1YJWP

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S RIBOSOMAL RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjwP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjwP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjwP02
3I56P 3CC4P 1VQKP 2OTLP 3CPWO 1K73Q 1YJWP 3CCLP 1KD1Q 1K8AQ 1M90Q 1VQ6P 1VQ5P 3CXCO 3CC2P 1Q7YQ 1YHQP 3G4SP 3CCSP 3G71P 1YJ9P 3CCRP 1VQ7P 3G6EP 3CCJP 1N8RQ 2OTJP 3CMEP 3CCUP 1YI2P 1YIJP 2QEXP 1W2BO 1VQMP 3CCMP 1YITP 1YJNP 3CCQP 2QA4P 1VQ8P 3CCEP 3CD6P 1VQLP 3CCVP 1VQOP 1S72P 3CC7P 1Q82Q 3I55P 1KC8Q 1VQPP 1Q81Q 3CMAP 1Q86Q 1NJIQ 1QVGO 1VQNP 1QVFO 1M1KQ 1KQSO 3OW2O 1K9MQ 1VQ9P 1JJ2O 1VQ4P
chains in the Genus database with same CATH superfamily
3O6QB 1NTKG 4UHPB 2YKQA 1LTJA 1KILD 1A8OA 3GZLA 1AA0A 2GZGA 3H0DA 4JYCA 4IL6H 1N2DC 5E79E 4LGDE 1FR2A 1IZNB 1L4AA 1NO4A 4H13D 5CCHC 4BPFA 1NTZG 2PRRA 2M5RA 2V4HA 1FDMA 5KAFE 3ABVC 1HH0A 2PEJA 3RG6C 2ZVOB 3G6EP 1S1CX 5CBNA 1NU1J 5B5EE 2P9XA 3M9QA 2PEQA 2LXBA 1DV5A 2KWLA 3B8EB 3D6ZA 1ZMEC 2M3EA 2B88A 3A5TA 1S3JA 1X0TA 3L35A 4MRTC 1DEBA 4U3FE 2Y0EA 1HBWA 2R5BA 2JYGA 3RK2B 3GKLC 2AFEA 3Q5PA 3H1KJ 1OXZA 4BPHA 2GDWA 1J1EB 2NPSB 4PD4I 2VLPA 1EDJA 4AYCA 2QM7A 2KGAA 1BE3E 3CC4P 2CQ8A 1J2JB 2AEMA 4XFYA 2KG9A 1PEQA 2E76C 2L0QA 2ZVNB 1OW6A 2QG4A 1IO4A 2XV6A 4EDFA 5CJ4A 2FYZA 5AVSB 2K3RA 5F2NA 1UIXA 3TGUD 1AF8A 2YXRB 1KQSO 1KQFB 2M8LA 2C0XA 2J5UA 2WTYA 5L8RJ 2HPCA 2W6JH 5H2FH 1N8RQ 2Z5HA 3L70G 1S2EA 3CMEP 5AVWB 2FYUK 3F89A 2C9LY 1KYOD 2E74D 2CG5B 1ZXGA 3GJNA 1D7MA 2QM8A 5CCHD 1IK7A 3JSVC 1SFCC 4YTPC 2BUOA 1E6JP 5EJDA 3RL0B 3Q5SA 2Q3IA 1JY2O 5HV8A 4KJMA 2E42A 1GW4A 2ZYGA 3E1RA 2ERHA 1YQ3C 5AVTB 2FQ1A 3GHGB 1SP4A 2Z46A 1P84D 1NOHA 1L4AB 5KJ7D 1SQVE 2OTJP 1NKNA 1N73C 2CPSA 2NO8A 1LWUC 2XZ1C 4W80A 1Q82Q 1U57A 4R4MA 2D2CC 2H89C 2Q1KA 3V2RA 1AYIA 2K93A 3B4QA 2FKWB 1ZRTD 1X9VA 4PV1C 1IJDB 2P2UA 2VLQA 4IFDK 2MJZA 4COPA 2BEQD 1G1JA 3MUDC 4OH8B 1T3UA 4MN4C 3TNUB 3BCCG 2WQYC 2IYOA 1GU4A 4NEOA 1SQVG 2FQ0A 3MHVA 1HTLC 2FYUD 2QRXA 1L0LJ 5AVUB 3M0DA 5AW2B 2QJYB 3CCVP 1ZN5A 2L91A 3V2QA 2EHTA 3RK2C 2P10A 1GU5A 4GOEA 4WWIA 4PH0A 1VQKP 5DJUB 1L0NG 3AECC 1FZAA 2IYPA 2AVAA 2Y9ZA 3T97B 4W7YA 4K35A 3VP8A 1SQVD 2JR8A 1EDLA 4W7ZA 1NU1G 2OYHA 1JO5A 3AE1C 1P84I 1LTBC 2CGQA 1NKZB 3H32B 2KNCA 3P32A 3CCJP 2FBWC 2BEZF 3HYBA 3SWYA 3HE5B 1YJNP 1SFCA 3WBHA 2JO1A 3NXSA 3AE4C 2KG6A 2XNXA 1MKMA 3A0BE 2PY8A 3WUUA 3G0VA 1X8YA 4M0IA 5CHXA 3H6PA 1LNQA 1NTMG 1YHQP 5EW5E 2PGDA 2OQQA 4YPCA 1QRJA 1YITP 5AW8B 1IFJA 2QJYC 2H43A 2H7HA 2E1MA 2O3JA 3D6YA 1HWTC 3H1HD 1BGYG 5AW0B 4N78D 3O8ZA 1SQXJ 1HGVA 1YJ9P 2KOGA 2Z4EA 1WRGA 3TDKA 1FZFA 3D70A 2GYKA 1L0LE 5HGLA 2KB7P 1W2EA 4H13C 3SFDC 3Q3DA 1Y47A 1RH5B 1L0LG 1LTIC 2A45I 3V5BA 1H8AA 4Y99C 1KILE 1ZLLA 4XFJA 1X79B 2Z44A 2GM4A 1BGYE 1XTCC 1PZQA 1ZOYC 1S5LH 4H2WC 3E2DA 2GZIA 1K04A 3SWFA 3M06A 2GZFA 1K05A 3ZDMA 3Q1MA 4PJ0E 2O01J 1EDIA 1NVOA 1LGHB 3L75G 1L0LD 3L37A 1RE3A 3WU2H 1A02F 3KZIE 3S4RA 4GR6A 2QJKC 1QEXA 4CPGA 2FACA 3CCSP 4U3FJ 2LL8A 1DD3A 4WY4A 5TISE 3CX5I 1LT1A 1NTKK 1AV1A 3OJAB 1CI6B 1KD1Q 3G21A 1BE3J 3R2PA 4RO0A 4KHXA 2GA1A 3H1ID 3G29A 2LIUA 1E79H 2MD9A 1RQUA 2P1JA 1SS1A 2M0BA 1HQBA 3CCEP 2K94A 3NMDA 5GTHH 2FXPA 1IFDA 1BDCA 1E0HA 3W67A 1FZEA 3GF3A 2G8YA 1GTWA 4WY4D 3L4FA 1Y9BA 3IAOA 1K30A 2ZAEB 5AVVB 3A0BH 2WWWA 2E74C 3LW5H 2L4BA 3AEGC 2JGPA 2LTEA 3KHUA 1X3OA 3V2NA 3H1LD 1EZVG 1BCCD 3U59A 5KP8B 1K8AQ 1N7SA 1JY2N 4H44C 2K0XA 3RL0D 1L0IA 1PFIA 3L74J 1NWQA 1SQQG 2A06D 1QGKB 3V6IA 3I56P 1ZR2A 2HYNA 1NU1D 3D71A 2AXTE 3OA7A 1GL2D 1LTSC 2LXCB 2AF8A 2N6YA 2XZ0D 2OTKE 4M3LA 1JTHB 2C0WA 1Y8AA 2IPPA 1SQXK 1F80D 1KQGB 3P8CE 1N7SD 1NJIQ 3Q5RA 1N7LA 3CXHD 2OYIC 2JAZA 1DX7A 2Z5IA 3EFFK 3G71P 2ZT9C 4JPZB 3TNUA 2ZYAA 4L76A 1NU1K 1T8ZA 2ZJSE 2YMKA 2NPSD 4RJTA 3HTKA 5APWA 1IFNA 2ZXXA 2WMMA 7CEIA 4ASWA 1M1JA 2YXQB 3CCUP 2FXOA 2OYIB 2A06E 3BRTB 2MY5A 2R5DA 1PPJE 1BE3D 4HKZH 3MTUE 1JY3P 3CXHI 2ZXEB 3RL0g 2QNWA 3MIWA 1WT6A 4PWVB 3OAKA 1RO0A 1T3JA 4IFMA 4BXLA 1BSNA 2P7JA 1Z56A 2K88A 5KLVJ 1SQPE 2LPKA 2V7QJ 1YTZI 4AUWA 2N5HA 1FZBA 4EI2A 4UB8E 1SQPG 1A43A 5APTA 1GMJA 5I4TG 1OMIA 1S9KD 3TF5A 1NTME 1EZVD 3AEAC 4EOTA 1D1DA 2OTLP 2GUSA 1Q2NA 4IZ6A 3DTJA 3KZIH 1L0HA 1BE3G 5APSA 4OGQC 3LRYA 2XXMA 5KLVD 1FE6A 2XKMA 1DIPA 3CWBJ 1QVGO 2RMZA 4U3FG 1GL2B 4C46A 5B66E 2I1KA 1HF9A 1DD4A 5KLVK 2LIWA 3UIAA 2HODA 2WITA 3A0HE 3H1IG 2JU1A 3N7NA 3CX5E 2PEKA 3NFQA 4Y28J 3E7KA 1VDFA 2KLUA 1SQPJ 4RKUJ 2P58A 1SQBJ 1ZR4A 4PV1B 1HGZA 1AUMA 1JY3N 2NPSC 5AW7B 1JM0A 1URQB 3AEBC 5AVYB 4COCA 4BPGA 1RQVA 2JYLA 2IFMA 3IFMA 1S9KE 1CZQA 3H1LJ 2FFDB 2WSFH 1FDIA 5CBOA 1FJKA 1MZ8A 2ROQA 4WBAA 1SQXG 5E79H 5KLIC 5KLVE 1DEEG 3CWBE 1BCCG 1HJ0A 2YO2A 2POHA 4C7RA 2HG5D 1HY8A 2G3AA 1PP9E 2O01N 4EIJA 2VRSA 5APYA 3EJBA 1KC8Q 1NTMJ 2KYVA 4N6JA 4PD4H 2LOLA 1VQ4P 4I7ZB 5CJ0A 1GDTA 2E75B 3AE6C 2OYHC 4D6TJ 5TISH 3FWLA 1KB9H 3NTEA 3L70E 2JP3A 2WT7B 3H1HJ 2JO0A 3A2AA 2P67A 3VYIA 5KKZC 3OW2O 2N5IA 2A45G 3H1LG 3H32A 1RF0A 1RE4A 2LKMA 3CWBG 4AQRD 1AQTA 3WU2E 3H1JD 3P8MC 1QL1A 1W5CE 2MVUA 4I6MC 1SQQD 3KQGA 3DS5A 1VQLP 1S72P 1IMPA 5EFWB 1H88A 3H1KD 2GZEA 3HUSA 3CCLP 5APXA 3G1GA 2N9YB 2UWJE 3AEEC 3GHGC 1LT9C 4A7PA 2M3BA 4NPEA 5BU5A 1U7JA 1HVVA 2YMYA 1K9MQ 1EC5A 3B5ND 1KILA 3H1HE 1KFMA 4H44D 2RH0A 4C7NB 2O01H 4H44B 1A02J 1YJWP 1P84E 1UNKA 1OFCX 2WPQA 1FBMA 4CA3A 2FYUG 2QJPB 2FVFA 5KP7B 1SFCD 4IOIH 2LMLA 1G2CB 1PP9J 3EFGA 1J1EC 1EDKA 2FYNB 1N73A 5AVQB 1DNYA 3HUSB 4NPDA 3SSUA 3G28A 3C1LA 3CI9A 1OZHA 5KJ7C 5HGNA 4JYBA 1EOQA 4QNBA 4XE5B 1MZ9A 1NTKD 4JQ0D 3Q20A 1SQBK 2E5TA 1W2BO 1M74A 3CE7A 1N86A 2SPZA 3AE5C 1DH3A 2D2CD 3L74G 2H88C 2IZ1A 2KGEA 2PNGA 3BATA 2E76D 5APQA 3GG2A 2EIAA 3O6QA 3VN0A 3M9BA 2M5AB 1RF1C 3CL3D 4PV1D 3BASA 1EZVI 5KAIH 4DCKA 5HGOA 1KYOI 3VOPA 4D6TD 5F2OA 4EYYQ 3EJDA 1VQMP 3M91A 1LT9A 2PENA 5CCGC 4XA4A 1RY3A 1PEUA 1GW3A 3JC22 4ZMDA 1GPJA 1SQQK 4H2YC 2O1JA 1SQQJ 3FX0A 2YNYA 1Q7YQ 1KILB 5KAFH 1S4XA 3GHGA 4BWNA 1EXJA 1USDA 2VLOA 1BCCJ 3CCQP 5CCGA 4HJGH 2PAJA 3U43A 4U0DA 4TT3H 2M5AA 3CPWO 2D2CB 2FQ2A 1JNMA 4GKGA 5DCKA 5AW1B 3VRLC 2BASA 2L22A 2BHVA 1L0NE 4WY4B 4L75A 3B5NB 4YXDC 1EMVA 5CCHA 4U0EA 4TLFA 3RK3E 1UIIA 1NTKE 4XFZA 4QKOA 2E75C 3B5IA 1PPJG 2FAEA 2KOPA 4Y99B 3U1CA 2B87B 4OGQD 4JF7A 1X22A 5KJ7A 1EZVE 1VF5D 2JWAA 3H1JE 2MF4A 1U7MA 1MFZA 1NGMB 4R4LA 3HZQA 1JUNA 5AW6B 1NTZD 1SQQE 2IBZD 4D6TG 2WT7A 1Q81Q 3USSA 3EJEA 1M1JC 4HYTB 4H0LD 2DNWA 2B89A 1FZCA 3L73G 2WPTA 1LTJC 1FZCC 1MUUA 2YKPA 2KG8A 2Q6QA 2J58A 3L74D 4H13B 3R4YA 2BQ1E 2QIWA 1JMMA 3CXHE 4HKGA 1LTGC 1FU1A 1MFTA 1PL5A 1JB0J 4IFFA 2VSQA 1L0NJ 4I1LA 3CX5D 1ZP0C 3H25A 3M0AA 1FS0E 1XTGB 4YXWH 3GF7A 3L71G 5BS2A 4GT1A 3JCUH 1NYHA 3GLMA 2WPVB 3B5NC 3M9HA 1LTJB 2WSCJ 2N98A 4R0MA 1LP1B 2H8PD 1GXHA 2QJPC 3MZWB 3L73J 4XRQA 3C9IA 1YTZT 1IC2A 2A06G 2IBZE 1M57D 5M1BA 3CXHH 2PEIA 2GZJA 2NRGA 1Q86Q 4UB8H 2K92A 2AXCA 2WZ7A 5BU8B 2B87A 4Z1MH 2O1KA 1PP9D 2Y0DA 1IFMA 4C7NA 5KKZB 1EQ7A 4LLHA 1VQ6P 3EWKA 1OW7A 1SQBE 3IN6A 3L73D 1GZLA 1JY3O 2KS1A 1VQ8P 3CD6P 1IUQA 2NZ2A 3FXDA 1LWUB 2W90A 3DS0A 3MGEA 1QVFO 4N78E 1VHNA 4U0BA 2Z45A 2WSEJ 2JDIH 1P84H 1FDOA 1ZV8A 1JY2P 5B5EH 1USEA 1CW5A 2JQ4A 3L70D 1KQLA 2QVAA 2N1TA 5CCGD 4BRYA 2K37A 4NPFX 2M8RA 2JBGA 1SQBG 1KFNA 1PGJA 3NY7B 1URQC 1KMIZ 1QX8A 4WY4C 2KGCA 1J1DB 5K5GB 5CMZA 3BCCJ 4O9BA 2E5YA 3HE4B 1PIXA 3P05A 1T8KA 2X2BA 3RK3C 3BCCD 3KDPB 1KLPA 3L73E 4WYMA 1S5LE 2KOQA 3HD7B 3H47A 3HE4A 4DG9A 2PEOA 4PH1A 3RL0C 3TYYA 3WUTA 1KORA 3NTNA 1OWAA 4GDOA 2K9JB 3CMAP 1SQBD 3G1IA 3PLNA 3P8CD 1ZNVA 1M1JB 3GMAA 3GZMA 2HLOA 3HTKB 5HGMA 2OYOA 2KXPB 2IZ0A 4IPYA 2WSSH 3CWBD 1N7SC 3AEFC 5DJTB 3II6A 3AE9C 2ZT9D 4H0LC 1M90Q 3ITKA 4DT0A 1VPCA 4ZKUA 2DW3A 4U0CA 2K9JA 1R8EA 1EIAA 1VQNP 3L72D 1JOCA 2E74B 2KSJA 3BVHA 2PEMA 3V2PA 4L74A 5BS1A 1RF1A 1UJZA 3CCRP 1T6AA 2B9BA 2KODA 1VKUA 3DS4A 3BCCE 1BCCE 5CZDB 1JCDA 4D6TE 1QLED 2FADA 5GTHE 5KTBA 1NTMD 1YBKA 3L36A 2WSFJ 1AQ5A 1AJYA 3RK3D 1IFPA 1BSHA 2IDBA 2NPSA 1OVUA 2K2QA 3LMOA 1LTTC 1KYOE 3L71D 3G9RA 1SQXE 2ZFCA 3MD0A 1M1KQ 1S5LX 1AVOA 1L4AD 1WMKA 2KUBA 1RE3C 4K3AA 4XFXA 2XU6A 2CWOA 1GK6A 2IBZI 1VQ7P 3H1JJ 3RBZA 1RHZB 3H1IE 4WB4A 3S1KA 1L0NK 2QSIA 2FXMA 2KW2A 5KAIE 1JEKA 1LT9B 3CC7P 2CPBA 3HD7A 3LW5J 4ZKPA 4ZNCA 5AW4B 3MP7B 1NTZJ 1NTZE 2HFED 3PHLA 3G4SP 1R5SA 2EHSA 4KT0J 3HD7C 1HUCA 1KB9D 2FYNC 2DGYA 3BRVB 3L74E 2PP6A 2KP8A 1KB9I 2R3CA 2ONTA 2KLVA 4U7JA 1PPJD 1URQA 1FZCB 1H89A 1LTAC 1AVYA 2CK3H 3RK3B 2KK7A 1PGOA 1NTKJ 2FY8A 2RKLA 1LWUA 1URQD 5APUA 1H0TB 2N1TC 2WPSA 3B4SA 3RBXA 1NQ4A 2GUVA 2E43A 1RF1B 2MVVA 1JJ2O 5HVCA 3RK2D 2KR5A 1K73Q 4DZOA 2Q3EA 4ASVA 1BXIA 1RO2A 2OGUA 2JB0A 3KPEA 1OR5A 3G26A 2AFDA 3PTZA 4PJ0H 1GK4A 3LIEA 1OVRA 2KORA 1GD2E 3F5HA 1KYOH 2RN0A 3L75J 2W27A 2KZIA 2JJLA 1LP1A 2N9BA 2LKIA 2FYUE 1YQ4C 3FWNA 5GTIE 1M7LA 2R44A 3P7KA 3H1IJ 1T2KD 1TU3F 3H1HG 1L0ND 5H2FE 3AEDC 1M6EX 3CLQA 3W68A 3I55P 3L75D 2FFDC 2JEEA 2Q9IA 1MV8A 4GIFA 2WSCH 1NU1E 5AVRB 2OARA 5BVZA 1IFIA 5KLVG 3E1IA 5APVA 2R3SA 1OIPA 1PEMA 1L2PA 3CCMP 1SFCB 3VMYA 3M0DC 2YKOA 1FOSF 3L71E 3L71J 1GXGA 2W6BA 2FVAA 3G3ZA 2VLNA 2JKVA 1NHLA 1EXIA 1CSBA 3H4EA 3PRJA 3L75E 1Z6MA 4RESB 5AVXB 2C9NY 4LC1A 4DOJA 2Y0CA 1NAYA 3L72J 4U0AA 3PJSK 2M8NA 1SVFA 2KGDA 3MUDA 4OVNF 1N73B 1RF0C 1IMQA 2KZJA 2KNCB 3FGAD 4L73A 1NH4A 2HPCB 2FFDA 1KTMA 3DS2A 1BGYD 2FHSC 1L4AC 2XNDH 1GL2A 2GDXA 1LJ2A 1GL2C 4F37A 1ZRTE 1YI2P 2LR2A 1VF5C 1T2KC 2WSEH 4GOFA 3SFEC 2KI7B 5C39A 4DJGA 5F2KA 3H1KE 3TGUG 3H1JG 3A3YB 1FOSE 1JCCA 4PD4E 2XDJA 3S9OA 2QJKB 3TGUE 3LIDA 2KOSA 3L72E 3MGNA 1OX3A 1L0LK 1Q90D 1VQOP 2E76B 2BCCG 3HD7D 3VMXA 1SQVJ 4PXHB 2XT1A 3U1AA 2GDYA 5KP6B 2I8DA 2KSEA 1PEOA 2BCCJ 2OYIA 3GW6A 4PD4D 2N6ZA 3HE5A 2N1TD 1VQPP 2ZYDA 5AW5B 4QMAA 4H2XC 3L70J 2WPRA 4OWFA 3AE7C 3V4WA 2BCCD 4GR2A 1CI6A 3IR9A 2OYHB 2AEJA 1PP9G 3CC2P 5TJHA 3CX5H 2IBZG 2YIUB 1BAJA 1YIJP 1H0TA 3B5NA 2EG5A 2QA4P 3QH9A 3VP9A 1NTZK 3DS3A 2XZRA 2AXTH 4UB6E 2MKVA 1VQ9P 2LF4A 1OW8A 3L72G 4I7ZC 2KOOA 3H1LE 2E75D 5AVZB 3AE3C 2MR7A 5KLIB 2YO3A 2W8ZA 1ZW0A 1SQXD 3N4XA 2K5XA 1AFOA 1FC2C 2M8PA 1R5LA 2IX7C 1G2CA 1JTHA 1BGYJ 1BDDA 1M8OB 4HB1A 2HR3A 3I5CA 1SQPK 2Q5UA 3C8VA 2W83C 1M56D 3HRNA 3TGUJ 1QL2A 2L6EA 3K5BA 5JPAA 4JBZA 4U3FD 2JU2A 1CEIA 1NTMK 3VTPC 2YIUC 2K1AA 3RG2A 1KV4A 2EFJA 5GTIH 3Q2YA 4H0LB 1NAFA 2Y9YA 2HODB 3A7OA 2R32A 1ACPA 3B71A 1HJBA 4N3YB 2N50A 2K0YA 1KB9E 1KILC 2V7QH 3DS1A 1JMBA 4HH2A 3QWOC 2KIKA 3WUVA 2PFXA 1YYCA 2J59M 1M6NA 2BCCE 2IFNA 2ZT9B 1ZMBA 2XV5A 2QE7H 3KXDA 1VF5B 3FXEA 5B66H 2Q7CA 3HUSC 1N7SB 2I1JA 4UB6H 3PH0A 4XROA 3M1MA 4BRYB 2CNRA 1RNIA 2K9YA 5AW9B 1RE4C 2N1TB 2A45H 1PGPA 3RGUA 4B86A 1OVVA 1IK9A 3H1KG 3WMM0 3T97A 1KN7A 2L5GB 3EQ2A 3AE2C 1SLQA 3TSIA 3DPHA 1PGQA 3V4QA 1J1DC 2FYUJ 2ITAA 4GODA 3SWKA 1VQ5P 1KZUB 3PP5A 2L9FA 2AEFA 3KYQA 4IL6X 1SQVK 4I2LC 1FAVA 1VL2A 2KS1B 2K0DX 2JWDA 3JCUE 4IL6E 1SQPD 2W6AA 1FJPA 5AW3B 4WVZA 2WVRA 2MR8A 3VMAA 3CXCO 3AE8C 2FVEA 1FZGA 3A0HH 2QEXP 1PV3A 4U0FA 4OGQB 3IF4A 1E5WA 1G1IA 3TK1A 3VMZA
chains in the Genus database with same CATH topology
1AUMA 2ONTA 2M8LA 2PEMA 3CCLP 3DS1A 1PEOA 5BS1A 3G1GA 1Q7YQ 4COCA 1YJ9P 1K30A 3CCRP 1N8RQ 1A8OA 2JYLA 3H4EA 5BS2A 3CMEP 3CCUP 1M6NA 2KODA 3DS4A 5HGLA 3H0DA 3CCQP 1ZMBA 3CCVP 1VQPP 4U0AA 4U0DA 2Z44A 1K9MQ 3P05A 1JJ2O 4PH0A 1VQKP 3CPWO 1RO0A 1K73Q 4GR2A 4XROA 1YJWP 3M1MA 2M8NA 4WYMA 1K8AQ 4XRQA 2PEJA 3CC2P 1RNIA 5DCKA 2BUOA 3RG6C 1E6JP 3H47A 3VRLC 3G6EP 1BAJA 2PEOA 1YIJP 1RO2A 3E2DA 4PH1A 1A43A 2P9XA 2EG5A 2BHVA 2QA4P 2PEIA 5I4TG 3G26A 3DS3A 1KC8Q 2PEQA 4U0EA 3CMAP 1Q86Q 3G1IA 4XFZA 1M1KQ 3DPHA 3B5IA 1VQ9P 2LF4A 1VQ4P 1D1DA 3I56P 3DS2A 2OTLP 2Z46A 3G28A 3DTJA 5HGNA 4XFXA 1VQ6P 2CWOA 1EOQA 4GR6A 1VQ5P 3CCSP 4QNBA 5HGMA 1VQ7P 3CCJP 2OTJP 3LRYA 3NTEA 2M8PA 3Q20A 2XXMA 1YI2P 1W2BO 1M74A 2JYGA 3HYBA 3HZQA 2JO0A 1YJNP 1M6EX 1VQ8P 3WBHA 3CD6P 1IUQA 5F2KA 3CC7P 1Q82Q 3I55P 1Q81Q 1NJIQ 3DS0A 1QVGO 3MGEA 1QVFO 3OW2O 4IPYA 1KD1Q 3G21A 2PY8A 3CC4P 2EIAA 2OARA 3G0VA 4XFYA 4U0BA 2Z45A 1PEQA 2L6EA 4M0IA 5JPAA 1M90Q 3CXCO 1YHQP 3G4SP 3G71P 3G29A 2XV6A 5HGOA 1PEMA 5F2OA 2BQ1E 2QEXP 4U0CA 1QRJA 4U0FA 3CCMP 1VQMP 1YITP 2PEKA 2PENA 3DS5A 5F2NA 4COPA 3CCEP 2EFJA 1VQLP 1VQOP 1S72P 2DGYA 1EIAA 1PEUA 1VQNP 1KQSO 2E1MA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 P;  3CC4 P;  1VQK P;  2OTL P;  3CPW O;  1K73 Q;  1YJW P;  3CCL P;  1KD1 Q;  1K8A Q;  1M90 Q;  1VQ6 P;  1VQ5 P;  3CXC O;  3CC2 P;  1Q7Y Q;  1YHQ P;  3G4S P;  3CCS P;  3G71 P;  1YJ9 P;  3CCR P;  1VQ7 P;  3G6E P;  3CCJ P;  1N8R Q;  2OTJ P;  3CME P;  3CCU P;  1YI2 P;  1YIJ P;  2QEX P;  1W2B O;  1VQM P;  3CCM P;  1YIT P;  1YJN P;  3CCQ P;  2QA4 P;  1VQ8 P;  3CCE P;  3CD6 P;  1VQL P;  3CCV P;  1VQO P;  1S72 P;  3CC7 P;  1Q82 Q;  3I55 P;  1KC8 Q;  1VQP P;  1Q81 Q;  3CMA P;  1Q86 Q;  1NJI Q;  1QVG O;  1VQN P;  1QVF O;  1M1K Q;  1KQS O;  3OW2 O;  1K9M Q;  1VQ9 P;  1JJ2 O;  1VQ4 P; 
#chains in the Genus database with same CATH topology
 3O6Q B;  1NTK G;  4UHP B;  2YKQ A;  1LTJ A;  1KIL D;  1A8O A;  3GZL A;  1AA0 A;  2GZG A;  3H0D A;  4JYC A;  4IL6 H;  1N2D C;  5E79 E;  4LGD E;  1FR2 A;  1IZN B;  1L4A A;  1NO4 A;  4H13 D;  5CCH C;  4BPF A;  1NTZ G;  2PRR A;  2M5R A;  2V4H A;  1FDM A;  5KAF E;  3ABV C;  1HH0 A;  2PEJ A;  3RG6 C;  2ZVO B;  3G6E P;  1S1C X;  5CBN A;  1NU1 J;  5B5E E;  2P9X A;  3M9Q A;  2PEQ A;  2LXB A;  1DV5 A;  2KWL A;  3B8E B;  3D6Z A;  1ZME C;  2M3E A;  2B88 A;  3A5T A;  1S3J A;  1X0T A;  3L35 A;  4MRT C;  1DEB A;  4U3F E;  2Y0E A;  1HBW A;  2R5B A;  2JYG A;  3RK2 B;  3GKL C;  2AFE A;  3Q5P A;  3H1K J;  1OXZ A;  4BPH A;  2GDW A;  1J1E B;  2NPS B;  4PD4 I;  2VLP A;  1EDJ A;  4AYC A;  2QM7 A;  2KGA A;  1BE3 E;  3CC4 P;  2CQ8 A;  1J2J B;  2AEM A;  4XFY A;  2KG9 A;  1PEQ A;  2E76 C;  2L0Q A;  2ZVN B;  1OW6 A;  2QG4 A;  1IO4 A;  2XV6 A;  4EDF A;  5CJ4 A;  2FYZ A;  5AVS B;  2K3R A;  5F2N A;  1UIX A;  3TGU D;  1AF8 A;  2YXR B;  1KQS O;  1KQF B;  2M8L A;  2C0X A;  2J5U A;  2WTY A;  5L8R J;  2HPC A;  2W6J H;  5H2F H;  1N8R Q;  2Z5H A;  3L70 G;  1S2E A;  3CME P;  5AVW B;  2FYU K;  3F89 A;  2C9L Y;  1KYO D;  2E74 D;  2CG5 B;  1ZXG A;  3GJN A;  1D7M A;  2QM8 A;  5CCH D;  1IK7 A;  3JSV C;  1SFC C;  4YTP C;  2BUO A;  1E6J P;  5EJD A;  3RL0 B;  3Q5S A;  2Q3I A;  1JY2 O;  5HV8 A;  4KJM A;  2E42 A;  1GW4 A;  2ZYG A;  3E1R A;  2ERH A;  1YQ3 C;  5AVT B;  2FQ1 A;  3GHG B;  1SP4 A;  2Z46 A;  1P84 D;  1NOH A;  1L4A B;  5KJ7 D;  1SQV E;  2OTJ P;  1NKN A;  1N73 C;  2CPS A;  2NO8 A;  1LWU C;  2XZ1 C;  4W80 A;  1Q82 Q;  1U57 A;  4R4M A;  2D2C C;  2H89 C;  2Q1K A;  3V2R A;  1AYI A;  2K93 A;  3B4Q A;  2FKW B;  1ZRT D;  1X9V A;  4PV1 C;  1IJD B;  2P2U A;  2VLQ A;  4IFD K;  2MJZ A;  4COP A;  2BEQ D;  1G1J A;  3MUD C;  4OH8 B;  1T3U A;  4MN4 C;  3TNU B;  3BCC G;  2WQY C;  2IYO A;  1GU4 A;  4NEO A;  1SQV G;  2FQ0 A;  3MHV A;  1HTL C;  2FYU D;  2QRX A;  1L0L J;  5AVU B;  3M0D A;  5AW2 B;  2QJY B;  3CCV P;  1ZN5 A;  2L91 A;  3V2Q A;  2EHT A;  3RK2 C;  2P10 A;  1GU5 A;  4GOE A;  4WWI A;  4PH0 A;  1VQK P;  5DJU B;  1L0N G;  3AEC C;  1FZA A;  2IYP A;  2AVA A;  2Y9Z A;  3T97 B;  4W7Y A;  4K35 A;  3VP8 A;  1SQV D;  2JR8 A;  1EDL A;  4W7Z A;  1NU1 G;  2OYH A;  1JO5 A;  3AE1 C;  1P84 I;  1LTB C;  2CGQ A;  1NKZ B;  3H32 B;  2KNC A;  3P32 A;  3CCJ P;  2FBW C;  2BEZ F;  3HYB A;  3SWY A;  3HE5 B;  1YJN P;  1SFC A;  3WBH A;  2JO1 A;  3NXS A;  3AE4 C;  2KG6 A;  2XNX A;  1MKM A;  3A0B E;  2PY8 A;  3WUU A;  3G0V A;  1X8Y A;  4M0I A;  5CHX A;  3H6P A;  1LNQ A;  1NTM G;  1YHQ P;  5EW5 E;  2PGD A;  2OQQ A;  4YPC A;  1QRJ A;  1YIT P;  5AW8 B;  1IFJ A;  2QJY C;  2H43 A;  2H7H A;  2E1M A;  2O3J A;  3D6Y A;  1HWT C;  3H1H D;  1BGY G;  5AW0 B;  4N78 D;  3O8Z A;  1SQX J;  1HGV A;  1YJ9 P;  2KOG A;  2Z4E A;  1WRG A;  3TDK A;  1FZF A;  3D70 A;  2GYK A;  1L0L E;  5HGL A;  2KB7 P;  1W2E A;  4H13 C;  3SFD C;  3Q3D A;  1Y47 A;  1RH5 B;  1L0L G;  1LTI C;  2A45 I;  3V5B A;  1H8A A;  4Y99 C;  1KIL E;  1ZLL A;  4XFJ A;  1X79 B;  2Z44 A;  2GM4 A;  1BGY E;  1XTC C;  1PZQ A;  1ZOY C;  1S5L H;  4H2W C;  3E2D A;  2GZI A;  1K04 A;  3SWF A;  3M06 A;  2GZF A;  1K05 A;  3ZDM A;  3Q1M A;  4PJ0 E;  2O01 J;  1EDI A;  1NVO A;  1LGH B;  3L75 G;  1L0L D;  3L37 A;  1RE3 A;  3WU2 H;  1A02 F;  3KZI E;  3S4R A;  4GR6 A;  2QJK C;  1QEX A;  4CPG A;  2FAC A;  3CCS P;  4U3F J;  2LL8 A;  1DD3 A;  4WY4 A;  5TIS E;  3CX5 I;  1LT1 A;  1NTK K;  1AV1 A;  3OJA B;  1CI6 B;  1KD1 Q;  3G21 A;  1BE3 J;  3R2P A;  4RO0 A;  4KHX A;  2GA1 A;  3H1I D;  3G29 A;  2LIU A;  1E79 H;  2MD9 A;  1RQU A;  2P1J A;  1SS1 A;  2M0B A;  1HQB A;  3CCE P;  2K94 A;  3NMD A;  5GTH H;  2FXP A;  1IFD A;  1BDC A;  1E0H A;  3W67 A;  1FZE A;  3GF3 A;  2G8Y A;  1GTW A;  4WY4 D;  3L4F A;  1Y9B A;  3IAO A;  1K30 A;  2ZAE B;  5AVV B;  3A0B H;  2WWW A;  2E74 C;  3LW5 H;  2L4B A;  3AEG C;  2JGP A;  2LTE A;  3KHU A;  1X3O A;  3V2N A;  3H1L D;  1EZV G;  1BCC D;  3U59 A;  5KP8 B;  1K8A Q;  1N7S A;  1JY2 N;  4H44 C;  2K0X A;  3RL0 D;  1L0I A;  1PFI A;  3L74 J;  1NWQ A;  1SQQ G;  2A06 D;  1QGK B;  3V6I A;  3I56 P;  1ZR2 A;  2HYN A;  1NU1 D;  3D71 A;  2AXT E;  3OA7 A;  1GL2 D;  1LTS C;  2LXC B;  2AF8 A;  2N6Y A;  2XZ0 D;  2OTK E;  4M3L A;  1JTH B;  2C0W A;  1Y8A A;  2IPP A;  1SQX K;  1F80 D;  1KQG B;  3P8C E;  1N7S D;  1NJI Q;  3Q5R A;  1N7L A;  3CXH D;  2OYI C;  2JAZ A;  1DX7 A;  2Z5I A;  3EFF K;  3G71 P;  2ZT9 C;  4JPZ B;  3TNU A;  2ZYA A;  4L76 A;  1NU1 K;  1T8Z A;  2ZJS E;  2YMK A;  2NPS D;  4RJT A;  3HTK A;  5APW A;  1IFN A;  2ZXX A;  2WMM A;  7CEI A;  4ASW A;  1M1J A;  2YXQ B;  3CCU P;  2FXO A;  2OYI B;  2A06 E;  3BRT B;  2MY5 A;  2R5D A;  1PPJ E;  1BE3 D;  4HKZ H;  3MTU E;  1JY3 P;  3CXH I;  2ZXE B;  3RL0 g;  2QNW A;  3MIW A;  1WT6 A;  4PWV B;  3OAK A;  1RO0 A;  1T3J A;  4IFM A;  4BXL A;  1BSN A;  2P7J A;  1Z56 A;  2K88 A;  5KLV J;  1SQP E;  2LPK A;  2V7Q J;  1YTZ I;  4AUW A;  2N5H A;  1FZB A;  4EI2 A;  4UB8 E;  1SQP G;  1A43 A;  5APT A;  1GMJ A;  5I4T G;  1OMI A;  1S9K D;  3TF5 A;  1NTM E;  1EZV D;  3AEA C;  4EOT A;  1D1D A;  2OTL P;  2GUS A;  1Q2N A;  4IZ6 A;  3DTJ A;  3KZI H;  1L0H A;  1BE3 G;  5APS A;  4OGQ C;  3LRY A;  2XXM A;  5KLV D;  1FE6 A;  2XKM A;  1DIP A;  3CWB J;  1QVG O;  2RMZ A;  4U3F G;  1GL2 B;  4C46 A;  5B66 E;  2I1K A;  1HF9 A;  1DD4 A;  5KLV K;  2LIW A;  3UIA A;  2HOD A;  2WIT A;  3A0H E;  3H1I G;  2JU1 A;  3N7N A;  3CX5 E;  2PEK A;  3NFQ A;  4Y28 J;  3E7K A;  1VDF A;  2KLU A;  1SQP J;  4RKU J;  2P58 A;  1SQB J;  1ZR4 A;  4PV1 B;  1HGZ A;  1AUM A;  1JY3 N;  2NPS C;  5AW7 B;  1JM0 A;  1URQ B;  3AEB C;  5AVY B;  4COC A;  4BPG A;  1RQV A;  2JYL A;  2IFM A;  3IFM A;  1S9K E;  1CZQ A;  3H1L J;  2FFD B;  2WSF H;  1FDI A;  5CBO A;  1FJK A;  1MZ8 A;  2ROQ A;  4WBA A;  1SQX G;  5E79 H;  5KLI C;  5KLV E;  1DEE G;  3CWB E;  1BCC G;  1HJ0 A;  2YO2 A;  2POH A;  4C7R A;  2HG5 D;  1HY8 A;  2G3A A;  1PP9 E;  2O01 N;  4EIJ A;  2VRS A;  5APY A;  3EJB A;  1KC8 Q;  1NTM J;  2KYV A;  4N6J A;  4PD4 H;  2LOL A;  1VQ4 P;  4I7Z B;  5CJ0 A;  1GDT A;  2E75 B;  3AE6 C;  2OYH C;  4D6T J;  5TIS H;  3FWL A;  1KB9 H;  3NTE A;  3L70 E;  2JP3 A;  2WT7 B;  3H1H J;  2JO0 A;  3A2A A;  2P67 A;  3VYI A;  5KKZ C;  3OW2 O;  2N5I A;  2A45 G;  3H1L G;  3H32 A;  1RF0 A;  1RE4 A;  2LKM A;  3CWB G;  4AQR D;  1AQT A;  3WU2 E;  3H1J D;  3P8M C;  1QL1 A;  1W5C E;  2MVU A;  4I6M C;  1SQQ D;  3KQG A;  3DS5 A;  1VQL P;  1S72 P;  1IMP A;  5EFW B;  1H88 A;  3H1K D;  2GZE A;  3HUS A;  3CCL P;  5APX A;  3G1G A;  2N9Y B;  2UWJ E;  3AEE C;  3GHG C;  1LT9 C;  4A7P A;  2M3B A;  4NPE A;  5BU5 A;  1U7J A;  1HVV A;  2YMY A;  1K9M Q;  1EC5 A;  3B5N D;  1KIL A;  3H1H E;  1KFM A;  4H44 D;  2RH0 A;  4C7N B;  2O01 H;  4H44 B;  1A02 J;  1YJW P;  1P84 E;  1UNK A;  1OFC X;  2WPQ A;  1FBM A;  4CA3 A;  2FYU G;  2QJP B;  2FVF A;  5KP7 B;  1SFC D;  4IOI H;  2LML A;  1G2C B;  1PP9 J;  3EFG A;  1J1E C;  1EDK A;  2FYN B;  1N73 A;  5AVQ B;  1DNY A;  3HUS B;  4NPD A;  3SSU A;  3G28 A;  3C1L A;  3CI9 A;  1OZH A;  5KJ7 C;  5HGN A;  4JYB A;  1EOQ A;  4QNB A;  4XE5 B;  1MZ9 A;  1NTK D;  4JQ0 D;  3Q20 A;  1SQB K;  2E5T A;  1W2B O;  1M74 A;  3CE7 A;  1N86 A;  2SPZ A;  3AE5 C;  1DH3 A;  2D2C D;  3L74 G;  2H88 C;  2IZ1 A;  2KGE A;  2PNG A;  3BAT A;  2E76 D;  5APQ A;  3GG2 A;  2EIA A;  3O6Q A;  3VN0 A;  3M9B A;  2M5A B;  1RF1 C;  3CL3 D;  4PV1 D;  3BAS A;  1EZV I;  5KAI H;  4DCK A;  5HGO A;  1KYO I;  3VOP A;  4D6T D;  5F2O A;  4EYY Q;  3EJD A;  1VQM P;  3M91 A;  1LT9 A;  2PEN A;  5CCG C;  4XA4 A;  1RY3 A;  1PEU A;  1GW3 A;  3JC2 2;  4ZMD A;  1GPJ A;  1SQQ K;  4H2Y C;  2O1J A;  1SQQ J;  3FX0 A;  2YNY A;  1Q7Y Q;  1KIL B;  5KAF H;  1S4X A;  3GHG A;  4BWN A;  1EXJ A;  1USD A;  2VLO A;  1BCC J;  3CCQ P;  5CCG A;  4HJG H;  2PAJ A;  3U43 A;  4U0D A;  4TT3 H;  2M5A A;  3CPW O;  2D2C B;  2FQ2 A;  1JNM A;  4GKG A;  5DCK A;  5AW1 B;  3VRL C;  2BAS A;  2L22 A;  2BHV A;  1L0N E;  4WY4 B;  4L75 A;  3B5N B;  4YXD C;  1EMV A;  5CCH A;  4U0E A;  4TLF A;  3RK3 E;  1UII A;  1NTK E;  4XFZ A;  4QKO A;  2E75 C;  3B5I A;  1PPJ G;  2FAE A;  2KOP A;  4Y99 B;  3U1C A;  2B87 B;  4OGQ D;  4JF7 A;  1X22 A;  5KJ7 A;  1EZV E;  1VF5 D;  2JWA A;  3H1J E;  2MF4 A;  1U7M A;  1MFZ A;  1NGM B;  4R4L A;  3HZQ A;  1JUN A;  5AW6 B;  1NTZ D;  1SQQ E;  2IBZ D;  4D6T G;  2WT7 A;  1Q81 Q;  3USS A;  3EJE A;  1M1J C;  4HYT B;  4H0L D;  2DNW A;  2B89 A;  1FZC A;  3L73 G;  2WPT A;  1LTJ C;  1FZC C;  1MUU A;  2YKP A;  2KG8 A;  2Q6Q A;  2J58 A;  3L74 D;  4H13 B;  3R4Y A;  2BQ1 E;  2QIW A;  1JMM A;  3CXH E;  4HKG A;  1LTG C;  1FU1 A;  1MFT A;  1PL5 A;  1JB0 J;  4IFF A;  2VSQ A;  1L0N J;  4I1L A;  3CX5 D;  1ZP0 C;  3H25 A;  3M0A A;  1FS0 E;  1XTG B;  4YXW H;  3GF7 A;  3L71 G;  5BS2 A;  4GT1 A;  3JCU H;  1NYH A;  3GLM A;  2WPV B;  3B5N C;  3M9H A;  1LTJ B;  2WSC J;  2N98 A;  4R0M A;  1LP1 B;  2H8P D;  1GXH A;  2QJP C;  3MZW B;  3L73 J;  4XRQ A;  3C9I A;  1YTZ T;  1IC2 A;  2A06 G;  2IBZ E;  1M57 D;  5M1B A;  3CXH H;  2PEI A;  2GZJ A;  2NRG A;  1Q86 Q;  4UB8 H;  2K92 A;  2AXC A;  2WZ7 A;  5BU8 B;  2B87 A;  4Z1M H;  2O1K A;  1PP9 D;  2Y0D A;  1IFM A;  4C7N A;  5KKZ B;  1EQ7 A;  4LLH A;  1VQ6 P;  3EWK A;  1OW7 A;  1SQB E;  3IN6 A;  3L73 D;  1GZL A;  1JY3 O;  2KS1 A;  1VQ8 P;  3CD6 P;  1IUQ A;  2NZ2 A;  3FXD A;  1LWU B;  2W90 A;  3DS0 A;  3MGE A;  1QVF O;  4N78 E;  1VHN A;  4U0B A;  2Z45 A;  2WSE J;  2JDI H;  1P84 H;  1FDO A;  1ZV8 A;  1JY2 P;  5B5E H;  1USE A;  1CW5 A;  2JQ4 A;  3L70 D;  1KQL A;  2QVA A;  2N1T A;  5CCG D;  4BRY A;  2K37 A;  4NPF X;  2M8R A;  2JBG A;  1SQB G;  1KFN A;  1PGJ A;  3NY7 B;  1URQ C;  1KMI Z;  1QX8 A;  4WY4 C;  2KGC A;  1J1D B;  5K5G B;  5CMZ A;  3BCC J;  4O9B A;  2E5Y A;  3HE4 B;  1PIX A;  3P05 A;  1T8K A;  2X2B A;  3RK3 C;  3BCC D;  3KDP B;  1KLP A;  3L73 E;  4WYM A;  1S5L E;  2KOQ A;  3HD7 B;  3H47 A;  3HE4 A;  4DG9 A;  2PEO A;  4PH1 A;  3RL0 C;  3TYY A;  3WUT A;  1KOR A;  3NTN A;  1OWA A;  4GDO A;  2K9J B;  3CMA P;  1SQB D;  3G1I A;  3PLN A;  3P8C D;  1ZNV A;  1M1J B;  3GMA A;  3GZM A;  2HLO A;  3HTK B;  5HGM A;  2OYO A;  2KXP B;  2IZ0 A;  4IPY A;  2WSS H;  3CWB D;  1N7S C;  3AEF C;  5DJT B;  3II6 A;  3AE9 C;  2ZT9 D;  4H0L C;  1M90 Q;  3ITK A;  4DT0 A;  1VPC A;  4ZKU A;  2DW3 A;  4U0C A;  2K9J A;  1R8E A;  1EIA A;  1VQN P;  3L72 D;  1JOC A;  2E74 B;  2KSJ A;  3BVH A;  2PEM A;  3V2P A;  4L74 A;  5BS1 A;  1RF1 A;  1UJZ A;  3CCR P;  1T6A A;  2B9B A;  2KOD A;  1VKU A;  3DS4 A;  3BCC E;  1BCC E;  5CZD B;  1JCD A;  4D6T E;  1QLE D;  2FAD A;  5GTH E;  5KTB A;  1NTM D;  1YBK A;  3L36 A;  2WSF J;  1AQ5 A;  1AJY A;  3RK3 D;  1IFP A;  1BSH A;  2IDB A;  2NPS A;  1OVU A;  2K2Q A;  3LMO A;  1LTT C;  1KYO E;  3L71 D;  3G9R A;  1SQX E;  2ZFC A;  3MD0 A;  1M1K Q;  1S5L X;  1AVO A;  1L4A D;  1WMK A;  2KUB A;  1RE3 C;  4K3A A;  4XFX A;  2XU6 A;  2CWO A;  1GK6 A;  2IBZ I;  1VQ7 P;  3H1J J;  3RBZ A;  1RHZ B;  3H1I E;  4WB4 A;  3S1K A;  1L0N K;  2QSI A;  2FXM A;  2KW2 A;  5KAI E;  1JEK A;  1LT9 B;  3CC7 P;  2CPB A;  3HD7 A;  3LW5 J;  4ZKP A;  4ZNC A;  5AW4 B;  3MP7 B;  1NTZ J;  1NTZ E;  2HFE D;  3PHL A;  3G4S P;  1R5S A;  2EHS A;  4KT0 J;  3HD7 C;  1HUC A;  1KB9 D;  2FYN C;  2DGY A;  3BRV B;  3L74 E;  2PP6 A;  2KP8 A;  1KB9 I;  2R3C A;  2ONT A;  2KLV A;  4U7J A;  1PPJ D;  1URQ A;  1FZC B;  1H89 A;  1LTA C;  1AVY A;  2CK3 H;  3RK3 B;  2KK7 A;  1PGO A;  1NTK J;  2FY8 A;  2RKL A;  1LWU A;  1URQ D;  5APU A;  1H0T B;  2N1T C;  2WPS A;  3B4S A;  3RBX A;  1NQ4 A;  2GUV A;  2E43 A;  1RF1 B;  2MVV A;  1JJ2 O;  5HVC A;  3RK2 D;  2KR5 A;  1K73 Q;  4DZO A;  2Q3E A;  4ASV A;  1BXI A;  1RO2 A;  2OGU A;  2JB0 A;  3KPE A;  1OR5 A;  3G26 A;  2AFD A;  3PTZ A;  4PJ0 H;  1GK4 A;  3LIE A;  1OVR A;  2KOR A;  1GD2 E;  3F5H A;  1KYO H;  2RN0 A;  3L75 J;  2W27 A;  2KZI A;  2JJL A;  1LP1 A;  2N9B A;  2LKI A;  2FYU E;  1YQ4 C;  3FWN A;  5GTI E;  1M7L A;  2R44 A;  3P7K A;  3H1I J;  1T2K D;  1TU3 F;  3H1H G;  1L0N D;  5H2F E;  3AED C;  1M6E X;  3CLQ A;  3W68 A;  3I55 P;  3L75 D;  2FFD C;  2JEE A;  2Q9I A;  1MV8 A;  4GIF A;  2WSC H;  1NU1 E;  5AVR B;  2OAR A;  5BVZ A;  1IFI A;  5KLV G;  3E1I A;  5APV A;  2R3S A;  1OIP A;  1PEM A;  1L2P A;  3CCM P;  1SFC B;  3VMY A;  3M0D C;  2YKO A;  1FOS F;  3L71 E;  3L71 J;  1GXG A;  2W6B A;  2FVA A;  3G3Z A;  2VLN A;  2JKV A;  1NHL A;  1EXI A;  1CSB A;  3H4E A;  3PRJ A;  3L75 E;  1Z6M A;  4RES B;  5AVX B;  2C9N Y;  4LC1 A;  4DOJ A;  2Y0C A;  1NAY A;  3L72 J;  4U0A A;  3PJS K;  2M8N A;  1SVF A;  2KGD A;  3MUD A;  4OVN F;  1N73 B;  1RF0 C;  1IMQ A;  2KZJ A;  2KNC B;  3FGA D;  4L73 A;  1NH4 A;  2HPC B;  2FFD A;  1KTM A;  3DS2 A;  1BGY D;  2FHS C;  1L4A C;  2XND H;  1GL2 A;  2GDX A;  1LJ2 A;  1GL2 C;  4F37 A;  1ZRT E;  1YI2 P;  2LR2 A;  1VF5 C;  1T2K C;  2WSE H;  4GOF A;  3SFE C;  2KI7 B;  5C39 A;  4DJG A;  5F2K A;  3H1K E;  3TGU G;  3H1J G;  3A3Y B;  1FOS E;  1JCC A;  4PD4 E;  2XDJ A;  3S9O A;  2QJK B;  3TGU E;  3LID A;  2KOS A;  3L72 E;  3MGN A;  1OX3 A;  1L0L K;  1Q90 D;  1VQO P;  2E76 B;  2BCC G;  3HD7 D;  3VMX A;  1SQV J;  4PXH B;  2XT1 A;  3U1A A;  2GDY A;  5KP6 B;  2I8D A;  2KSE A;  1PEO A;  2BCC J;  2OYI A;  3GW6 A;  4PD4 D;  2N6Z A;  3HE5 A;  2N1T D;  1VQP P;  2ZYD A;  5AW5 B;  4QMA A;  4H2X C;  3L70 J;  2WPR A;  4OWF A;  3AE7 C;  3V4W A;  2BCC D;  4GR2 A;  1CI6 A;  3IR9 A;  2OYH B;  2AEJ A;  1PP9 G;  3CC2 P;  5TJH A;  3CX5 H;  2IBZ G;  2YIU B;  1BAJ A;  1YIJ P;  1H0T A;  3B5N A;  2EG5 A;  2QA4 P;  3QH9 A;  3VP9 A;  1NTZ K;  3DS3 A;  2XZR A;  2AXT H;  4UB6 E;  2MKV A;  1VQ9 P;  2LF4 A;  1OW8 A;  3L72 G;  4I7Z C;  2KOO A;  3H1L E;  2E75 D;  5AVZ B;  3AE3 C;  2MR7 A;  5KLI B;  2YO3 A;  2W8Z A;  1ZW0 A;  1SQX D;  3N4X A;  2K5X A;  1AFO A;  1FC2 C;  2M8P A;  1R5L A;  2IX7 C;  1G2C A;  1JTH A;  1BGY J;  1BDD A;  1M8O B;  4HB1 A;  2HR3 A;  3I5C A;  1SQP K;  2Q5U A;  3C8V A;  2W83 C;  1M56 D;  3HRN A;  3TGU J;  1QL2 A;  2L6E A;  3K5B A;  5JPA A;  4JBZ A;  4U3F D;  2JU2 A;  1CEI A;  1NTM K;  3VTP C;  2YIU C;  2K1A A;  3RG2 A;  1KV4 A;  2EFJ A;  5GTI H;  3Q2Y A;  4H0L B;  1NAF A;  2Y9Y A;  2HOD B;  3A7O A;  2R32 A;  1ACP A;  3B71 A;  1HJB A;  4N3Y B;  2N50 A;  2K0Y A;  1KB9 E;  1KIL C;  2V7Q H;  3DS1 A;  1JMB A;  4HH2 A;  3QWO C;  2KIK A;  3WUV A;  2PFX A;  1YYC A;  2J59 M;  1M6N A;  2BCC E;  2IFN A;  2ZT9 B;  1ZMB A;  2XV5 A;  2QE7 H;  3KXD A;  1VF5 B;  3FXE A;  5B66 H;  2Q7C A;  3HUS C;  1N7S B;  2I1J A;  4UB6 H;  3PH0 A;  4XRO A;  3M1M A;  4BRY B;  2CNR A;  1RNI A;  2K9Y A;  5AW9 B;  1RE4 C;  2N1T B;  2A45 H;  1PGP A;  3RGU A;  4B86 A;  1OVV A;  1IK9 A;  3H1K G;  3WMM 0;  3T97 A;  1KN7 A;  2L5G B;  3EQ2 A;  3AE2 C;  1SLQ A;  3TSI A;  3DPH A;  1PGQ A;  3V4Q A;  1J1D C;  2FYU J;  2ITA A;  4GOD A;  3SWK A;  1VQ5 P;  1KZU B;  3PP5 A;  2L9F A;  2AEF A;  3KYQ A;  4IL6 X;  1SQV K;  4I2L C;  1FAV A;  1VL2 A;  2KS1 B;  2K0D X;  2JWD A;  3JCU E;  4IL6 E;  1SQP D;  2W6A A;  1FJP A;  5AW3 B;  4WVZ A;  2WVR A;  2MR8 A;  3VMA A;  3CXC O;  3AE8 C;  2FVE A;  1FZG A;  3A0H H;  2QEX P;  1PV3 A;  4U0F A;  4OGQ B;  3IF4 A;  1E5W A;  1G1I A;  3TK1 A;  3VMZ A; 
#chains in the Genus database with same CATH homology
 1AUM A;  2ONT A;  2M8L A;  2PEM A;  3CCL P;  3DS1 A;  1PEO A;  5BS1 A;  3G1G A;  1Q7Y Q;  4COC A;  1YJ9 P;  1K30 A;  3CCR P;  1N8R Q;  1A8O A;  2JYL A;  3H4E A;  5BS2 A;  3CME P;  3CCU P;  1M6N A;  2KOD A;  3DS4 A;  5HGL A;  3H0D A;  3CCQ P;  1ZMB A;  3CCV P;  1VQP P;  4U0A A;  4U0D A;  2Z44 A;  1K9M Q;  3P05 A;  1JJ2 O;  4PH0 A;  1VQK P;  3CPW O;  1RO0 A;  1K73 Q;  4GR2 A;  4XRO A;  1YJW P;  3M1M A;  2M8N A;  4WYM A;  1K8A Q;  4XRQ A;  2PEJ A;  3CC2 P;  1RNI A;  5DCK A;  2BUO A;  3RG6 C;  1E6J P;  3H47 A;  3VRL C;  3G6E P;  1BAJ A;  2PEO A;  1YIJ P;  1RO2 A;  3E2D A;  4PH1 A;  1A43 A;  2P9X A;  2EG5 A;  2BHV A;  2QA4 P;  2PEI A;  5I4T G;  3G26 A;  3DS3 A;  1KC8 Q;  2PEQ A;  4U0E A;  3CMA P;  1Q86 Q;  3G1I A;  4XFZ A;  1M1K Q;  3DPH A;  3B5I A;  1VQ9 P;  2LF4 A;  1VQ4 P;  1D1D A;  3I56 P;  3DS2 A;  2OTL P;  2Z46 A;  3G28 A;  3DTJ A;  5HGN A;  4XFX A;  1VQ6 P;  2CWO A;  1EOQ A;  4GR6 A;  1VQ5 P;  3CCS P;  4QNB A;  5HGM A;  1VQ7 P;  3CCJ P;  2OTJ P;  3LRY A;  3NTE A;  2M8P A;  3Q20 A;  2XXM A;  1YI2 P;  1W2B O;  1M74 A;  2JYG A;  3HYB A;  3HZQ A;  2JO0 A;  1YJN P;  1M6E X;  1VQ8 P;  3WBH A;  3CD6 P;  1IUQ A;  5F2K A;  3CC7 P;  1Q82 Q;  3I55 P;  1Q81 Q;  1NJI Q;  3DS0 A;  1QVG O;  3MGE A;  1QVF O;  3OW2 O;  4IPY A;  1KD1 Q;  3G21 A;  2PY8 A;  3CC4 P;  2EIA A;  2OAR A;  3G0V A;  4XFY A;  4U0B A;  2Z45 A;  1PEQ A;  2L6E A;  4M0I A;  5JPA A;  1M90 Q;  3CXC O;  1YHQ P;  3G4S P;  3G71 P;  3G29 A;  2XV6 A;  5HGO A;  1PEM A;  5F2O A;  2BQ1 E;  2QEX P;  4U0C A;  1QRJ A;  4U0F A;  3CCM P;  1VQM P;  1YIT P;  2PEK A;  2PEN A;  3DS5 A;  5F2N A;  4COP A;  3CCE P;  2EFJ A;  1VQL P;  1VQO P;  1S72 P;  2DGY A;  1EIA A;  1PEU A;  1VQN P;  1KQS O;  2E1M A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...