1YJWP

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjwP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjwP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjwP02
3CC2P 3CCMP 3CMAP 1VQNP 3CCEP 1M1KQ 3I56P 1Q82Q 1KC8Q 1YIJP 2OTJP 1YJWP 1S72P 1VQ4P 3CCSP 2OTLP 1KQSO 3G71P 1K9MQ 3CCJP 3CCQP 1Q7YQ 1QVFO 2QEXP 1JJ2O 1Q86Q 1VQPP 3CMEP 1K8AQ 1QVGO 3CCUP 1YHQP 3CCVP 1Q81Q 1VQKP 3CPWO 3G4SP 3OW2O 3CCLP 2QA4P 3G6EP 1YJNP 3I55P 1YI2P 1VQMP 1VQOP 1VQ7P 1YJ9P 1NJIQ 3CCRP 1KD1Q 3CD6P 1YITP 1VQ8P 3CC4P 3CXCO 1M90Q 1VQ6P 1W2BO 1VQ5P 1VQLP 1VQ9P 1K73Q 1N8RQ 3CC7P
chains in the Genus database with same CATH superfamily
4WVZA 3RK3B 1PGPA 2HPCB 3AE3C 1S4XA 1JJ2O 1P84E 1OVRA 4I2LC 1KB9I 4OGQC 4UHPB 3G4SP 2Q9IA 1NTKJ 1YJNP 4M3LA 1VQ7P 1KD1Q 5TJHA 1PV3A 3L72E 4JQ0D 1M74A 4L73A 2VRSA 2P58A 1KC8Q 1U7MA 5HGNA 1FZBA 2B88A 2Q3EA 2FQ0A 3H1JG 1FZCC 3Q3DA 1SQVG 1ZXGA 5APWA 2JB0A 1VPCA 1OW8A 2ZT9B 3TGUG 4EYYQ 4NEOA 2LPKA 2M3EA 2WPRA 1GK6A 5H2FH 2QJKB 1RNIA 1Y8AA 1FOSE 1PPJD 3RK3C 5KJ7A 4DJGA 3OAKA 3GHGC 2A45G 3HE4A 2K92A 1FBMA 2E76C 3G28A 3DTJA 3H25A 1J2JB 3LMOA 2NPSC 2JYLA 1SQQE 1NU1E 2ERHA 5GTIH 3BRTB 1SVFA 1JEKA 1L0ND 3CMAP 2OTJP 4C7NA 3CCJP 3VYIA 2WSCH 1HY8A 5CBNA 5AW0B 1IFJA 1PP9D 3H1LD 2ZYGA 1ZOYC 1PGOA 2QJYB 1JO5A 2ZT9C 3NTNA 2K93A 1S9KD 1HWTC 3V2PA 2IPPA 2IBZD 2RN0A 2QJKC 3TDKA 3UIAA 2PGDA 3W67A 2Z45A 2L91A 1KILE 5AVSB 2R32A 4GKGA 3LW5J 3GJNA 3CWBG 3VTPC 3M1MA 2BCCJ 3GZMA 4ZKUA 1AVOA 1BE3D 3F5HA 4U3FG 1HJ0A 1USDA 4TLFA 1Q86Q 1VKUA 2WSEH 1DX7A 1RE3C 1L0LD 2CNRA 3NFQA 3OW2O 2HYNA 3NY7B 4ZKPA 3TNUB 5AVWB 2KLUA 2Q3IA 1L0NK 2IZ0A 4OWFA 5APUA 4A7PA 3CXHI 4BXLA 3A2AA 2IFMA 3TK1A 4PD4E 3FGAD 4C7NB 3L70G 1EOQA 1BCCG 1RE4A 5KAIH 2GUVA 4K3AA 2IFNA 3M9QA 2ITAA 2MJZA 1N7SC 1OWAA 4JYCA 1DNYA 2H43A 2EHTA 1LTJB 1JY3P 2LIUA 3A0BH 4BRYA 3WU2H 1X79B 4EIJA 3Q5SA 2N1TA 4U3FE 2LXCB 4GDOA 3HD7D 1S2EA 2R5DA 4JPZB 3OJAB 4XA4A 4XROA 2PFXA 5AW2B 1KYOE 3LIEA 3I56P 4H44B 2G8YA 2R5BA 2Z4EA 2Q1KA 5APVA 3PH0A 1HUCA 4GR2A 2WT7A 3AEBC 2KODA 1ZR4A 1KB9D 2LKMA 1L0LK 1EC5A 3L70E 1YHQP 1LWUB 1NTKG 2KI7B 4OH8B 2JO1A 1R5LA 1YJ9P 1AJYA 2PEJA 1YTZT 1Q2NA 4H0LB 1N8RQ 1RF1A 1FE6A 3NMDA 1QL1A 2AVAA 2GDXA 1LTJC 3RBXA 2FYUG 2XZRA 4U0CA 1URQA 5KAFH 1DD3A 2KG8A 1DV5A 5HGMA 2QM7A 2OYIB 3KPEA 1KQFB 4AQRD 5CCHA 1N86A 4H44C 3V6IA 3KYQA 1SFCA 1PEMA 2Y0DA 1RF0C 1NTKE 4IL6X 1LWUC 3CXCO 1EDKA 2G3AA 1GXHA 1JNMA 1LJ2A 1BGYG 4H0LC 1SQPD 2QG4A 1ACPA 2GA1A 1GZLA 3DS3A 2HR3A 1ZLLA 2WT7B 2FFDB 2ONTA 2GYKA 1JY2O 3II6A 1IFNA 4NPFX 2QJPB 2KUBA 3H1LJ 1KFNA 1RE4C 2KGAA 3IR9A 5CBOA 3JC22 2W83C 1ZP0C 2SPZA 2OYIC 2PEIA 1EZVE 1GW3A 2NRGA 1OVVA 1RF1B 4EOTA 2V7QH 2CWOA 3L74G 3P8CD 1MZ9A 2ZXEB 3TYYA 2CGQA 1FZEA 1G1JA 2XU6A 5CJ4A 5AVZB 3FX0A 1GL2D 3HZQA 2E74B 3DS1A 3F89A 5KP8B 3CX5H 2FADA 4AYCA 1GD2E 4KHXA 3AE1C 2XKMA 2BCCG 3V4QA 2N9YB 4IOIH 1KFMA 3EWKA 3C1LA 3R4YA 3PJSK 1DH3A 2O01H 1L0LJ 2A45H 2FFDC 2YO2A 3CE7A 2MR8A 1NJIQ 1SFCB 4YTPC 3D70A 2K94A 2QJPC 1M6EX 1SQPK 5AW6B 3CC2P 5H2FE 3RL0g 1A43A 2A06D 4LLHA 4W7ZA 3CCSP 4YXWH 1RF1C 1E6JP 3EJDA 3B5NC 2YMYA 1SQVJ 2HG5D 5GTIE 1IO4A 3TGUJ 1W2BO 2E74C 2W6JH 2JWAA 1WMKA 1U57A 2BCCE 3MGNA 2K0XA 4PD4H 1RY3A 2KS1A 2Q7CA 1SQBD 3AE4C 2N5IA 3PLNA 4DT0A 3AEGC 3H1HD 2VSQA 2JYGA 1H0TA 1YBKA 2K9JB 2ZYAA 2MY5A 1SFCC 4GIFA 4XFYA 1FJPA 3GG2A 5KJ7D 2C0WA 1GXGA 5F2KA 4YPCA 3IN6A 1KYOH 5APQA 3L35A 1JMMA 2J58A 3CL3D 2OTLP 1FZCA 3RL0B 1P84I 2P1JA 3HRNA 3G26A 2WTYA 2B87A 1BAJA 5AW7B 5CJ0A 5TISE 1OXZA 3H1ID 5L8RJ 5JPAA 3G3ZA 2Z5HA 3CWBJ 3GHGA 3RGUA 2JU2A 4H2YC 1PPJG 2NPSA 1UIIA 2JDIH 1SQBK 5KAIE 1KILB 1PIXA 1T8ZA 2XXMA 2W27A 3BCCD 2KWLA 5BVZA 3CCLP 2WITA 3MGEA 1N73C 1J1DB 1WRGA 4OVNF 3CD6P 3ABVC 1IMPA 1L0NG 5CZDB 4PV1C 4H44D 2K3RA 3OA7A 1MUUA 1SQPJ 2GDYA 3A0BE 2LXBA 2VLNA 3RL0C 2N50A 1BCCJ 4H2XC 4PXHB 1PP9G 3H1LG 1QRJA 2LF4A 2QVAA 5AVTB 2PEMA 1EQ7A 3NXSA 3CCEP 3CLQA 5CCGC 2L6EA 5KLIB 2BEZF 1OR5A 1LTSC 5AW5B 2MVUA 2IBZG 1PPJE 2ZFCA 2LOLA 2D2CB 4KJMA 2XNXA 1KILC 3D6ZA 2MF4A 4UB8H 2K0DX 3KXDA 1NVOA 1HF9A 3G29A 1T2KD 1J1DC 2VLQA 1PFIA 1RE3A 1M7LA 1LTIC 3GHGB 3SFEC 1DD4A 1BE3G 2H89C 2E76B 2JAZA 1Q7YQ 1OX3A 1JTHB 2P2UA 1M6NA 2GUSA 2NPSB 3L75D 2N1TD 3D71A 2XDJA 1L0LG 4DG9A 5KAFE 2MVVA 1JY2N 3I55P 3QH9A 1D1DA 1YQ4C 1NO4A 3H1LE 3IAOA 3L73D 5AVXB 1A02F 1S9KE 2PRRA 5KLIC 5BS2A 1QVFO 3L71D 5DJTB 2FYUJ 1N7SA 1NTMD 1OFCX 5E79H 1PEOA 2D2CC 1FS0E 1HJBA 2K37A 1VQOP 3LIDA 2ZVNB 4WYMA 1OZHA 2KG6A 2WVRA 2MR7A 4C7RA 5KP7B 4QMAA 5BU8B 1IFDA 1K9MQ 2Q5UA 4MRTC 3RK2B 2N98A 1VDFA 4I7ZB 3TNUA 3SFDC 5C39A 2E74D 1URQD 1L0LE 1MV8A 4N78D 1A02J 3RG6C 1S3JA 3LW5H 4EDFA 1Q82Q 3VMZA 1BGYJ 1NTZD 2CG5B 5CCHD 2FY8A 1CEIA 2N9BA 3AEDC 4XE5B 4CA3A 5F2NA 1ZMBA 3AECC 2KOOA 2PNGA 3H1JE 5GTHH 1SFCD 2Y9YA 1SQVE 1QL2A 2WQYC 2ZXXA 2WWWA 1S5LE 1IC2A 3CX5E 1KORA 2P9XA 1HVVA 1LTJA 3M9HA 1BDCA 3TGUE 4K35A 1P84D 3AE7C 2JO0A 3L4FA 1NTMK 4PWVB 2OYOA 5HVCA 3L74J 1MKMA 3QWOC 3DS0A 1N7SB 3RK2C 3L72D 3USSA 4Y99B 4I7ZC 4HJGH 1KTMA 3H1IJ 3DPHA 2XV6A 2KIKA 1SQXD 3N7NA 3H0DA 2P10A 4YXDC 3EFFK 3L37A 1RF0A 3LRYA 2QE7H 1KB9E 1LWUA 1J1EB 4DZOA 2I1KA 5TISH 2FYNB 5AW1B 1GPJA 2K5XA 1K73Q 2GZEA 1NTZK 3U43A 1SQPG 1IFPA 2LTEA 2CPBA 2FVFA 2M8LA 1T3JA 3M0DC 3H32B 2KG9A 1SQQD 1NU1D 2QRXA 2AEJA 1PGQA 2OYIA 4RESB 3BVHA 7CEIA 1YITP 1NH4A 4Y99C 2H88C 1LP1B 1PEUA 3CWBE 1VQ4P 3RL0D 1QX8A 4XFJA 3CCUP 1IFMA 2VLOA 3AE6C 4U0FA 1J1EC 2K0YA 1HGVA 4W80A 2YXRB 1NWQA 1K05A 1SQXK 1LTGC 2FYNC 4B86A 1UIXA 4R0MA 2P7JA 4XFXA 4HB1A 4HH2A 2FFDA 1LT9A 2Z5IA 1N2DC 2EG5A 1H88A 1BCCE 2LMLA 2FHSC 4HKZH 2LL8A 3L36A 5APYA 3L73J 1CI6B 1M1KQ 2A06G 3T97B 2FBWC 3B5NA 1L2PA 1A8OA 3H1KD 4OGQD 3L71J 2JR8A 1SQQK 1NU1K 2ZVOB 2Z44A 1IK9A 1L0IA 3Q20A 1IJDB 2PAJA 1OVUA 2HLOA 3I5CA 1U7JA 4ASWA 4XRQA 2GDWA 4PD4D 2AXCA 2KSEA 3EQ2A 1AA0A 1GTWA 2FYZA 4W7YA 3WUVA 3AE5C 3CCVP 1SQBG 3H1HG 1AF8A 4PH1A 1G2CB 2WZ7A 1E79H 2ROQA 1VQ9P 1L0NJ 4GOEA 3RK3D 3MZWB 1FDIA 3GF7A 3CXHE 1ZR2A 2E76D 2YNYA 2O1JA 2KLVA 2NPSD 3CMEP 2HFED 2O3JA 2FYUE 1LT9B 2ZAEB 1AQTA 2M8PA 1FZFA 4UB8E 3VP9A 2NZ2A 1PP9J 3P7KA 3MUDC 5AVRB 1M57D 1NYHA 1EDLA 2OYHC 1MFZA 2FQ1A 2IZ1A 4R4MA 2UWJE 3FWLA 2QEXP 3SWYA 3B5NB 3JSVC 2WPQA 2I1JA 2IYOA 2K9JA 5CHXA 3DS4A 2ZT9D 2AFDA 3CCRP 1S5LH 3H1IG 1TU3F 3CC7P 1SQXJ 3BASA 1JUNA 1BGYE 1LTAC 1BE3J 3AEAC 3RK2D 3M91A 1N73A 4L75A 5E79E 1RQVA 3BCCG 3B4SA 1FZGA 2XV5A 1LT9C 4HKGA 1AV1A 2YKPA 4WY4A 5KP6B 2J59M 2YXQB 1VQNP 2XZ0D 1YJWP 3H47A 2KR5A 2FKWB 3BATA 1E0HA 1IFIA 4WWIA 1KB9H 2L4BA 1ZW0A 3L74E 4KT0J 2AXTH 3G6EP 2W6BA 3Q1MA 5CCGA 4QNBA 2BASA 5BU5A 2M8NA 4GOFA 3H1IE 3S4RA 1AFOA 1FC2C 1KILA 3R2PA 1YYCA 1VQPP 1N7SD 1NKZB 2EHSA 3V4WA 5GTHE 3KQGA 2RKLA 5F2OA 2YMKA 3GZLA 1EZVD 1KLPA 4JBZA 2HODA 3CI9A 5EJDA 1M1JA 1VF5B 3NTEA 1JCDA 3K5BA 4U0EA 3L75G 1X3OA 2R44A 2PY8A 1N73B 1ZRTE 1EDIA 4H2WC 1WT6A 4PV1B 1M90Q 3AEFC 3L73G 1R8EA 2O1KA 1W2EA 4WY4B 3WBHA 1RHZB 2JJLA 3H1KJ 5KLVD 1GU5A 3L71G 2WSSH 1NTMG 1H89A 3PP5A 1G1IA 4IZ6A 1DEEG 5APSA 2KOQA 3FXEA 2FVAA 1IMQA 1Y47A 1VL2A 3A0HE 1JTHA 3GLMA 4PJ0H 1OW7A 1VF5C 1NAFA 1IK7A 1KMIZ 1KV4A 2K88A 1VQKP 3HD7B 1LTTC 2GZJA 1JOCA 2EIAA 1NTZG 4D6TD 4LC1A 1FDMA 2Y0EA 2PP6A 2E75B 4BPFA 2DW3A 2HODB 4WY4C 2C9LY 1M1JB 1UJZA 1BSHA 1LTBC 4H0LD 2W8ZA 3EJEA 3HUSB 4U7JA 5DCKA 5KLVK 3CXHH 1NGMB 3RG2A 1L4AA 1JY2P 1JY3O 3VOPA 3O8ZA 1Y9BA 3B5IA 2M8RA 2WSFJ 1F80D 1BSNA 2W6AA 4LGDE 3L72G 3HTKB 2KOSA 1USEA 1KZUB 1VQMP 3HD7C 3CX5I 2M5AB 2H8PD 3S9OA 3SSUA 1SQXG 1CSBA 3DS5A 2LKIA 1L0NE 4H13B 2FAEA 1S1CX 3MP7B 3P05A 1EXJA 1T8KA 4N6JA 1BXIA 2E75C 1FDOA 2Y9ZA 3U1AA 3B71A 4TT3H 2A45I 2N6YA 5B5EE 3CPWO 1M1JC 2YKQA 2AFEA 1PP9E 2PEKA 4IFDK 3M0DA 5APTA 4AUWA 1FJKA 2Z46A 3HUSC 3V5BA 1IZNB 2LIWA 2IBZE 3E7KA 1SQQG 1NU1G 1XTCC 4WB4A 2B89A 1ZV8A 1SS1A 2KGDA 1VQ5P 3VN0A 2KSJA 1SQXE 3A7OA 3B5ND 4PD4I 4QKOA 2JKVA 1CZQA 4H13C 1BE3E 2QIWA 1L4AB 1SQBJ 3PTZA 5HGLA 4RJTA 2E5YA 4GR6A 3H1HJ 1GL2B 1S5LX 2OQQA 1VQ8P 1HQBA 3Q5RA 2JEEA 1PGJA 1RQUA 1UNKA 3H32A 1GK4A 1AYIA 5APXA 3VRLC 1KYOI 4HYTB 2JU1A 1AVYA 2QNWA 1LP1A 3M9BA 1K04A 2I8DA 4NPDA 2JQ4A 3Q2YA 3AE2C 1KQSO 2Q6QA 2MD9A 3H1KG 2KYVA 5KLVJ 4BPHA 3AEEC 3MD0A 2GZIA 1Z56A 1L4AC 4DOJA 3KHUA 1QEXA 1GL2C 4WBAA 3G1IA 3CCMP 1HTLC 1R5SA 2L5GB 2CQ8A 1GU4A 3P8MC 3G71P 2FACA 2K9YA 1DIPA 2QSIA 2YO3A 5B66E 2DGYA 2AXTE 2R3SA 2QA4P 3BCCJ 1W5CE 2Y0CA 2L0QA 3E2DA 1ZNVA 1AUMA 2M3BA 4XFZA 1CI6A 1FU1A 4IFFA 2KZIA 4N3YB 3T97A 1ZN5A 1Q90D 2GZFA 2KGCA 3G21A 1L0HA 3PRJA 1VF5D 2WSCJ 3A5TA 4D6TJ 2K1AA 3A0HH 5KKZB 2CPSA 3JCUE 5AVUB 3AE8C 3H1KE 3MUDA 1Q81Q 3FXDA 3HE4B 2OYHA 2LR2A 1JB0J 4PV1D 2KW2A 3GW6A 2P67A 4JF7A 1NAYA 4NPEA 1CW5A 4WY4D 2QJYC 2XT1A 1LT1A 3RBZA 3H1JD 1FZAA 3GMAA 1K8AQ 1SQVD 2E1MA 1DEBA 3CX5D 3E1RA 1G2CA 2OGUA 2IX7C 3TGUD 4UB6E 5CCGD 1MFTA 4I6MC 1EMVA 1BDDA 3N4XA 1RH5B 1EZVI 3RK3E 2WSEJ 2BQ1E 1PZQA 1SQPE 2KXPB 3MTUE 5KKZC 1KILD 4MN4C 5AW4B 2EFJA 3VP8A 3KZIH 2KOPA 3L75J 2K2QA 1LNQA 5KJ7C 1T6AA 1N7LA 2PEQA 1M56D 3KDPB 5AVQB 4BWNA 2N6ZA 2CK3H 2E42A 2KB7P 2ZYDA 3EFGA 2E75D 1S72P 1OW6A 1T3UA 1X8YA 4PJ0E 2IYPA 3ZDMA 1JY3N 2C9NY 1NTMJ 3E1IA 2H7HA 4U0AA 3P8CE 3V2QA 5B5EH 2WPTA 3HYBA 5HV8A 3VMXA 3H6PA 2OYHB 1VQ6P 4I1LA 1LGHB 3PHLA 1KQGB 1FAVA 2JGPA 3H4EA 4CPGA 2OARA 2OTKE 2B9BA 2BEQD 1P84H 2D2CD 1SQVK 2JWDA 1SP4A 5I4TG 1PL5A 3P32A 2IDBA 1H8AA 2RMZA 3CWBD 1EZVG 1GDTA 1AQ5A 1OMIA 3G1GA 4H13D 4ZMDA 1NTZJ 2XNDH 2A06E 4U3FD 4BRYB 4PH0A 1IUQA 1NQ4A 2N1TB 3VMYA 1KYOD 1JM0A 2AF8A 3S1KA 1M8OB 5CMZA 3O6QA 2POHA 5M1BA 2BHVA 5KLVG 3L70D 1HBWA 1FOSF 1BCCD 2AEMA 2M0BA 1NHLA 2FXOA 1PEQA 1YTZI 2KZJA 3L72J 1SQBE 1NKNA 4IL6E 3H1HE 2VLPA 5DJUB 3U1CA 4GT1A 1Z6MA 1T2KC 5EFWB 3G0VA 2JP3A 1L4AD 2KK7A 3V2RA 1HGZA 4ZNCA 2GM4A 3Q5PA 4DCKA 1URQB 2N1TC 4Y28J 2RH0A 3EJBA 1ZMEC 4D6TG 4U0BA 1QLED 2FXPA 2JBGA 4ASVA 1X22A 3SWKA 5KLVE 1GMJA 1SQQJ 2QM8A 1NU1J 5B66H 2KP8A 1NTKD 3WUUA 3FWNA 4COCA 2YIUB 4COPA 3CXHD 1RO2A 3C9IA 3O6QB 3MIWA 2V7QJ 2M5RA 5EW5E 3JCUH 2FYUD 3M06A 3H1JJ 3HD7A 2KOGA 1QVGO 1E5WA 3GF3A 3SWFA 2C0XA 2KORA 2N5HA 3BCCE 3HE5A 1K30A 4M0IA 1URQC 3G9RA 2E43A 2MKVA 2W90A 2WPVB 4D6TE 2O01J 1X0TA 4JYBA 3M0AA 5CCHC 3AE9C 3GKLC 2L9FA 2YKOA 2WMMA 1X9VA 1EXIA 4EI2A 3HUSA 4UB6H 3C8VA 5HGOA 3BRVB 1SLQA 2YIUC 1BGYD 3TF5A 3CCQP 1XTGB 3VMAA 1NTKK 3HTKA 3TSIA 4O9BA 4F37A 3WUTA 4RKUJ 2M5AA 2PENA 1EIAA 1VQLP 1YQ3C 2FXMA 1VHNA 1GW4A 2FYUK 5AVYB 3B8EB 2IBZI 3L74D 3IF4A 2KNCA 2L22A 2V4HA 1MZ8A 2X2BA 3L75E 2KGEA 2WSFH 2J5UA 5K5GB 2XZ1C 2HPCA 3HE5B 2BCCD 4IPYA 5AVVB 3L73E 1FR2A 2E5TA 4U3FJ 4R4LA 4U0DA 3U59A 5BS1A 2WPSA 3L71E 3DS2A 1HH0A 1D7MA 2KS1B 1NTME 5AW3B 2FQ2A 4GODA 1JMBA 3CC4P 1H0TB 3MHVA 2NO8A 2GZGA 4C46A 3A3YB 3D6YA 3WU2E 2O01N 2FVEA 4L74A 1QGKB 4OGQB 3L70J 1RO0A 1ZRTD 5KTBA 1JCCA 3KZIE 5AW8B 1KQLA 3W68A 2BUOA 1GL2A 4IFMA 4L76A 1YI2P 4BPGA 1OIPA 1NOHA 2AEFA 3WMM0 4N78E 4RO0A 2ZJSE 1YIJP 1KN7A 4Z1MH 2R3CA 1FZCB 1NTZE 3ITKA 3IFMA 1EDJA 2B87B 2KNCB 5AW9B 3V2NA 3B4QA 2DNWA 4IL6H 2PEOA
chains in the Genus database with same CATH topology
3G21A 3CCEP 4XFYA 3I56P 2L6EA 2EIAA 1Q82Q 2PEIA 1PEUA 1VQ4P 3H4EA 2OARA 4U0BA 5F2NA 4GR2A 1ZMBA 2KODA 1JJ2O 1VQPP 2CWOA 3CMEP 3CCUP 1YHQP 2Z45A 1Q81Q 3G4SP 5HGLA 5I4TG 4U0FA 2M8PA 5F2KA 5F2OA 1YJNP 3HZQA 4GR6A 3DS1A 4COCA 1YJ9P 1VQ7P 2PEJA 1KD1Q 1VQ8P 3G29A 1M74A 4COPA 2P9XA 1RO2A 1N8RQ 3M1MA 5DCKA 3G1GA 4IPYA 4XFXA 2XT1A 1KC8Q 2OTLP 5HGNA 2JO0A 1Q7YQ 2QEXP 3G26A 4U0DA 1M6NA 1Q86Q 3NTEA 4PH0A 1IUQA 1K8AQ 5BS1A 1QVGO 4U0CA 3B5IA 4U0EA 2EG5A 3DS2A 2E1MA 3DS0A 2PY8A 1BAJA 3VRLC 3OW2O 3I55P 3DS4A 1VQMP 5HGMA 1NJIQ 3CCRP 1D1DA 3CC4P 1M90Q 1K30A 3DPHA 1M6EX 4M0IA 2XV6A 5JPAA 3CC7P 3CC2P 1A43A 3H0DA 1M1KQ 3DS5A 1RNIA 3CCSP 1KQSO 1A8OA 3WBHA 2BQ1E 3P05A 2BHVA 5BS2A 1QVFO 1EOQA 1RO0A 3LRYA 3G28A 3DTJA 2EFJA 1E6JP 2Z44A 1PEOA 2XXMA 1PEQA 3CPWO 2BUOA 3Q20A 1PEMA 3CCLP 3MGEA 1YI2P 2JYLA 1VQOP 2PEQA 3CD6P 3CXCO 1W2BO 2PEKA 4WYMA 5HGOA 1K73Q 3G1IA 3CCMP 3CMAP 1VQNP 4XRQA 2OTJP 1YIJP 1YJWP 1S72P 3H47A 3G71P 2Z46A 1K9MQ 3CCJP 3G0VA 3CCQP 2M8LA 3DS3A 3CCVP 2ONTA 2DGYA 1VQKP 4U0AA 2QA4P 3G6EP 4XROA 4QNBA 3E2DA 3HYBA 1AUMA 2JYGA 4XFZA 4PH1A 2PENA 1YITP 1QRJA 1EIAA 2M8NA 1VQ6P 3RG6C 2LF4A 1VQ5P 1VQLP 2PEOA 1VQ9P 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 P;  3CCM P;  3CMA P;  1VQN P;  3CCE P;  1M1K Q;  3I56 P;  1Q82 Q;  1KC8 Q;  1YIJ P;  2OTJ P;  1YJW P;  1S72 P;  1VQ4 P;  3CCS P;  2OTL P;  1KQS O;  3G71 P;  1K9M Q;  3CCJ P;  3CCQ P;  1Q7Y Q;  1QVF O;  2QEX P;  1JJ2 O;  1Q86 Q;  1VQP P;  3CME P;  1K8A Q;  1QVG O;  3CCU P;  1YHQ P;  3CCV P;  1Q81 Q;  1VQK P;  3CPW O;  3G4S P;  3OW2 O;  3CCL P;  2QA4 P;  3G6E P;  1YJN P;  3I55 P;  1YI2 P;  1VQM P;  1VQO P;  1VQ7 P;  1YJ9 P;  1NJI Q;  3CCR P;  1KD1 Q;  3CD6 P;  1YIT P;  1VQ8 P;  3CC4 P;  3CXC O;  1M90 Q;  1VQ6 P;  1W2B O;  1VQ5 P;  1VQL P;  1VQ9 P;  1K73 Q;  1N8R Q;  3CC7 P; 
#chains in the Genus database with same CATH topology
 4WVZ A;  3RK3 B;  1PGP A;  2HPC B;  3AE3 C;  1S4X A;  1JJ2 O;  1P84 E;  1OVR A;  4I2L C;  1KB9 I;  4OGQ C;  4UHP B;  3G4S P;  2Q9I A;  1NTK J;  1YJN P;  4M3L A;  1VQ7 P;  1KD1 Q;  5TJH A;  1PV3 A;  3L72 E;  4JQ0 D;  1M74 A;  4L73 A;  2VRS A;  2P58 A;  1KC8 Q;  1U7M A;  5HGN A;  1FZB A;  2B88 A;  2Q3E A;  2FQ0 A;  3H1J G;  1FZC C;  3Q3D A;  1SQV G;  1ZXG A;  5APW A;  2JB0 A;  1VPC A;  1OW8 A;  2ZT9 B;  3TGU G;  4EYY Q;  4NEO A;  2LPK A;  2M3E A;  2WPR A;  1GK6 A;  5H2F H;  2QJK B;  1RNI A;  1Y8A A;  1FOS E;  1PPJ D;  3RK3 C;  5KJ7 A;  4DJG A;  3OAK A;  3GHG C;  2A45 G;  3HE4 A;  2K92 A;  1FBM A;  2E76 C;  3G28 A;  3DTJ A;  3H25 A;  1J2J B;  3LMO A;  2NPS C;  2JYL A;  1SQQ E;  1NU1 E;  2ERH A;  5GTI H;  3BRT B;  1SVF A;  1JEK A;  1L0N D;  3CMA P;  2OTJ P;  4C7N A;  3CCJ P;  3VYI A;  2WSC H;  1HY8 A;  5CBN A;  5AW0 B;  1IFJ A;  1PP9 D;  3H1L D;  2ZYG A;  1ZOY C;  1PGO A;  2QJY B;  1JO5 A;  2ZT9 C;  3NTN A;  2K93 A;  1S9K D;  1HWT C;  3V2P A;  2IPP A;  2IBZ D;  2RN0 A;  2QJK C;  3TDK A;  3UIA A;  2PGD A;  3W67 A;  2Z45 A;  2L91 A;  1KIL E;  5AVS B;  2R32 A;  4GKG A;  3LW5 J;  3GJN A;  3CWB G;  3VTP C;  3M1M A;  2BCC J;  3GZM A;  4ZKU A;  1AVO A;  1BE3 D;  3F5H A;  4U3F G;  1HJ0 A;  1USD A;  4TLF A;  1Q86 Q;  1VKU A;  2WSE H;  1DX7 A;  1RE3 C;  1L0L D;  2CNR A;  3NFQ A;  3OW2 O;  2HYN A;  3NY7 B;  4ZKP A;  3TNU B;  5AVW B;  2KLU A;  2Q3I A;  1L0N K;  2IZ0 A;  4OWF A;  5APU A;  4A7P A;  3CXH I;  4BXL A;  3A2A A;  2IFM A;  3TK1 A;  4PD4 E;  3FGA D;  4C7N B;  3L70 G;  1EOQ A;  1BCC G;  1RE4 A;  5KAI H;  2GUV A;  4K3A A;  2IFN A;  3M9Q A;  2ITA A;  2MJZ A;  1N7S C;  1OWA A;  4JYC A;  1DNY A;  2H43 A;  2EHT A;  1LTJ B;  1JY3 P;  2LIU A;  3A0B H;  4BRY A;  3WU2 H;  1X79 B;  4EIJ A;  3Q5S A;  2N1T A;  4U3F E;  2LXC B;  4GDO A;  3HD7 D;  1S2E A;  2R5D A;  4JPZ B;  3OJA B;  4XA4 A;  4XRO A;  2PFX A;  5AW2 B;  1KYO E;  3LIE A;  3I56 P;  4H44 B;  2G8Y A;  2R5B A;  2Z4E A;  2Q1K A;  5APV A;  3PH0 A;  1HUC A;  4GR2 A;  2WT7 A;  3AEB C;  2KOD A;  1ZR4 A;  1KB9 D;  2LKM A;  1L0L K;  1EC5 A;  3L70 E;  1YHQ P;  1LWU B;  1NTK G;  2KI7 B;  4OH8 B;  2JO1 A;  1R5L A;  1YJ9 P;  1AJY A;  2PEJ A;  1YTZ T;  1Q2N A;  4H0L B;  1N8R Q;  1RF1 A;  1FE6 A;  3NMD A;  1QL1 A;  2AVA A;  2GDX A;  1LTJ C;  3RBX A;  2FYU G;  2XZR A;  4U0C A;  1URQ A;  5KAF H;  1DD3 A;  2KG8 A;  1DV5 A;  5HGM A;  2QM7 A;  2OYI B;  3KPE A;  1KQF B;  4AQR D;  5CCH A;  1N86 A;  4H44 C;  3V6I A;  3KYQ A;  1SFC A;  1PEM A;  2Y0D A;  1RF0 C;  1NTK E;  4IL6 X;  1LWU C;  3CXC O;  1EDK A;  2G3A A;  1GXH A;  1JNM A;  1LJ2 A;  1BGY G;  4H0L C;  1SQP D;  2QG4 A;  1ACP A;  2GA1 A;  1GZL A;  3DS3 A;  2HR3 A;  1ZLL A;  2WT7 B;  2FFD B;  2ONT A;  2GYK A;  1JY2 O;  3II6 A;  1IFN A;  4NPF X;  2QJP B;  2KUB A;  3H1L J;  1KFN A;  1RE4 C;  2KGA A;  3IR9 A;  5CBO A;  3JC2 2;  2W83 C;  1ZP0 C;  2SPZ A;  2OYI C;  2PEI A;  1EZV E;  1GW3 A;  2NRG A;  1OVV A;  1RF1 B;  4EOT A;  2V7Q H;  2CWO A;  3L74 G;  3P8C D;  1MZ9 A;  2ZXE B;  3TYY A;  2CGQ A;  1FZE A;  1G1J A;  2XU6 A;  5CJ4 A;  5AVZ B;  3FX0 A;  1GL2 D;  3HZQ A;  2E74 B;  3DS1 A;  3F89 A;  5KP8 B;  3CX5 H;  2FAD A;  4AYC A;  1GD2 E;  4KHX A;  3AE1 C;  2XKM A;  2BCC G;  3V4Q A;  2N9Y B;  4IOI H;  1KFM A;  3EWK A;  3C1L A;  3R4Y A;  3PJS K;  1DH3 A;  2O01 H;  1L0L J;  2A45 H;  2FFD C;  2YO2 A;  3CE7 A;  2MR8 A;  1NJI Q;  1SFC B;  4YTP C;  3D70 A;  2K94 A;  2QJP C;  1M6E X;  1SQP K;  5AW6 B;  3CC2 P;  5H2F E;  3RL0 g;  1A43 A;  2A06 D;  4LLH A;  4W7Z A;  3CCS P;  4YXW H;  1RF1 C;  1E6J P;  3EJD A;  3B5N C;  2YMY A;  1SQV J;  2HG5 D;  5GTI E;  1IO4 A;  3TGU J;  1W2B O;  2E74 C;  2W6J H;  2JWA A;  1WMK A;  1U57 A;  2BCC E;  3MGN A;  2K0X A;  4PD4 H;  1RY3 A;  2KS1 A;  2Q7C A;  1SQB D;  3AE4 C;  2N5I A;  3PLN A;  4DT0 A;  3AEG C;  3H1H D;  2VSQ A;  2JYG A;  1H0T A;  1YBK A;  2K9J B;  2ZYA A;  2MY5 A;  1SFC C;  4GIF A;  4XFY A;  1FJP A;  3GG2 A;  5KJ7 D;  2C0W A;  1GXG A;  5F2K A;  4YPC A;  3IN6 A;  1KYO H;  5APQ A;  3L35 A;  1JMM A;  2J58 A;  3CL3 D;  2OTL P;  1FZC A;  3RL0 B;  1P84 I;  2P1J A;  3HRN A;  3G26 A;  2WTY A;  2B87 A;  1BAJ A;  5AW7 B;  5CJ0 A;  5TIS E;  1OXZ A;  3H1I D;  5L8R J;  5JPA A;  3G3Z A;  2Z5H A;  3CWB J;  3GHG A;  3RGU A;  2JU2 A;  4H2Y C;  1PPJ G;  2NPS A;  1UII A;  2JDI H;  1SQB K;  5KAI E;  1KIL B;  1PIX A;  1T8Z A;  2XXM A;  2W27 A;  3BCC D;  2KWL A;  5BVZ A;  3CCL P;  2WIT A;  3MGE A;  1N73 C;  1J1D B;  1WRG A;  4OVN F;  3CD6 P;  3ABV C;  1IMP A;  1L0N G;  5CZD B;  4PV1 C;  4H44 D;  2K3R A;  3OA7 A;  1MUU A;  1SQP J;  2GDY A;  3A0B E;  2LXB A;  2VLN A;  3RL0 C;  2N50 A;  1BCC J;  4H2X C;  4PXH B;  1PP9 G;  3H1L G;  1QRJ A;  2LF4 A;  2QVA A;  5AVT B;  2PEM A;  1EQ7 A;  3NXS A;  3CCE P;  3CLQ A;  5CCG C;  2L6E A;  5KLI B;  2BEZ F;  1OR5 A;  1LTS C;  5AW5 B;  2MVU A;  2IBZ G;  1PPJ E;  2ZFC A;  2LOL A;  2D2C B;  4KJM A;  2XNX A;  1KIL C;  3D6Z A;  2MF4 A;  4UB8 H;  2K0D X;  3KXD A;  1NVO A;  1HF9 A;  3G29 A;  1T2K D;  1J1D C;  2VLQ A;  1PFI A;  1RE3 A;  1M7L A;  1LTI C;  3GHG B;  3SFE C;  1DD4 A;  1BE3 G;  2H89 C;  2E76 B;  2JAZ A;  1Q7Y Q;  1OX3 A;  1JTH B;  2P2U A;  1M6N A;  2GUS A;  2NPS B;  3L75 D;  2N1T D;  3D71 A;  2XDJ A;  1L0L G;  4DG9 A;  5KAF E;  2MVV A;  1JY2 N;  3I55 P;  3QH9 A;  1D1D A;  1YQ4 C;  1NO4 A;  3H1L E;  3IAO A;  3L73 D;  5AVX B;  1A02 F;  1S9K E;  2PRR A;  5KLI C;  5BS2 A;  1QVF O;  3L71 D;  5DJT B;  2FYU J;  1N7S A;  1NTM D;  1OFC X;  5E79 H;  1PEO A;  2D2C C;  1FS0 E;  1HJB A;  2K37 A;  1VQO P;  3LID A;  2ZVN B;  4WYM A;  1OZH A;  2KG6 A;  2WVR A;  2MR7 A;  4C7R A;  5KP7 B;  4QMA A;  5BU8 B;  1IFD A;  1K9M Q;  2Q5U A;  4MRT C;  3RK2 B;  2N98 A;  1VDF A;  4I7Z B;  3TNU A;  3SFD C;  5C39 A;  2E74 D;  1URQ D;  1L0L E;  1MV8 A;  4N78 D;  1A02 J;  3RG6 C;  1S3J A;  3LW5 H;  4EDF A;  1Q82 Q;  3VMZ A;  1BGY J;  1NTZ D;  2CG5 B;  5CCH D;  2FY8 A;  1CEI A;  2N9B A;  3AED C;  4XE5 B;  4CA3 A;  5F2N A;  1ZMB A;  3AEC C;  2KOO A;  2PNG A;  3H1J E;  5GTH H;  1SFC D;  2Y9Y A;  1SQV E;  1QL2 A;  2WQY C;  2ZXX A;  2WWW A;  1S5L E;  1IC2 A;  3CX5 E;  1KOR A;  2P9X A;  1HVV A;  1LTJ A;  3M9H A;  1BDC A;  3TGU E;  4K35 A;  1P84 D;  3AE7 C;  2JO0 A;  3L4F A;  1NTM K;  4PWV B;  2OYO A;  5HVC A;  3L74 J;  1MKM A;  3QWO C;  3DS0 A;  1N7S B;  3RK2 C;  3L72 D;  3USS A;  4Y99 B;  4I7Z C;  4HJG H;  1KTM A;  3H1I J;  3DPH A;  2XV6 A;  2KIK A;  1SQX D;  3N7N A;  3H0D A;  2P10 A;  4YXD C;  3EFF K;  3L37 A;  1RF0 A;  3LRY A;  2QE7 H;  1KB9 E;  1LWU A;  1J1E B;  4DZO A;  2I1K A;  5TIS H;  2FYN B;  5AW1 B;  1GPJ A;  2K5X A;  1K73 Q;  2GZE A;  1NTZ K;  3U43 A;  1SQP G;  1IFP A;  2LTE A;  2CPB A;  2FVF A;  2M8L A;  1T3J A;  3M0D C;  3H32 B;  2KG9 A;  1SQQ D;  1NU1 D;  2QRX A;  2AEJ A;  1PGQ A;  2OYI A;  4RES B;  3BVH A;  7CEI A;  1YIT P;  1NH4 A;  4Y99 C;  2H88 C;  1LP1 B;  1PEU A;  3CWB E;  1VQ4 P;  3RL0 D;  1QX8 A;  4XFJ A;  3CCU P;  1IFM A;  2VLO A;  3AE6 C;  4U0F A;  1J1E C;  2K0Y A;  1HGV A;  4W80 A;  2YXR B;  1NWQ A;  1K05 A;  1SQX K;  1LTG C;  2FYN C;  4B86 A;  1UIX A;  4R0M A;  2P7J A;  4XFX A;  4HB1 A;  4HH2 A;  2FFD A;  1LT9 A;  2Z5I A;  1N2D C;  2EG5 A;  1H88 A;  1BCC E;  2LML A;  2FHS C;  4HKZ H;  2LL8 A;  3L36 A;  5APY A;  3L73 J;  1CI6 B;  1M1K Q;  2A06 G;  3T97 B;  2FBW C;  3B5N A;  1L2P A;  1A8O A;  3H1K D;  4OGQ D;  3L71 J;  2JR8 A;  1SQQ K;  1NU1 K;  2ZVO B;  2Z44 A;  1IK9 A;  1L0I A;  3Q20 A;  1IJD B;  2PAJ A;  1OVU A;  2HLO A;  3I5C A;  1U7J A;  4ASW A;  4XRQ A;  2GDW A;  4PD4 D;  2AXC A;  2KSE A;  3EQ2 A;  1AA0 A;  1GTW A;  2FYZ A;  4W7Y A;  3WUV A;  3AE5 C;  3CCV P;  1SQB G;  3H1H G;  1AF8 A;  4PH1 A;  1G2C B;  2WZ7 A;  1E79 H;  2ROQ A;  1VQ9 P;  1L0N J;  4GOE A;  3RK3 D;  3MZW B;  1FDI A;  3GF7 A;  3CXH E;  1ZR2 A;  2E76 D;  2YNY A;  2O1J A;  2KLV A;  2NPS D;  3CME P;  2HFE D;  2O3J A;  2FYU E;  1LT9 B;  2ZAE B;  1AQT A;  2M8P A;  1FZF A;  4UB8 E;  3VP9 A;  2NZ2 A;  1PP9 J;  3P7K A;  3MUD C;  5AVR B;  1M57 D;  1NYH A;  1EDL A;  2OYH C;  1MFZ A;  2FQ1 A;  2IZ1 A;  4R4M A;  2UWJ E;  3FWL A;  2QEX P;  3SWY A;  3B5N B;  3JSV C;  2WPQ A;  2I1J A;  2IYO A;  2K9J A;  5CHX A;  3DS4 A;  2ZT9 D;  2AFD A;  3CCR P;  1S5L H;  3H1I G;  1TU3 F;  3CC7 P;  1SQX J;  3BAS A;  1JUN A;  1BGY E;  1LTA C;  1BE3 J;  3AEA C;  3RK2 D;  3M91 A;  1N73 A;  4L75 A;  5E79 E;  1RQV A;  3BCC G;  3B4S A;  1FZG A;  2XV5 A;  1LT9 C;  4HKG A;  1AV1 A;  2YKP A;  4WY4 A;  5KP6 B;  2J59 M;  2YXQ B;  1VQN P;  2XZ0 D;  1YJW P;  3H47 A;  2KR5 A;  2FKW B;  3BAT A;  1E0H A;  1IFI A;  4WWI A;  1KB9 H;  2L4B A;  1ZW0 A;  3L74 E;  4KT0 J;  2AXT H;  3G6E P;  2W6B A;  3Q1M A;  5CCG A;  4QNB A;  2BAS A;  5BU5 A;  2M8N A;  4GOF A;  3H1I E;  3S4R A;  1AFO A;  1FC2 C;  1KIL A;  3R2P A;  1YYC A;  1VQP P;  1N7S D;  1NKZ B;  2EHS A;  3V4W A;  5GTH E;  3KQG A;  2RKL A;  5F2O A;  2YMK A;  3GZL A;  1EZV D;  1KLP A;  4JBZ A;  2HOD A;  3CI9 A;  5EJD A;  1M1J A;  1VF5 B;  3NTE A;  1JCD A;  3K5B A;  4U0E A;  3L75 G;  1X3O A;  2R44 A;  2PY8 A;  1N73 B;  1ZRT E;  1EDI A;  4H2W C;  1WT6 A;  4PV1 B;  1M90 Q;  3AEF C;  3L73 G;  1R8E A;  2O1K A;  1W2E A;  4WY4 B;  3WBH A;  1RHZ B;  2JJL A;  3H1K J;  5KLV D;  1GU5 A;  3L71 G;  2WSS H;  1NTM G;  1H89 A;  3PP5 A;  1G1I A;  4IZ6 A;  1DEE G;  5APS A;  2KOQ A;  3FXE A;  2FVA A;  1IMQ A;  1Y47 A;  1VL2 A;  3A0H E;  1JTH A;  3GLM A;  4PJ0 H;  1OW7 A;  1VF5 C;  1NAF A;  1IK7 A;  1KMI Z;  1KV4 A;  2K88 A;  1VQK P;  3HD7 B;  1LTT C;  2GZJ A;  1JOC A;  2EIA A;  1NTZ G;  4D6T D;  4LC1 A;  1FDM A;  2Y0E A;  2PP6 A;  2E75 B;  4BPF A;  2DW3 A;  2HOD B;  4WY4 C;  2C9L Y;  1M1J B;  1UJZ A;  1BSH A;  1LTB C;  4H0L D;  2W8Z A;  3EJE A;  3HUS B;  4U7J A;  5DCK A;  5KLV K;  3CXH H;  1NGM B;  3RG2 A;  1L4A A;  1JY2 P;  1JY3 O;  3VOP A;  3O8Z A;  1Y9B A;  3B5I A;  2M8R A;  2WSF J;  1F80 D;  1BSN A;  2W6A A;  4LGD E;  3L72 G;  3HTK B;  2KOS A;  1USE A;  1KZU B;  1VQM P;  3HD7 C;  3CX5 I;  2M5A B;  2H8P D;  3S9O A;  3SSU A;  1SQX G;  1CSB A;  3DS5 A;  2LKI A;  1L0N E;  4H13 B;  2FAE A;  1S1C X;  3MP7 B;  3P05 A;  1EXJ A;  1T8K A;  4N6J A;  1BXI A;  2E75 C;  1FDO A;  2Y9Z A;  3U1A A;  3B71 A;  4TT3 H;  2A45 I;  2N6Y A;  5B5E E;  3CPW O;  1M1J C;  2YKQ A;  2AFE A;  1PP9 E;  2PEK A;  4IFD K;  3M0D A;  5APT A;  4AUW A;  1FJK A;  2Z46 A;  3HUS C;  3V5B A;  1IZN B;  2LIW A;  2IBZ E;  3E7K A;  1SQQ G;  1NU1 G;  1XTC C;  4WB4 A;  2B89 A;  1ZV8 A;  1SS1 A;  2KGD A;  1VQ5 P;  3VN0 A;  2KSJ A;  1SQX E;  3A7O A;  3B5N D;  4PD4 I;  4QKO A;  2JKV A;  1CZQ A;  4H13 C;  1BE3 E;  2QIW A;  1L4A B;  1SQB J;  3PTZ A;  5HGL A;  4RJT A;  2E5Y A;  4GR6 A;  3H1H J;  1GL2 B;  1S5L X;  2OQQ A;  1VQ8 P;  1HQB A;  3Q5R A;  2JEE A;  1PGJ A;  1RQU A;  1UNK A;  3H32 A;  1GK4 A;  1AYI A;  5APX A;  3VRL C;  1KYO I;  4HYT B;  2JU1 A;  1AVY A;  2QNW A;  1LP1 A;  3M9B A;  1K04 A;  2I8D A;  4NPD A;  2JQ4 A;  3Q2Y A;  3AE2 C;  1KQS O;  2Q6Q A;  2MD9 A;  3H1K G;  2KYV A;  5KLV J;  4BPH A;  3AEE C;  3MD0 A;  2GZI A;  1Z56 A;  1L4A C;  4DOJ A;  3KHU A;  1QEX A;  1GL2 C;  4WBA A;  3G1I A;  3CCM P;  1HTL C;  1R5S A;  2L5G B;  2CQ8 A;  1GU4 A;  3P8M C;  3G71 P;  2FAC A;  2K9Y A;  1DIP A;  2QSI A;  2YO3 A;  5B66 E;  2DGY A;  2AXT E;  2R3S A;  2QA4 P;  3BCC J;  1W5C E;  2Y0C A;  2L0Q A;  3E2D A;  1ZNV A;  1AUM A;  2M3B A;  4XFZ A;  1CI6 A;  1FU1 A;  4IFF A;  2KZI A;  4N3Y B;  3T97 A;  1ZN5 A;  1Q90 D;  2GZF A;  2KGC A;  3G21 A;  1L0H A;  3PRJ A;  1VF5 D;  2WSC J;  3A5T A;  4D6T J;  2K1A A;  3A0H H;  5KKZ B;  2CPS A;  3JCU E;  5AVU B;  3AE8 C;  3H1K E;  3MUD A;  1Q81 Q;  3FXD A;  3HE4 B;  2OYH A;  2LR2 A;  1JB0 J;  4PV1 D;  2KW2 A;  3GW6 A;  2P67 A;  4JF7 A;  1NAY A;  4NPE A;  1CW5 A;  4WY4 D;  2QJY C;  2XT1 A;  1LT1 A;  3RBZ A;  3H1J D;  1FZA A;  3GMA A;  1K8A Q;  1SQV D;  2E1M A;  1DEB A;  3CX5 D;  3E1R A;  1G2C A;  2OGU A;  2IX7 C;  3TGU D;  4UB6 E;  5CCG D;  1MFT A;  4I6M C;  1EMV A;  1BDD A;  3N4X A;  1RH5 B;  1EZV I;  3RK3 E;  2WSE J;  2BQ1 E;  1PZQ A;  1SQP E;  2KXP B;  3MTU E;  5KKZ C;  1KIL D;  4MN4 C;  5AW4 B;  2EFJ A;  3VP8 A;  3KZI H;  2KOP A;  3L75 J;  2K2Q A;  1LNQ A;  5KJ7 C;  1T6A A;  1N7L A;  2PEQ A;  1M56 D;  3KDP B;  5AVQ B;  4BWN A;  2N6Z A;  2CK3 H;  2E42 A;  2KB7 P;  2ZYD A;  3EFG A;  2E75 D;  1S72 P;  1OW6 A;  1T3U A;  1X8Y A;  4PJ0 E;  2IYP A;  3ZDM A;  1JY3 N;  2C9N Y;  1NTM J;  3E1I A;  2H7H A;  4U0A A;  3P8C E;  3V2Q A;  5B5E H;  2WPT A;  3HYB A;  5HV8 A;  3VMX A;  3H6P A;  2OYH B;  1VQ6 P;  4I1L A;  1LGH B;  3PHL A;  1KQG B;  1FAV A;  2JGP A;  3H4E A;  4CPG A;  2OAR A;  2OTK E;  2B9B A;  2BEQ D;  1P84 H;  2D2C D;  1SQV K;  2JWD A;  1SP4 A;  5I4T G;  1PL5 A;  3P32 A;  2IDB A;  1H8A A;  2RMZ A;  3CWB D;  1EZV G;  1GDT A;  1AQ5 A;  1OMI A;  3G1G A;  4H13 D;  4ZMD A;  1NTZ J;  2XND H;  2A06 E;  4U3F D;  4BRY B;  4PH0 A;  1IUQ A;  1NQ4 A;  2N1T B;  3VMY A;  1KYO D;  1JM0 A;  2AF8 A;  3S1K A;  1M8O B;  5CMZ A;  3O6Q A;  2POH A;  5M1B A;  2BHV A;  5KLV G;  3L70 D;  1HBW A;  1FOS F;  1BCC D;  2AEM A;  2M0B A;  1NHL A;  2FXO A;  1PEQ A;  1YTZ I;  2KZJ A;  3L72 J;  1SQB E;  1NKN A;  4IL6 E;  3H1H E;  2VLP A;  5DJU B;  3U1C A;  4GT1 A;  1Z6M A;  1T2K C;  5EFW B;  3G0V A;  2JP3 A;  1L4A D;  2KK7 A;  3V2R A;  1HGZ A;  4ZNC A;  2GM4 A;  3Q5P A;  4DCK A;  1URQ B;  2N1T C;  4Y28 J;  2RH0 A;  3EJB A;  1ZME C;  4D6T G;  4U0B A;  1QLE D;  2FXP A;  2JBG A;  4ASV A;  1X22 A;  3SWK A;  5KLV E;  1GMJ A;  1SQQ J;  2QM8 A;  1NU1 J;  5B66 H;  2KP8 A;  1NTK D;  3WUU A;  3FWN A;  4COC A;  2YIU B;  4COP A;  3CXH D;  1RO2 A;  3C9I A;  3O6Q B;  3MIW A;  2V7Q J;  2M5R A;  5EW5 E;  3JCU H;  2FYU D;  3M06 A;  3H1J J;  3HD7 A;  2KOG A;  1QVG O;  1E5W A;  3GF3 A;  3SWF A;  2C0X A;  2KOR A;  2N5H A;  3BCC E;  3HE5 A;  1K30 A;  4M0I A;  1URQ C;  3G9R A;  2E43 A;  2MKV A;  2W90 A;  2WPV B;  4D6T E;  2O01 J;  1X0T A;  4JYB A;  3M0A A;  5CCH C;  3AE9 C;  3GKL C;  2L9F A;  2YKO A;  2WMM A;  1X9V A;  1EXI A;  4EI2 A;  3HUS A;  4UB6 H;  3C8V A;  5HGO A;  3BRV B;  1SLQ A;  2YIU C;  1BGY D;  3TF5 A;  3CCQ P;  1XTG B;  3VMA A;  1NTK K;  3HTK A;  3TSI A;  4O9B A;  4F37 A;  3WUT A;  4RKU J;  2M5A A;  2PEN A;  1EIA A;  1VQL P;  1YQ3 C;  2FXM A;  1VHN A;  1GW4 A;  2FYU K;  5AVY B;  3B8E B;  2IBZ I;  3L74 D;  3IF4 A;  2KNC A;  2L22 A;  2V4H A;  1MZ8 A;  2X2B A;  3L75 E;  2KGE A;  2WSF H;  2J5U A;  5K5G B;  2XZ1 C;  2HPC A;  3HE5 B;  2BCC D;  4IPY A;  5AVV B;  3L73 E;  1FR2 A;  2E5T A;  4U3F J;  4R4L A;  4U0D A;  3U59 A;  5BS1 A;  2WPS A;  3L71 E;  3DS2 A;  1HH0 A;  1D7M A;  2KS1 B;  1NTM E;  5AW3 B;  2FQ2 A;  4GOD A;  1JMB A;  3CC4 P;  1H0T B;  3MHV A;  2NO8 A;  2GZG A;  4C46 A;  3A3Y B;  3D6Y A;  3WU2 E;  2O01 N;  2FVE A;  4L74 A;  1QGK B;  4OGQ B;  3L70 J;  1RO0 A;  1ZRT D;  5KTB A;  1JCC A;  3KZI E;  5AW8 B;  1KQL A;  3W68 A;  2BUO A;  1GL2 A;  4IFM A;  4L76 A;  1YI2 P;  4BPG A;  1OIP A;  1NOH A;  2AEF A;  3WMM 0;  4N78 E;  4RO0 A;  2ZJS E;  1YIJ P;  1KN7 A;  4Z1M H;  2R3C A;  1FZC B;  1NTZ E;  3ITK A;  3IFM A;  1EDJ A;  2B87 B;  2KNC B;  5AW9 B;  3V2N A;  3B4Q A;  2DNW A;  4IL6 H;  2PEO A; 
#chains in the Genus database with same CATH homology
 3G21 A;  3CCE P;  4XFY A;  3I56 P;  2L6E A;  2EIA A;  1Q82 Q;  2PEI A;  1PEU A;  1VQ4 P;  3H4E A;  2OAR A;  4U0B A;  5F2N A;  4GR2 A;  1ZMB A;  2KOD A;  1JJ2 O;  1VQP P;  2CWO A;  3CME P;  3CCU P;  1YHQ P;  2Z45 A;  1Q81 Q;  3G4S P;  5HGL A;  5I4T G;  4U0F A;  2M8P A;  5F2K A;  5F2O A;  1YJN P;  3HZQ A;  4GR6 A;  3DS1 A;  4COC A;  1YJ9 P;  1VQ7 P;  2PEJ A;  1KD1 Q;  1VQ8 P;  3G29 A;  1M74 A;  4COP A;  2P9X A;  1RO2 A;  1N8R Q;  3M1M A;  5DCK A;  3G1G A;  4IPY A;  4XFX A;  2XT1 A;  1KC8 Q;  2OTL P;  5HGN A;  2JO0 A;  1Q7Y Q;  2QEX P;  3G26 A;  4U0D A;  1M6N A;  1Q86 Q;  3NTE A;  4PH0 A;  1IUQ A;  1K8A Q;  5BS1 A;  1QVG O;  4U0C A;  3B5I A;  4U0E A;  2EG5 A;  3DS2 A;  2E1M A;  3DS0 A;  2PY8 A;  1BAJ A;  3VRL C;  3OW2 O;  3I55 P;  3DS4 A;  1VQM P;  5HGM A;  1NJI Q;  3CCR P;  1D1D A;  3CC4 P;  1M90 Q;  1K30 A;  3DPH A;  1M6E X;  4M0I A;  2XV6 A;  5JPA A;  3CC7 P;  3CC2 P;  1A43 A;  3H0D A;  1M1K Q;  3DS5 A;  1RNI A;  3CCS P;  1KQS O;  1A8O A;  3WBH A;  2BQ1 E;  3P05 A;  2BHV A;  5BS2 A;  1QVF O;  1EOQ A;  1RO0 A;  3LRY A;  3G28 A;  3DTJ A;  2EFJ A;  1E6J P;  2Z44 A;  1PEO A;  2XXM A;  1PEQ A;  3CPW O;  2BUO A;  3Q20 A;  1PEM A;  3CCL P;  3MGE A;  1YI2 P;  2JYL A;  1VQO P;  2PEQ A;  3CD6 P;  3CXC O;  1W2B O;  2PEK A;  4WYM A;  5HGO A;  1K73 Q;  3G1I A;  3CCM P;  3CMA P;  1VQN P;  4XRQ A;  2OTJ P;  1YIJ P;  1YJW P;  1S72 P;  3H47 A;  3G71 P;  2Z46 A;  1K9M Q;  3CCJ P;  3G0V A;  3CCQ P;  2M8L A;  3DS3 A;  3CCV P;  2ONT A;  2DGY A;  1VQK P;  4U0A A;  2QA4 P;  3G6E P;  4XRO A;  4QNB A;  3E2D A;  3HYB A;  1AUM A;  2JYG A;  4XFZ A;  4PH1 A;  2PEN A;  1YIT P;  1QRJ A;  1EIA A;  2M8N A;  1VQ6 P;  3RG6 C;  2LF4 A;  1VQ5 P;  1VQL P;  2PEO A;  1VQ9 P;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...