA4 A;  2IZ0 A;  4CPG A;  1FR2 A;  2AFD A;  1L0H A;  7CEI A;  2QEX P;  3H1K E;  5CHX A;  1FZB A;  1VHN A;  3HZQ A;  1NQ4 A;  4U0A A;  1EDL A;  5BU8 B;  1FZG A;  3VMX A;  1A02 F;  5TIS E;  2N98 A;  4OH8 B;  1JTH B;  3AE8 C;  2WT7 B;  2EIA A;  2CGQ A;  3TDK A;  2BAS A;  4U0B A;  3IAO A;  4YTP C;  4KT0 J;  3CME P;  2IBZ G;  2M5R A;  1IFI A;  4TLF A;  2GZG A;  3CI9 A;  1SFC B;  3TGU G;  2IBZ E;  1KQS O;  2XZ0 D;  2GDW A;  2MF4 A;  1KB9 H;  2O01 N;  1FDO A;  3TGU E;  3KZI H;  2IPP A;  2ZFC A;  1RQV A;  1GL2 D;  4ZKU A;  3CXH E;  1WT6 A;  2L6E A;  4QMA A;  3O8Z A;  2CG5 B;  3CCV P;  5APT A;  3SFD C;  5CBO A;  1SFC A;  3S1K A;  2LKM A;  3JSV C;  3VMY A;  3KPE A;  2KS1 B;  4XRO A;  1OW6 A;  4HH2 A;  3ZDM A;  2JO0 A;  1BDC A;  1SQX K;  1CZQ A;  1P84 I;  3RG2 A;  3H1J J;  1FZC C;  4K35 A;  4GR6 A;  3A0B H;  3CC2 P;  2FFD A;  3EJD A;  2KSJ A;  4TT3 H;  1BSH A;  5AVX B;  5E79 H;  2E1M A;  1OFC X;  2GZE A;  3G21 A;  4D6T J;  4HB1 A;  2Y9Z A;  1NTM D;  4UB8 E;  4I6M C;  2KS1 A;  2H88 C;  1N73 C;  1BXI A;  1SQB D;  1KFN A;  2KOG A;  1DD3 A;  1SQV D;  4B86 A;  1DEE G;  1CW5 A;  2OTL P;  3SFE C;  2Z5I A;  2WSF J;  1H0T B;  4H13 D;  2ZYG A;  2MVV A;  5AW2 B;  3H1L G;  2ZVO B;  1SQQ D;  5AVU B;  2G8Y A;  2M8R A;  3FWN A;  2IYO A;  1M8O B;  4MRT C;  1LT1 A;  1Q2N A;  1NU1 K;  3II6 A;  2MKV A;  1HUC A;  2AEF A;  3G1G A;  1BE3 E;  4IFF A;  3W68 A;  4RKU J;  3H1H J;  2LTE A;  1J1E C;  4Y99 C;  4N78 E;  1ZRT E;  4U3F G;  1QEX A;  3P8C D;  1PP9 E;  2PP6 A;  1L0L D;  3L72 J;  4U3F E;  1HJB A;  1NGM B;  1VQ7 P;  1KD1 Q;  1VF5 D;  1M74 A;  5EJD A;  4HJG H;  2KW2 A;  4U7J A;  2E43 A;  1VQ4 P;  2FAE A;  5B5E H;  4BXL A;  1ZN5 A;  2K9J B;  3C8V A;  3B8E B;  4GT1 A;  3HTK B;  3H0D A;  1X9V A;  1FOS E;  2OYH C;  1EDK A;  1BGY D;  4IL6 X;  4PV1 C;  1GW3 A;  2QM7 A;  2XXM A;  1GL2 A;  2E74 B;  1KC8 Q;  1IK9 A;  3CL3 D;  1QVF O;  2K9J A;  2YO3 A;  1AVO A;  3D71 A;  2QRX A;  1S9K D;  2Q9I A;  3HTK A;  2FYU K;  1L4A D;  5B66 E;  2K1A A;  2I8D A;  3H32 B;  1RF1 A;  3NFQ A;  2K93 A;  1RE3 A;  2HOD B;  4K3A A;  5GTH E;  1NKN A;  3VTP C;  5F2K A;  3RBX A;  3L73 J;  1N8R Q;  5HGM A;  1PPJ G;  2FHS C;  1LTI C;  1E5W A;  1OVR A;  1GD2 E;  3VMA A;  1PPJ E;  2V7Q H;  1RF0 C;  1N7S C;  2HOD A;  1PZQ A;  3HRN A;  3CLQ A;  3L74 E;  2ERH A;  2J5U A;  1YQ3 C;  1IMQ A;  2JJL A;  3AE7 C;  1LTB C;  3K5B A;  1NAF A;  1A8O A;  3MIW A;  5AW0 B;  1PEO A;  5KP6 B;  2ZAE B;  3VRL C;  4CA3 A;  2MR8 A;  1RO2 A;  3CCQ P;  1VQ5 P;  5BU5 A;  3QH9 A;  5I4T G;  1LTJ A;  1YYC A;  2L91 A;  2A45 I;  2Z4E A;  4IL6 H;  3BCC G;  1K05 A;  1FZC B;  3B5N D;  1SQX G;  2RKL A;  2Z5H A;  2Z45 A;  3BCC E;  2H89 C;  1NVO A;  4ZMD A;  1Y9B A;  1SQX E;  4JYC A;  1DEB A;  1J1D C;  1N7L A;  1J2J B;  4OGQ C;  3G9R A;  4IOI H;  1N73 B;  2LKI A;  1XTG B;  2P1J A;  5AW4 B;  2KOO A;  2MVU A;  2NO8 A;  1HWT C;  1NOH A;  1GK6 A;  2N1T D;  3WBH A;  1NAY A;  3A0H E;  2VLO A;  3H1J D;  1K30 A;  4I7Z C;  1KYO E;  1M7L A;  1NWQ A;  3B5I A;  1S5L E;  4NPF X;  3RK2 D;  2KUB A;  3RBZ A;  1M1J A;  2BEZ F;  2K0Y A;  1AQT A;  4D6T D;  1D7M A;  1N73 A;  1LTT C;  5APQ A;  2FBW C;  1L4A B;  5AW3 B;  3DS5 A;  3DS1 A;  1OW8 A;  1QL2 A;  5CCH D;  4RJT A;  2UWJ E;  3G28 A;  2XV5 A;  1GXG A;  1U7M A;  3U1A A;  1H8A A;  1J1E B;  1PV3 A;  4Y99 B;  1NU1 E;  1JCD A;  1KOR A;  1U7J A;  4R4M A;  1IZN B;  3OA7 A;  3AE3 C;  1HVV A;  2ZJS E;  3GHG C;  2WTY A;  1L4A A;  1NO4 A;  1RE4 C;  4WB4 A;  1A02 J;  2LIU A;  1LTS C;  1KIL D;  2KK7 A;  2E75 D;  3RL0 g;  1M1K Q;  2JYL A;  1IFM A;  2FYN B;  3TGU J;  5CCG C;  2E42 A;  1JJ2 O;  1EZV D;  2P9X A;  3H1H D;  2GYK A;  2BCC G;  2BHV A;  2LOL A;  1DNY A;  2JEE A;  1KQG B;  3CWB G;  1ZXG A;  3CX5 E;  2L5G B;  3L71 G;  1R8E A;  2BCC E;  5KAI H;  3L72 D;  2LPK A;  3UIA A;  3L71 E;  2EHS A;  3G4S P;  3F89 A;  1ZOY C;  1NTZ K;  3B5N B;  1H89 A;  1RO0 A;  3IN6 A;  1UNK A;  3GG2 A;  1Y47 A;  1LT9 B;  2KWL A;  2LL8 A;  1FBM A;  4M3L A;  4COC A;  3SWF A;  2R32 A;  4IFM A;  5AVW B;  2FXM A;  3TYY A;  5HV8 A;  2CPB A;  2ZT9 C;  3E7K A;  2KOD A;  2FYU G;  4W7Y A;  4EIJ A;  2QJP C;  3PRJ A;  2N1T B;  2FVF A;  3B5N A;  1FAV A;  1L0N K;  2VLP A;  1LT9 A;  2FYU E;  2IFN A;  3SSU A;  3RK3 D;  2Z44 A;  1RNI A;  1NTK D;  3RK2 B;  3EFG A;  2AVA A;  2YKP A;  2Y0D A;  1R5S A;  1G2C B;  1GMJ A;  2CQ8 A;  5KTB A;  2XV6 A;  4BPF A;  1YJN P;  2N1T A;  1JY3 P;  4WBA A;  1E0H A;  1BE3 J;  2FQ0 A;  2VLN A;  2M8N A;  2FVE A;  2AXC A;  5CZD B;  4UB6 H;  1KMI Z;  3L73 D;  3P7K A;  4GOE A;  2R44 A;  2KG8 A;  4ZKP A;  1K04 A;  1PP9 J;  2VRS A;  1G2C A;  3L70 G;  3GZM A;  2R5D A;  4U3F J;  5CCH A;  1FZE A;  5AVQ B;  5HVC A;  1KIL B;  4I1L A;  3WMM 0;  1EDJ A;  1SP4 A;  5C39 A;  2HPC B;  2KI7 B;  3L70 E;  1EQ7 A;  2AXT E;  3G0V A;  2M8L A;  1SQP K;  3GJN A;  3HD7 C;  3EJB A;  2ZT9 D;  1JY3 O;  3LW5 H;  3IF4 A;  1KIL A;  2GA1 A;  3B4S A;  4BRY B;  1KFM A;  1PEM A;  3PLN A;  4DCK A;  4EOT A;  4WY4 C;  1URQ C;  1HQB A;  1JOC A;  2KZI A;  4I7Z B;  1VPC A;  4L74 A;  2PEN A;  3L75 G;  2IX7 C;  5KLV K;  1BAJ A;  2FXO A;  3L75 E;  1IUQ A;  2PEJ A;  4BRY A;  1JY2 P;  3EQ2 A;  3MUD A;  1VQO P;  1LNQ A;  3VP8 A;  3Q3D A;  4WYM A;  1YTZ I;  1T3U A;  2M3E A;  2QJK B;  4OVN F;  3LRY A;  1GPJ A;  1P84 D;  1HY8 A;  3CCR P;  1JTH A;  2WT7 A;  2N6Z A;  3RK3 B;  5KLI C;  2GDX A;  4QKO A;  2O01 J;  3S4R A;  1NTM G;  2JYG A;  2J58 A;  3GHG B;  2KNC B;  3H1K D;  1KTM A;  2MY5 A;  1SQV G;  5KKZ B;  1JB0 J;  2GUS A;  3AE1 C;  3L74 J;  1YIT P;  2PEM A;  2LF4 A;  2QM8 A;  4PJ0 E;  2JQ4 A;  3VN0 A;  3AED C;  1SQQ G;  2I1J A;  4HKG A;  5GTI H;  2AFE A;  1HH0 A;  1FE6 A;  1X3O A;  3HD7 D;  2E74 D;  2OAR A;  4BPG A;  1JY2 O;  5GTH H;  5HGL A;  2IBZ D;  1VQ9 P;  2IDB A;  1URQ D;  2K2Q A;  3TGU D;  3L4F A;  1OIP A;  1HGV A;  1NTZ G;  3M0D C;  3BCC J;  1T3J A;  3P8M C;  3CXH D;  1HJ0 A;  1SQX J;  2JO1 A;  4XFY A;  3LIE A;  1NTZ E;  3A7O A;  1KN7 A;  2ZT9 B;  3MGN A;  4LLH A;  2D2C C;  4XFZ A;  2QJP B;  2HG5 D;  4U0C A;  2IBZ I;  3C1L A;  2JAZ A;  3H1L E;  1JY3 N;  2CNR A;  4PD4 E;  1PEU A;  5DJT B;  1L0N G;  2DW3 A;  2NPS C;  3MZW B;  3H6P A;  2JWA A;  2PEI A;  1VQL P;  3AEG C;  1H0T A;  3AEF C;  2YKO A;  2K88 A;  3CXH I;  1L0N E;  3DS3 A;  1QVG O;  1SLQ A;  1Y8A A;  4JBZ A;  4WWI A;  5KP7 B;  3MGE A;  2E76 C;  2WSF H;  3A2A A;  3QWO C;  4AUW A;  3M1M A;  1NU1 J;  4R4L A;  1X0T A;  2ZVN B;  2WMM A;  2R3S A;  2OYI C;  2YNY A;  1DV5 A;  1L2P A;  1SVF A;  3HYB A;  2LXB A;  1ZW0 A;  3WU2 H;  2NRG A;  3P05 A;  2L22 A;  2H7H A;  4DT0 A;  1BDD A;  2HYN A;  1AJY A;  1OXZ A;  1RQU A;  2BEQ D;  1BE3 D;  2M3B A;  2N50 A;  5KJ7 C;  1UJZ A;  2HLO A;  2H43 A;  1IFJ A;  2Y9Y A;  3AEC C;  4H2Y C;  4U0F A;  4N78 D;  4I2L C;  1ZRT D;  5BS2 A;  2GZF A;  1VQP P;  5HGO A;  2P2U A;  1MZ8 A;  5F2O A;  3HD7 B;  1KB9 E;  2P67 A;  2BCC J;  1SQP G;  2KLV A;  1PP9 D;  1PGJ A;  2D2C D;  3CWB J;  5HGN A;  3GMA A;  2LR2 A;  3KHU A;  4U3F D;  2KOP A;  2O1J A;  3L71 J;  1BSN A;  3KZI E;  1JY2 N;  1URQ B;  1OR5 A;  1SQP E;  2FVA A;  2XZ1 C;  2Q7C A;  5CBN A;  3GF7 A;  1JO5 A;  1E79 H;  2M8P A;  5CJ0 A;  2P58 A;  3DS0 A;  4NPE A;  1R5L A;  2W27 A;  3CCU P;  1FJP A;  5KLV G;  3DTJ A;  1Z6M A;  2FQ2 A;  4JYB A;  4IPY A;  4PXH B;  1URQ A;  3A0B E;  1AA0 A;  4RES B;  5KLV E;  3H32 A;  2FYU J;  3N7N A;  2WSE J;  2OYO A;  2A06 G;  1VQK P;  5E79 E;  1QRJ A;  2JU1 A;  5H2F E;  2KP8 A;  2QJY C;  3HUS C;  4AQR D;  2WZ7 A;  2A06 E;  2CWO A;  5KP8 B;  1USD A;  1OW7 A;  3VMZ A;  1S2E A;  5AW9 B;  4PH0 A;  5EW5 E;  3TK1 A;  3CCE P;  2WVR A;  3H1J G;  1PGP A;  5KAF H;  2HFE D;  2QA4 P;  2XZR A;  5KJ7 D;  5CMZ A;  2KZJ A;  3R4Y A;  2WSC J;  1KQF B;  4H0L C;  1RH5 B;  4PV1 D;  2QVA A;  2HR3 A;  1FJK A;  2W90 A;  2M0B A;  2FQ1 A;  4D6T G;  4DZO A;  1LTG C;  1MV8 A;  3SWK A;  3Q2Y A;  2OTK E;  1PPJ D;  3M9H A;  2KOR A;  1T8K A;  4N3Y B;  1QGK B;  1X8Y A;  3GW6 A;  2E5T A;  2RMZ A;  2XNX A;  3FWL A;  2GUV A;  3L74 D;  2IZ1 A;  3L70 J;  1M90 Q;  2FAC A;  1QX8 A;  2FXP A;  2DNW A;  3RG6 C;  1FZC A;  3CXC O;  4KJM A;  4ASV A;  2XND H;  1JEK A;  2WWW A;  4N6J A;  3N4X A;  1BCC G;  1USE A;  2AEM A;  3PTZ A;  2D2C B;  3JCU H;  3VYI A;  4C7N B;  2OQQ A;  1PGQ A;  1BCC E;  1N7S D;  1EZV G;  5B5E E;  2NPS B;  4GR2 A;  1W2E A;  2LML A;  1NJI Q;  2PEO A;  1EXJ A;  3U1C A;  3BCC D;  1SQX D;  3L75 J;  4YPC A;  3FXE A;  3SWY A;  2MD9 A;  3V2P A;  1NTM K;  1LGH B;  2G3A A;  2JU2 A;  1M6N A;  2NZ2 A;  2FKW B;  1P84 H;  1SQV K;  4NPD A;  1AFO A;  2LXC B;  2WPT A;  4H2X C;  1T6A A;  3LID A;  2PEQ A;  1KYO D;  3R2P A;  2BUO A;  3RL0 C;  3IFM A;  3B4Q A;  4R0M A;  1IJD B;  3AE9 C;  5AVY B;  1SQQ K;  2OYI B;  4JQ0 D;  2M5A B;  1EIA A;  2KGC A;  4H44 C;  2YXR B;  2FFD C;  4PWV B;  2JKV A;  2GZI A;  2LIW A;  1GTW A;  4OGQ D;  5TIS H;  2QE7 H;  3NXS A;  3O6Q B;  1CI6 B;  3CWB E;  4DJG A;  4DG9 A;  3NMD A;  2OYH B;  4IZ6 A;  3GF3 A;  2Y0C A;  1KV4 A;  1NTK G;  3LMO A;  4PV1 B;  1NU1 D;  1KYO I;  2M5A A;  1EC5 A;  2K5X A;  2AF8 A;  1HF9 A;  1PFI A;  3H1I G;  1L0L K;  4GDO A;  1MUU A;  1IFN A;  1LP1 B;  1OX3 A;  4QNB A;  3CCJ P;  2OYH A;  3CXH H;  2PNG A;  3H1I E;  5L8R J;  3OJA B;  3Q5S A;  1XTC C;  3G29 A;  3CX5 D;  1ZMB A;  1VL2 A;  1NTZ J;  3DPH A;  4L76 A;  4ZNC A;  2FY8 A;  2JB0 A;  1N2D C;  2BCC D;  4IL6 E;  2KXP B;  2PY8 A;  2C9L Y;  2C9N Y;  2Q5U A;  3GZL A;  1LP1 A;  2IFM A;  3H1L J;  3L71 D;  3EJE A;  3Q5P A;  1PEQ A;  3CMA P;  1VQN P;  1N7S B;  2KOQ A;  1K9M Q;  1LWU C;  2QJY B;  1EDI A;  3HUS B;  2N5I A;  5CCG D;  2QG4 A;  4UB8 H;  1L0N J;  2YMY A;  4YXW H;  3HE5 B;  3CX5 I;  2YO2 A;  3WUV A;  1AUM A;  1GXH A;  1RF0 A;  1N7S A;  1UIX A;  2W8Z A;  1K73 Q;  5AVZ B;  2FYU D;  2W6J H;  2KLU A;  4PH1 A;  4H0L B;  4L73 A;  5F2N A;  1DD4 A;  1FDI A;  1GL2 C;  1GK4 A;  1J1D B;  4OGQ B;  2K0D X;  3MD0 A;  1ZLL A;  3I55 P;  5AVT B;  3V5B A;  2GM4 A;  1MFT A;  2HPC A;  1RF1 C;  1AYI A;  3P32 A;  1RE3 C;  2YIU C;  2PGD A;  3H1K G;  2KYV A;  1S1C X;  1MFZ A;  3HE4 B;  1SQP J;  1OVU A;  2K94 A;  1GW4 A;  3L70 D;  3VP9 A;  5CJ4 A;  1E6J P;  2VSQ A;  2J59 M;  3H47 A;  3L36 A;  3PP5 A;  2PAJ A;  1H88 A;  3FXD A;  5APS A;  4XFX A;  4A7P A;  4Y28 J;  2K0X A;  4H13 C;  5KAI E;  3IR9 A;  3HE4 A;  3L35 A;  3USS A;  1SS1 A;  2A45 H;  1MZ9 A;  1Z56 A;  1ZNV A;  2V4H A;  5AW7 B;  1SQB G;  2Q1K A;  1LJ2 A;  5KLV J;  3DS2 A;  2W6B A;  1X22 A;  1AVY A;  3RL0 B;  1LTJ C;  1NTM E;  3CD6 P;  2WSS H;  1SQB E;  1L0I A;  1LTA C;  1SQV E;  3U59 A;  2N9B A;  2C0X A;  4H44 B;  2FFD B;  3L75 D;  1FZA A;  2WIT A;  5B66 H;  3GHG A;  3MP7 B;  2KNC A;  1RE4 A;  3NTE A;  1S3J A;  1SQQ E;  4UHP B;  1K8A Q;  2ONT A;  2B9B A;  3I5C A;  2N9Y B;  2E5Y A;  3CCM P;  4WY4 D;  2W6A A;  3V2Q A;  1S5L X;  2XT1 A;  1YI2 P;  2O01 H;  1VF5 C;  5CCG A;  3EWK A;  3U43 A;  2WPV B;  4M0I A;  1DX7 A;  1IFP A;  3PHL A;  3CC4 P;  2X2B A;  1PIX A;  1VQ6 P;  2FYZ A;  4XRQ A;  5H2F H;  1M1J C;  1W2B O;  1L0L G;  1OMI A;  2O3J A;  3KQG A;  4UB6 E;  3CE7 A;  3P8C E;  2JWD A;  1YIJ P;  5DJU B;  1L0L E;  4GOD A;  2KGA A;  3V4W A;  3E1I A;  1KZU B;  4W7Z A;  1NKZ B;  4C7R A;  3H4E A;  4Z1M H;  2WPQ A;  4AYC A;  1PL5 A;  1PGO A;  1G1J A;  3AEA C;  1BE3 G;  2K3R A;  1BCC J;  1L4A C;  3M9B A;  3Q5R A;  1RHZ B;  1BGY G;  1GZL A;  1LWU B;  4ASW A;  2WPR A;  3F5H A;  1DIP A;  2POH A;  3WUU A;  2KG9 A;  1T8Z A;  1DH3 A;  3D6Z A;  1BGY E;  5APW A;  1PP9 G;  1NTZ D;  2Q3E A;  3JC2 2;  2L9F A;  3CCL P;  4HYT B;  3I56 P;  4HKZ H;  4LC1 A;  2MJZ A;  3A0H H;  1HGZ A;  1OZH A;  3H1L D;  1KYO H;  1JM0 A;  1S9K E;  3MTU E;  1LWU A;  1IFD A;  4PD4 D;  1JUN A;  1WMK A;  1S5L H;  3G3Z A;  2FYN C;  1FOS F;  2KG6 A;  1NTK K;  4KHX A;  1L0N D;  2B87 B;  3BVH A;  1GL2 B;  4C46 A;  1IC2 A;  1WRG A;  4GOF A;  1Q86 Q;  3T97 B;  2WQY C;  2A45 G;  3V4Q A;  1S4X A;  4BPH A;  1IO4 A;  4XE5 B;  1IK7 A;  1EXI A;  1FS0 E;  1QLE D;  2P10 A;  2MR7 A;  3B71 A;  1Q7Y Q;  4WY4 B;  1RF1 B;  4PD4 I;  2YIU B;  5APU A;  3B5N C;  2NPS D;  5APV A;  2B87 A;  1N86 A;  2V7Q J;  1LT9 C;  3EFF K;  3M9Q A;  1NTK J;  1OVV A;  2KSE A;  3T97 A;  1GU5 A;  2RN0 A;  3HD7 A;  4COP A;  1VDF A;  3MHV A;  1W5C E;  3D70 A;  3A3Y B;  1YQ4 C;  4WY4 A;  3H1I J;  5GTI E;  1D1D A;  3V2R A;  2E76 D;  2KR5 A;  2N1T C;  3CX5 H;  1ZV8 A;  2OGU A;  1ACP A;  3AEE C;  5AVV B;  2JGP A;  3G26 A;  4H13 B;  1VQ8 P;  1KB9 D;  2L4B A;  5KLI B;  1EOQ A; 
#chains in the Genus database with same CATH homology
 1EIA A;  1RO0 A;  5HGL A;  1VQ9 P;  3CD6 P;  1AUM A;  2EIA A;  1Q82 Q;  1VQM P;  2EG5 A;  4COC A;  4U0D A;  3WBH A;  1K73 Q;  4U0B A;  3CCL P;  3I56 P;  1K30 A;  3CME P;  4PH1 A;  4U0F A;  3CCS P;  1PEM A;  5BS2 A;  1VQP P;  5HGO A;  3B5I A;  5F2O A;  3G71 P;  5F2N A;  1A43 A;  5BS1 A;  2KOD A;  5F2K A;  4U0E A;  3G1G A;  2PEN A;  4XFY A;  1M90 Q;  2M8L A;  3NTE A;  5HGN A;  1KQS O;  5DCK A;  1N8R Q;  5HGM A;  2BQ1 E;  3DS5 A;  1K8A Q;  2ONT A;  3DS1 A;  3RG6 C;  3CCM P;  3CXC O;  1BAJ A;  2OTJ P;  3G28 A;  4XFZ A;  2XT1 A;  3I55 P;  1YI2 P;  1IUQ A;  4U0C A;  2Z44 A;  1RNI A;  1S72 P;  2PEJ A;  1Q86 Q;  2M8P A;  5JPA A;  1YJW P;  2L6E A;  4M0I A;  1VQO P;  3CCV P;  3DS0 A;  4QNB A;  1PEU A;  3CCJ P;  1M6E X;  4WYM A;  3CC4 P;  2PEK A;  3CCU P;  1VQ6 P;  2PEI A;  1VQ7 P;  1VQL P;  4XRQ A;  3DTJ A;  3LRY A;  2XV6 A;  3OW2 O;  1KD1 Q;  1YJN P;  1M74 A;  3DS4 A;  3G1I A;  1Q7Y Q;  1A8O A;  1W2B O;  4XRO A;  3CCR P;  3DS3 A;  4IPY A;  1QVG O;  4GR2 A;  3G29 A;  1PEO A;  2JO0 A;  1ZMB A;  3VRL C;  1NJI Q;  3DPH A;  2M8N A;  2PEO A;  1RO2 A;  3CCQ P;  1VQ5 P;  1VQ4 P;  2JYG A;  1YIJ P;  2DGY A;  4GR6 A;  3CC2 P;  1M1K Q;  2JYL A;  3CPW O;  5I4T G;  3G6E P;  1VQK P;  2PY8 A;  1QRJ A;  3MGE A;  1E6J P;  3M1M A;  1JJ2 O;  3H47 A;  2P9X A;  4COP A;  1M6N A;  2BHV A;  1PEQ A;  3H4E A;  2E1M A;  2EFJ A;  3H0D A;  3CMA P;  3G21 A;  1VQN P;  4XFX A;  2CWO A;  1YIT P;  2PEM A;  1K9M Q;  2LF4 A;  2Z46 A;  2Z45 A;  1D1D A;  3E2D A;  4PH0 A;  3HYB A;  1Q81 Q;  2XXM A;  3CCE P;  2QEX P;  2PEQ A;  2BUO A;  1YHQ P;  3P05 A;  2QA4 P;  1KC8 Q;  3G26 A;  3HZQ A;  1QVF O;  4U0A A;  2OAR A;  3G4S P;  1VQ8 P;  2OTL P;  3CC7 P;  3DS2 A;  3G0V A;  3Q20 A;  1YJ9 P;  1EOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...