1YJWP

Crystal structure of quinupristin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yjwP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yjwP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yjwP02
1W2BO 1VQOP 3CCEP 3G71P 3CPWO 3G6EP 2QA4P 1YI2P 1YITP 1YJ9P 1Q7YQ 1VQ7P 1VQ9P 1VQLP 1YIJP 2QEXP 3CC2P 3I56P 3I55P 1VQ4P 3CCMP 3CMAP 1K8AQ 1QVFO 1KQSO 1KD1Q 1VQ8P 3CCRP 1M1KQ 1YJNP 1JJ2O 1VQ5P 3CD6P 1Q86Q 3CCUP 3G4SP 1Q82Q 1VQNP 3OW2O 1VQPP 1YJWP 1VQ6P 3CCJP 1Q81Q 1N8RQ 1K73Q 1YHQP 1K9MQ 1KC8Q 3CC7P 1VQKP 3CCVP 2OTJP 3CMEP 1M90Q 3CXCO 1S72P 1QVGO 3CC4P 3CCLP 1VQMP 2OTLP 3CCQP 3CCSP 1NJIQ
chains in the Genus database with same CATH superfamily
3L74G 4PJ0E 1RO2A 3SWYA 2JKVA 1YQ3C 2QJKC 2XV6A 1L0NE 1BGYE 4QMAA 1SQQJ 3G9RA 2WSFJ 2N98A 3K5BA 1GDTA 2FQ2A 2OTJP 2R3CA 5AW9B 4LC1A 1M56D 2KG6A 3SWKA 2E75D 3HTKB 5F2OA 2N1TB 2M3EA 1URQD 3S1KA 3H1IJ 2YO2A 4BRYB 1GL2D 2WZ7A 1SQXJ 3RK3B 3Q1MA 1PEUA 3PH0A 4PV1D 1S5LH 1NYHA 4ZMDA 4OH8B 4W7ZA 2K1AA 1RF0A 1SFCC 1LTJA 3SSUA 2CG5B 1H88A 2BCCJ 3PP5A 4C7NB 4I7ZC 1WRGA 5AW6B 3DTJA 2KZIA 3L75J 1J1EB 2BEQD 4D6TD 5C39A 3V2QA 4QKOA 1NTZK 3G4SP 2LIUA 4XFJA 2PGDA 1T3JA 3GZMA 1T3UA 1JY2P 1SQVE 1CZQA 3AE8C 3P7KA 4JYCA 2AFDA 2LR2A 2R44A 2K88A 3CPWO 1DD3A 3TNUA 1YIJP 2FQ1A 5AW8B 3PJSK 1M1KQ 2FFDC 3H25A 2H8PD 2BUOA 5TISE 3CWBG 1T8ZA 3GLMA 3B5NC 1EOQA 3G1IA 1OVRA 1U57A 5HGLA 1LT9A 1L0LD 1NTZG 2MF4A 1LTJB 1L0IA 2BASA 3VP9A 4DOJA 1MKMA 1N73C 1Q90D 1BE3J 1ZRTE 2X2BA 1YTZI 4C7RA 2H89C 3H1JG 2B89A 3L70D 2MVUA 2ZT9B 1KQLA 3E1IA 3LMOA 1PZQA 1HBWA 3EFFK 2XZRA 1T8KA 3BCCJ 1EDJA 2LXCB 4XROA 1T2KD 2JYLA 3O6QA 2XKMA 1WMKA 5AVTB 1M1JA 1GD2E 3E7KA 3EFGA 1KQSO 3H1HG 1PGQA 2ZYAA 3GF7A 2ZVOB 1ACPA 2L0QA 3AE2C 1OW7A 4JYBA 1S5LE 2IBZD 5DJUB 1J1DC 1NU1D 3D71A 3VTPC 1H8AA 1LTBC 1SQPJ 1NTMK 1DH3A 1JTHA 2L91A 2ZAEB 1FDIA 5BU8B 2Q6QA 2K0YA 1HQBA 2KLVA 3IR9A 3KDPB 2K37A 4RJTA 2OYIA 2QE7H 2L4BA 4WVZA 2WVRA 3G28A 4WYMA 2Z5HA 1RQUA 4OVNF 1ZR2A 2K0XA 1VQ7P 1U7MA 3VRLC 1IFPA 4YXDC 2O01H 2GDXA 5EJDA 3RK2D 1N7SA 1RY3A 3KYQA 4HB1A 4GOFA 4IFMA 1JCDA 1M1JB 4XRQA 4IL6X 1NTMG 1EZVG 2P10A 1HVVA 2LKMA 2OGUA 2ERHA 2PEMA 3G6EP 1L0NK 3HUSB 3DS4A 1VQ4P 3MHVA 3NTEA 1NQ4A 4KHXA 2CGQA 1ZV8A 1VF5B 2P7JA 4NPDA 2E76D 2AF8A 2C0XA 1JTHB 2E74C 2HG5D 5K5GB 5KP8B 1OVUA 1VQKP 2FYUD 1JEKA 3L74J 4U3FJ 2GYKA 3D70A 2HLOA 1VQ8P 1YJNP 4D6TE 4BPGA 1HF9A 2XDJA 2IYOA 1EXJA 2OYHC 2Z4EA 1SQXK 3EQ2A 4DG9A 3CC4P 1FZEA 2E75C 2FKWB 3H1LD 1QGKB 2KOGA 1URQC 1M6NA 2LKIA 2C0WA 1VQ5P 1GL2C 4U0CA 3H6PA 5CCGD 5APYA 1QL1A 2B87A 3RL0D 1QEXA 4PV1C 2GA1A 1FAVA 5KJ7A 1VKUA 2N5IA 1X22A 5B66H 2EFJA 3DS1A 3V2NA 1Q7YQ 1FS0E 1PPJD 2M3BA 1S1CX 4OGQD 5I4TG 1SS1A 2BQ1E 3H1IG 5CZDB 4LLHA 5APTA 2KXPB 1SQXG 2FYNB 4HKZH 3H32B 1Y47A 2NO8A 2KORA 1M8OB 3U59A 3ITKA 2FVFA 1VQ9P 1VQLP 2PENA 2JR8A 1OIPA 2QEXP 1EQ7A 1IK9A 3L70E 2Z46A 1U7JA 5F2NA 3WUTA 3L75G 3CWBJ 4EDFA 3OW2O 1P84D 5AVQB 2NPSD 2ZYGA 3MUDA 3VMAA 2H43A 1PGPA 5APSA 3AE3C 3Q5PA 3G21A 1D1DA 3L36A 4K3AA 2ONTA 2HR3A 2YKQA 2IBZE 3HUSC 1NU1E 2K9YA 3AEEC 3CCLP 1HTLC 2KGEA 1MV8A 1SQQD 3HE5B 3M0AA 4BWNA 2PNGA 3I56P 1BCCD 4W80A 3USSA 2OQQA 2W90A 3IN6A 1KQGB 2GZEA 4H13B 1KB9D 1E6JP 5B5EH 2FY8A 1T2KC 1G2CA 5DCKA 4GT1A 1LTGC 2RH0A 2V7QH 3RL0B 2M8NA 1ZW0A 3NMDA 3KXDA 4PH1A 4YXWH 2B9BA 5CHXA 1SQPK 2BCCD 1P84H 2WSSH 1EZVI 2CNRA 2AXTH 1M7LA 2ITAA 4Z1MH 4U7JA 4ASWA 1K9MQ 2KSJA 2M5RA 3AE9C 1RE3C 4Y28J 3A3YB 2KOPA 5B66E 3ABVC 1Z6MA 2N9YB 1LP1A 2ROQA 4M3LA 5KLVJ 3L72J 3Q5SA 2KGAA 1A02J 1USDA 3RBXA 3AE6C 3CCJP 4L76A 4PWVB 2P58A 3KZIH 3MIWA 2FYUE 2Q1KA 1FZFA 1RF1C 3RK3D 2JBGA 1BDDA 1GU5A 1YITP 2YO3A 2RKLA 4RO0A 1SQPG 4WBAA 3WBHA 2GZGA 1KB9H 1JUNA 1NTKJ 4TT3H 4H44B 2I1KA 2E5YA 3RK2C 3C9IA 1NTMJ 3HD7B 1IJDB 1KTMA 1K73Q 3AE4C 1M90Q 3GG2A 2N50A 1S5LX 2FAEA 1BXIA 4UB6H 2E42A 2QA4P 3H1LE 4BPFA 1AV1A 1BE3D 4WWIA 4EYYQ 1VQNP 2A45H 1FZCC 2E76C 2L5GB 3U1AA 4YTPC 1N86A 3V5BA 1UIIA 1LP1B 3JCUH 3L73J 1S72P 4Y99B 4GDOA 3B4SA 2H7HA 1PPJE 2PEKA 2E5TA 3BCCD 4JF7A 2FYZA 3AE1C 4PD4D 1SQBD 5HVCA 2YIUB 4EIJA 3V4WA 2WPQA 4NPEA 2IPPA 4DCKA 1L0NJ 1BGYJ 2IYPA 3NY7B 2WSCH 2K9JB 4U3FG 1JCCA 5AVXB 2R3SA 2KB7P 1VHNA 1DV5A 2QJPC 2POHA 5KKZC 4IFFA 5CCGC 2VLQA 1FZAA 2LPKA 1P84E 2IFNA 1MZ9A 2AXTE 3M9HA 2ZT9D 1L2PA 2XNDH 5F2KA 3EJBA 2VLPA 2GZJA 3H0DA 4ZNCA 5CJ0A 1R5SA 2A06G 2LOLA 2B88A 2CPSA 4OGQC 3VYIA 5KTBA 4OWFA 1ZXGA 4I6MC 3MGEA 3S9OA 2N6YA 2BHVA 5KP6B 5AVYB 3CMEP 2K94A 3KZIE 4L75A 2Q7CA 1SQQE 2O1KA 2LXBA 1M57D 1SQVJ 4PD4H 1BCCE 2KUBA 2MY5A 1OW8A 5AVVB 5GTIE 4XA4A 3LW5J 3VN0A 1KORA 1KB9E 2OARA 1PGOA 1HH0A 2YNYA 5APQA 4HH2A 3Q2YA 1MZ8A 3TDKA 2NPSC 4IZ6A 3DPHA 3WMM0 2E1MA 4UB6E 2P2UA 3G3ZA 3N7NA 4KT0J 1OWAA 1LWUA 2BCCE 1L4AA 3L74D 1Q81Q 5TJHA 2DNWA 2FVEA 2W83C 2KP8A 1OR5A 2H88C 1HJBA 3NFQA 1WT6A 1FBMA 3JCUE 1URQA 2JAZA 1X8YA 1KILA 2Q5UA 4U0BA 1GL2A 2Z5IA 5CCHA 2ZFCA 4RESB 1SP4A 1VQPP 2KODA 4C46A 2QG4A 2FXOA 2JWAA 4NEOA 3P32A 3RK3E 1NWQA 1VF5D 1NVOA 1LTSC 2WPRA 3F5HA 4H2WC 3M0DC 3JSVC 3CCMP 2PEQA 2VRSA 1HWTC 5APVA 1GZLA 1K04A 5H2FH 1RE4C 3CX5D 2WPVB 2VLOA 1QL2A 1PV3A 1Y8AA 1JOCA 4MN4C 2FYUK 3TNUB 2M8RA 2L22A 1PEQA 3AEDC 5KLVK 2XNXA 1FDMA 1LWUB 2LIWA 2ZVNB 2DW3A 4F37A 2Y0EA 1BE3E 2L6EA 3AE7C 3H1KE 3L37A 1EDKA 3L71E 1EC5A 4H2YC 2KOOA 1A8OA 1N7SD 5KLIB 2XXMA 1GK4A 2N1TC 1KILB 1LT9B 1Y9BA 5APXA 2GZFA 3I5CA 1NTKK 7CEIA 3RK3C 4JQ0D 3VMZA 1XTCC 2P9XA 3ZDMA 2YMYA 1R8EA 3O8ZA 1M6EX 4PD4E 1OVVA 1EIAA 1SQBE 1LGHB 1BAJA 2PEJA 3E1RA 2MVVA 2YMKA 1YJWP 3TYYA 1NTZD 5KLVG 3L72G 1FU1A 1AFOA 4H0LB 2EHSA 5APUA 1J1EC 1IK7A 1D7MA 1HGVA 2WSEH 4RKUJ 3VMYA 2WMMA 3CX5H 5BS1A 2MR8A 3H47A 3O6QB 3H1JD 3A0BH 4PXHB 1NTKG 1HUCA 1UNKA 3H1LG 1SLQA 4HJGH 4W7YA 3M91A 2W27A 3LIDA 3NXSA 1NH4A 1ZN5A 2E43A 2K92A 1AQTA 2LF4A 1GW3A 2PP6A 2QIWA 1KYOD 4BPHA 2NRGA 3A7OA 4R0MA 3H1HD 1S9KD 3TGUD 4WY4A 1QLED 3FXDA 1RF0C 1LTJC 5KJ7D 1IFMA 2QJYB 3L73G 4DJGA 2OYIB 2O3JA 5BS2A 3P8CD 2P1JA 4M0IA 4NPFX 2JYGA 2OYOA 1IMPA 3CCVP 2Z44A 2ZT9C 1L0NG 1BGYG 4H13D 3CCQP 2M8PA 2RMZA 2ZXEB 1PP9D 1N7SB 1PEMA 3A2AA 2L9FA 3AEFC 3KQGA 1SQVK 5CBNA 1ZR4A 1CSBA 1X0TA 1DEEG 2JWDA 2RN0A 2YXRB 3OAKA 2WPTA 4GR2A 5HGNA 5CMZA 5KAFH 2IBZI 5M1BA 2IDBA 2I1JA 1KFNA 1L0LE 1NTMD 4N78D 1LT9C 1LJ2A 1QX8A 4WY4B 2FXPA 1BSNA 1KYOH 1FZCA 5AW7B 1JY3O 4UB8H 3L70J 3MD0A 2Q3EA 3RG2A 2O01N 2PEOA 1TU3F 2PAJA 2VLNA 2JQ4A 2O01J 1AYIA 3AEAC 5KP7B 4IL6H 1VDFA 3IAOA 2MR7A 1SQVG 1AJYA 4CPGA 3CX5E 3FX0A 1JY3N 2XZ1C 3A0BE 2WITA 3GHGA 5AW0B 4HYTB 2KOQA 1GXHA 1JNMA 3AE5C 2OTLP 1NAYA 4HKGA 1OFCX 3CLQA 3W67A 4H44D 2C9LY 1KMIZ 2B87B 3HD7D 1NU1J 3GJNA 1JMBA 2JDIH 1M1JC 3UIAA 1IFNA 2KIKA 1NOHA 1H0TA 3KHUA 1JMMA 3II6A 1VF5C 4JBZA 2N9BA 2M8LA 3I55P 4XE5B 1AF8A 1MFZA 5BU5A 2K93A 1OW6A 2NZ2A 1ZNVA 3BATA 1NTZE 1SFCA 2QVAA 1E0HA 1PEOA 3H1ID 3CC7P 1G1IA 3CXHD 1GMJA 3V2PA 1SQXD 2I8DA 2J5UA 3GHGB 1K8AQ 4KJMA 3V2RA 2FXMA 1LTAC 3H1JE 1RHZB 5CBOA 1N7SC 2QJKB 1OZHA 3AEGC 3L75D 3H1KG 3L71G 1PFIA 2HPCA 3PHLA 3VP8A 3A5TA 1H0TB 2FFDA 2FYUJ 1AQ5A 2ZYDA 3A0HH 4L74A 4COPA 1KYOE 1EXIA 1JY2O 3WU2H 4UB8E 4A7PA 3B5NA 3H1HE 1S9KE 1MFTA 3TGUE 1RNIA 2R32A 1YYCA 3EJDA 2J59M 3T97A 2WSFH 1FOSF 2GUSA 2FYNC 2G8YA 4BXLA 5AVWB 1G2CB 1N73A 3H1LJ 1JY2N 2KYVA 3P8CE 2GDWA 2XU6A 3RBZA 3G0VA 5APWA 3CXHH 3B8EB 2AVAA 1LT1A 2HYNA 1P84I 1PP9E 2KLUA 2KW2A 3BRVB 1R5LA 3HZQA 1YI2P 3RGUA 1DNYA 1RE4A 1GU4A 5AW3B 2ZXXA 4JPZB 1DIPA 1KN7A 1ZMBA 1NKNA 3MZWB 2JO1A 2FFDB 1YHQP 3R2PA 4IFDK 4GOEA 4ZKUA 3NTNA 1VQMP 5KJ7C 3QH9A 1XTGB 4YPCA 1NKZB 1W2EA 2WT7A 1IC2A 1N7LA 4N78E 3B5NB 5DJTB 1EDLA 3PTZA 3TF5A 2KGCA 2N1TA 1GPJA 2QSIA 4H2XC 2V7QJ 4BRYA 2K2QA 5B5EE 3FWLA 4LGDE 2R5DA 1FE6A 1L0LK 4L73A 4D6TG 3RL0g 4H13C 3LRYA 3V6IA 2KZJA 1N2DC 2Q3IA 2GM4A 3EWKA 2ZJSE 2E74D 1CW5A 1SQPD 1N8RQ 3RL0C 2Y9YA 2O1JA 3MUDC 2LMLA 2IZ1A 3IF4A 2JU1A 2A45I 3PLNA 4XFXA 4IOIH 1QVFO 2W6BA 4U0AA 2MD9A 2UWJE 3A0HE 2YXQB 3GW6A 1CEIA 2SPZA 1G1JA 1L4AD 1BCCJ 2K3RA 3Q3DA 2W6AA 2WT7B 1L0LG 3M06A 3WU2E 1X3OA 2JP3A 3B5IA 2WPSA 4EOTA 1KZUB 2M0BA 2KSEA 2DGYA 1J1DB 1KILD 5AVRB 5CCHD 2JO0A 1ZMEC 1NU1K 4AYCA 2AXCA 2QNWA 3H1IE 3CXHE 3L70G 1SQXE 1LTIC 3CCEP 5AVZB 5KAIH 4H44C 3HD7C 1VPCA 4R4MA 4H0LD 3Q5RA 3GKLC 3FGAD 2Q9IA 1Q86Q 3KPEA 2OYHA 3N4XA 4U3FD 2K5XA 3GZLA 1KFMA 2XZ0D 2KI7B 3OA7A 3L75E 3WUUA 4U0EA 3DS2A 3QWOC 1ZOYC 3L35A 2IBZG 1NU1G 1AVOA 2AFEA 2WSCJ 4Y99C 2AEJA 2FACA 4PD4I 3IFMA 2A06D 4B86A 4R4LA 3JC22 4ASVA 1H89A 1FJPA 2MKVA 1GW4A 1FZGA 2E74B 1OX3A 4XFZA 2YIUC 1ZP0C 2XV5A 2YKPA 1EDIA 2WTYA 3V4QA 3R4YA 1FOSE 1OMIA 3H1KJ 4O9BA 2P67A 3L71J 4CA3A 2OYHB 2EG5A 1L4AB 5BVZA 3B71A 4AUWA 2KWLA 2KNCA 3DS0A 3CD6P 2E75B 3U43A 1LNQA 2QM8A 1FC2C 1URQB 1K30A 3D6ZA 5EW5E 5CJ4A 1KC8Q 1GL2B 1SQBJ 4DT0A 1HJ0A 3DS3A 4PV1B 3CWBD 5EFWB 3CC2P 1GXGA 3BCCE 1RO0A 3CMAP 5HV8A 3TGUG 1JJ2O 2FYUG 1IFIA 2Y0DA 3HUSA 2W8ZA 1RH5B 3P05A 2JEEA 4WY4D 3AECC 1IUQA 4XFYA 3G26A 2KG9A 1UIXA 3C1LA 5GTHH 4GIFA 5KAIE 3WUVA 3GMAA 1KQFB 2N6ZA 1AVYA 2CK3H 1SQPE 1PP9G 2N5HA 2KK7A 2KNCB 1GTWA 1JM0A 2J58A 2PY8A 2IFMA 3CCRP 2K0DX 1AA0A 4ZKPA 3MP7B 2Y9ZA 1RE3A 1PPJG 1PIXA 2JU2A 3E2DA 4D6TJ 3CL3D 2FVAA 1SVFA 2D2CD 5AVUB 1KILE 3W68A 3P8MC 1KD1Q 5HGMA 2PFXA 3H4EA 5H2FE 2FBWC 2M5AA 1A02F 3M9QA 1RF1A 2PRRA 3CX5I 1L0HA 1SQQK 3HE4A 2Z45A 1W2BO 1RQVA 5KLVD 3F89A 3L72D 1S2EA 2MJZA 1DX7A 3H32A 3AEBC 3HRNA 4I1LA 3L74E 1FJKA 1L0LJ 1LWUC 4U3FE 1L4AC 2JGPA 4PH0A 2QRXA 3OJAB 1LTTC 3VOPA 1MUUA 1NTKD 3MTUE 1NO4A 5KLIC 1KILC 1EZVD 1ZLLA 5AW1B 2VSQA 1QRJA 5CCHC 2GDYA 1Q2NA 2A06E 4TLFA 1SQQG 1BDCA 2WSEJ 1J2JB 5JPAA 1BCCG 3BVHA 2KOSA 2M5AB 1YJ9P 2W6JH 1RF1B 5GTHE 3U1CA 3M1MA 5L8RJ 1PL5A 2WQYC 4H0LC 3HE4B 2LTEA 1GK6A 3HE5A 3L73D 2CWOA 1VQ6P 1SFCD 5AVSB 2KG8A 3C8VA 1A43A 3EJEA 1UJZA 1X9VA 1QVGO 3SFEC 3RK2B 1FR2A 2BCCG 1PGJA 4K35A 4N3YB 1CI6A 2A45G 5AW5B 1L0ND 1BGYD 3Q20A 5CCGA 2D2CB 2EHTA 2WWWA 1VL2A 3L4FA 1KYOI 4GR6A 1EMVA 2OTKE 1FZBA 1FZCB 2E76B 1NTZJ 2XT1A 3G71P 1YBKA 3CWBE 2EIAA 2R5BA 1K05A 1AUMA 2G3AA 3FXEA 1IZNB 3HYBA 2JB0A 2QJYC 1IFJA 2PEIA 3B5ND 5E79H 1M74A 2CQ8A 3H1JJ 1OXZA 1IO4A 1S3JA 2OYIC 1F80D 1X79B 5AW2B 5HGOA 2FHSC 1SQBK 1KV4A 1W5CE 1JO5A 2KGDA 4GODA 3VMXA 1Q82Q 4IPYA 2NPSA 1FDOA 1CI6B 1SQVD 2QJPB 3G29A 1NAFA 5KKZB 1BE3G 3D6YA 4PJ0H 2CPBA 2JJLA 3HD7A 4AQRD 3H1HJ 5KAFE 3TGUJ 1IMQA 1DD4A 3CI9A 2V4HA 4COCA 2IZ0A 4MRTC 2KR5A 3BRTB 3CE7A 2LL8A 2Y0CA 4OGQB 3BCCG 3CXCO 4WY4C 4EI2A 1SQBG 1SFCB 1E79H 2HODA 4GKGA 4IL6E 1PP9J 2N1TD 2FADA 3B4QA 4I7ZB 3SFDC 2BEZF 2AEFA 2AEMA 1ZRTD 3MGNA 2GZIA 3CCSP 3DS5A 5KLVE 3L72E 3M0DA 3LIEA 2C9NY 4U0FA 5GTIH 1IFDA 1USEA 4QNBA 4UHPB 2NPSB 1YTZT 2KS1A 2QM7A 2YKOA 3PRJA 4DZOA 2HFED 4I2LC 3S4RA 3SWFA 1BSHA 2K9JA 2HPCB 3M9BA 2GUVA 1JY3P 4WB4A 3LW5H 1YQ4C 2D2CC 1NTKE 1JB0J 2FQ0A 1NTME 1EZVE 3H1KD 3L71D 1DEBA 3HTKA 5TISH 1E5WA 1HGZA 3FWNA 3T97B 1NHLA 3RG6C 2HODB 1T6AA 1NGMB 5E79E 1KB9I 3TSIA 1NJIQ 1N73B 1VQOP 1KLPA 3CXHI 3TK1A 3G1GA 1S4XA 3BASA 3GF3A 3CCUP 3L73E 5AW4B 1Z56A 4C7NA 4N6JA 2KS1B 3GHGC 4U0DA 1HY8A 2IX7C
chains in the Genus database with same CATH topology
2EG5A 3G28A 4WYMA 2DGYA 2M8LA 2E1MA 3HZQA 5HGLA 2P9XA 1YI2P 1Q7YQ 1VQ7P 2PEKA 3VRLC 1RO2A 1PEMA 2M8NA 3DS0A 3I55P 5I4TG 4PH1A 1M6EX 2XV6A 1KD1Q 5HGMA 2BQ1E 1EIAA 3Q20A 3CD6P 1ZMBA 3H4EA 1BAJA 2PEJA 2JO0A 1YJWP 1K30A 4XRQA 1Q81Q 1YHQP 1PEOA 1K9MQ 1KC8Q 3CC7P 2OTJP 2M8PA 4GR6A 3DS3A 1VQMP 4GR2A 5F2OA 5HGNA 3CCSP 2Z45A 1W2BO 3DS5A 2XT1A 2PEMA 3CCEP 3G71P 3G6EP 1VQ9P 1VQLP 2EIAA 2PENA 4U0FA 3CC2P 2QEXP 4U0BA 4QNBA 1AUMA 3DS4A 1VQ4P 3NTEA 2Z46A 1RO0A 3CMAP 1K8AQ 5BS1A 3H47A 5F2NA 1JJ2O 1Q86Q 1PEUA 3HYBA 3OW2O 1VQPP 3CCJP 2PEIA 2KODA 4PH0A 3P05A 2PEOA 4XROA 1VQKP 1M74A 2JYLA 5F2KA 4U0EA 3DS2A 3H0DA 1IUQA 4XFYA 3G26A 3LRYA 1YITP 5HGOA 3DTJA 3G21A 3CCMP 1D1DA 2PEQA 1KQSO 1VQ8P 3WBHA 1YJNP 4COPA 2LF4A 1QRJA 2ONTA 3G4SP 3MGEA 1Q82Q 4IPYA 3RG6C 1N8RQ 1K73Q 2BHVA 5JPAA 1RNIA 3G29A 3CMEP 1M90Q 2PY8A 1PEQA 3CC4P 3CCLP 2OTLP 1NJIQ 4XFZA 1VQOP 3CPWO 4XFXA 2QA4P 1YJ9P 1YIJP 3G1GA 3I56P 1M6NA 3M1MA 2L6EA 1QVFO 3CCRP 1M1KQ 4U0AA 1VQ5P 4COCA 4U0CA 3CCUP 1A8OA 1VQNP 5BS2A 2XXMA 2BUOA 1E6JP 2OARA 2CWOA 1VQ6P 3G0VA 4M0IA 2JYGA 3E2DA 3CCVP 2Z44A 1A43A 1EOQA 3CXCO 3B5IA 3G1IA 4U0DA 2EFJA 1S72P 3DPHA 1QVGO 5DCKA 3CCQP 3DS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1VQO P;  3CCE P;  3G71 P;  3CPW O;  3G6E P;  2QA4 P;  1YI2 P;  1YIT P;  1YJ9 P;  1Q7Y Q;  1VQ7 P;  1VQ9 P;  1VQL P;  1YIJ P;  2QEX P;  3CC2 P;  3I56 P;  3I55 P;  1VQ4 P;  3CCM P;  3CMA P;  1K8A Q;  1QVF O;  1KQS O;  1KD1 Q;  1VQ8 P;  3CCR P;  1M1K Q;  1YJN P;  1JJ2 O;  1VQ5 P;  3CD6 P;  1Q86 Q;  3CCU P;  3G4S P;  1Q82 Q;  1VQN P;  3OW2 O;  1VQP P;  1YJW P;  1VQ6 P;  3CCJ P;  1Q81 Q;  1N8R Q;  1K73 Q;  1YHQ P;  1K9M Q;  1KC8 Q;  3CC7 P;  1VQK P;  3CCV P;  2OTJ P;  3CME P;  1M90 Q;  3CXC O;  1S72 P;  1QVG O;  3CC4 P;  3CCL P;  1VQM P;  2OTL P;  3CCQ P;  3CCS P;  1NJI Q; 
#chains in the Genus database with same CATH topology
 3L74 G;  4PJ0 E;  1RO2 A;  3SWY A;  2JKV A;  1YQ3 C;  2QJK C;  2XV6 A;  1L0N E;  1BGY E;  4QMA A;  1SQQ J;  3G9R A;  2WSF J;  2N98 A;  3K5B A;  1GDT A;  2FQ2 A;  2OTJ P;  2R3C A;  5AW9 B;  4LC1 A;  1M56 D;  2KG6 A;  3SWK A;  2E75 D;  3HTK B;  5F2O A;  2N1T B;  2M3E A;  1URQ D;  3S1K A;  3H1I J;  2YO2 A;  4BRY B;  1GL2 D;  2WZ7 A;  1SQX J;  3RK3 B;  3Q1M A;  1PEU A;  3PH0 A;  4PV1 D;  1S5L H;  1NYH A;  4ZMD A;  4OH8 B;  4W7Z A;  2K1A A;  1RF0 A;  1SFC C;  1LTJ A;  3SSU A;  2CG5 B;  1H88 A;  2BCC J;  3PP5 A;  4C7N B;  4I7Z C;  1WRG A;  5AW6 B;  3DTJ A;  2KZI A;  3L75 J;  1J1E B;  2BEQ D;  4D6T D;  5C39 A;  3V2Q A;  4QKO A;  1NTZ K;  3G4S P;  2LIU A;  4XFJ A;  2PGD A;  1T3J A;  3GZM A;  1T3U A;  1JY2 P;  1SQV E;  1CZQ A;  3AE8 C;  3P7K A;  4JYC A;  2AFD A;  2LR2 A;  2R44 A;  2K88 A;  3CPW O;  1DD3 A;  3TNU A;  1YIJ P;  2FQ1 A;  5AW8 B;  3PJS K;  1M1K Q;  2FFD C;  3H25 A;  2H8P D;  2BUO A;  5TIS E;  3CWB G;  1T8Z A;  3GLM A;  3B5N C;  1EOQ A;  3G1I A;  1OVR A;  1U57 A;  5HGL A;  1LT9 A;  1L0L D;  1NTZ G;  2MF4 A;  1LTJ B;  1L0I A;  2BAS A;  3VP9 A;  4DOJ A;  1MKM A;  1N73 C;  1Q90 D;  1BE3 J;  1ZRT E;  2X2B A;  1YTZ I;  4C7R A;  2H89 C;  3H1J G;  2B89 A;  3L70 D;  2MVU A;  2ZT9 B;  1KQL A;  3E1I A;  3LMO A;  1PZQ A;  1HBW A;  3EFF K;  2XZR A;  1T8K A;  3BCC J;  1EDJ A;  2LXC B;  4XRO A;  1T2K D;  2JYL A;  3O6Q A;  2XKM A;  1WMK A;  5AVT B;  1M1J A;  1GD2 E;  3E7K A;  3EFG A;  1KQS O;  3H1H G;  1PGQ A;  2ZYA A;  3GF7 A;  2ZVO B;  1ACP A;  2L0Q A;  3AE2 C;  1OW7 A;  4JYB A;  1S5L E;  2IBZ D;  5DJU B;  1J1D C;  1NU1 D;  3D71 A;  3VTP C;  1H8A A;  1LTB C;  1SQP J;  1NTM K;  1DH3 A;  1JTH A;  2L91 A;  2ZAE B;  1FDI A;  5BU8 B;  2Q6Q A;  2K0Y A;  1HQB A;  2KLV A;  3IR9 A;  3KDP B;  2K37 A;  4RJT A;  2OYI A;  2QE7 H;  2L4B A;  4WVZ A;  2WVR A;  3G28 A;  4WYM A;  2Z5H A;  1RQU A;  4OVN F;  1ZR2 A;  2K0X A;  1VQ7 P;  1U7M A;  3VRL C;  1IFP A;  4YXD C;  2O01 H;  2GDX A;  5EJD A;  3RK2 D;  1N7S A;  1RY3 A;  3KYQ A;  4HB1 A;  4GOF A;  4IFM A;  1JCD A;  1M1J B;  4XRQ A;  4IL6 X;  1NTM G;  1EZV G;  2P10 A;  1HVV A;  2LKM A;  2OGU A;  2ERH A;  2PEM A;  3G6E P;  1L0N K;  3HUS B;  3DS4 A;  1VQ4 P;  3MHV A;  3NTE A;  1NQ4 A;  4KHX A;  2CGQ A;  1ZV8 A;  1VF5 B;  2P7J A;  4NPD A;  2E76 D;  2AF8 A;  2C0X A;  1JTH B;  2E74 C;  2HG5 D;  5K5G B;  5KP8 B;  1OVU A;  1VQK P;  2FYU D;  1JEK A;  3L74 J;  4U3F J;  2GYK A;  3D70 A;  2HLO A;  1VQ8 P;  1YJN P;  4D6T E;  4BPG A;  1HF9 A;  2XDJ A;  2IYO A;  1EXJ A;  2OYH C;  2Z4E A;  1SQX K;  3EQ2 A;  4DG9 A;  3CC4 P;  1FZE A;  2E75 C;  2FKW B;  3H1L D;  1QGK B;  2KOG A;  1URQ C;  1M6N A;  2LKI A;  2C0W A;  1VQ5 P;  1GL2 C;  4U0C A;  3H6P A;  5CCG D;  5APY A;  1QL1 A;  2B87 A;  3RL0 D;  1QEX A;  4PV1 C;  2GA1 A;  1FAV A;  5KJ7 A;  1VKU A;  2N5I A;  1X22 A;  5B66 H;  2EFJ A;  3DS1 A;  3V2N A;  1Q7Y Q;  1FS0 E;  1PPJ D;  2M3B A;  1S1C X;  4OGQ D;  5I4T G;  1SS1 A;  2BQ1 E;  3H1I G;  5CZD B;  4LLH A;  5APT A;  2KXP B;  1SQX G;  2FYN B;  4HKZ H;  3H32 B;  1Y47 A;  2NO8 A;  2KOR A;  1M8O B;  3U59 A;  3ITK A;  2FVF A;  1VQ9 P;  1VQL P;  2PEN A;  2JR8 A;  1OIP A;  2QEX P;  1EQ7 A;  1IK9 A;  3L70 E;  2Z46 A;  1U7J A;  5F2N A;  3WUT A;  3L75 G;  3CWB J;  4EDF A;  3OW2 O;  1P84 D;  5AVQ B;  2NPS D;  2ZYG A;  3MUD A;  3VMA A;  2H43 A;  1PGP A;  5APS A;  3AE3 C;  3Q5P A;  3G21 A;  1D1D A;  3L36 A;  4K3A A;  2ONT A;  2HR3 A;  2YKQ A;  2IBZ E;  3HUS C;  1NU1 E;  2K9Y A;  3AEE C;  3CCL P;  1HTL C;  2KGE A;  1MV8 A;  1SQQ D;  3HE5 B;  3M0A A;  4BWN A;  2PNG A;  3I56 P;  1BCC D;  4W80 A;  3USS A;  2OQQ A;  2W90 A;  3IN6 A;  1KQG B;  2GZE A;  4H13 B;  1KB9 D;  1E6J P;  5B5E H;  2FY8 A;  1T2K C;  1G2C A;  5DCK A;  4GT1 A;  1LTG C;  2RH0 A;  2V7Q H;  3RL0 B;  2M8N A;  1ZW0 A;  3NMD A;  3KXD A;  4PH1 A;  4YXW H;  2B9B A;  5CHX A;  1SQP K;  2BCC D;  1P84 H;  2WSS H;  1EZV I;  2CNR A;  2AXT H;  1M7L A;  2ITA A;  4Z1M H;  4U7J A;  4ASW A;  1K9M Q;  2KSJ A;  2M5R A;  3AE9 C;  1RE3 C;  4Y28 J;  3A3Y B;  2KOP A;  5B66 E;  3ABV C;  1Z6M A;  2N9Y B;  1LP1 A;  2ROQ A;  4M3L A;  5KLV J;  3L72 J;  3Q5S A;  2KGA A;  1A02 J;  1USD A;  3RBX A;  3AE6 C;  3CCJ P;  4L76 A;  4PWV B;  2P58 A;  3KZI H;  3MIW A;  2FYU E;  2Q1K A;  1FZF A;  1RF1 C;  3RK3 D;  2JBG A;  1BDD A;  1GU5 A;  1YIT P;  2YO3 A;  2RKL A;  4RO0 A;  1SQP G;  4WBA A;  3WBH A;  2GZG A;  1KB9 H;  1JUN A;  1NTK J;  4TT3 H;  4H44 B;  2I1K A;  2E5Y A;  3RK2 C;  3C9I A;  1NTM J;  3HD7 B;  1IJD B;  1KTM A;  1K73 Q;  3AE4 C;  1M90 Q;  3GG2 A;  2N50 A;  1S5L X;  2FAE A;  1BXI A;  4UB6 H;  2E42 A;  2QA4 P;  3H1L E;  4BPF A;  1AV1 A;  1BE3 D;  4WWI A;  4EYY Q;  1VQN P;  2A45 H;  1FZC C;  2E76 C;  2L5G B;  3U1A A;  4YTP C;  1N86 A;  3V5B A;  1UII A;  1LP1 B;  3JCU H;  3L73 J;  1S72 P;  4Y99 B;  4GDO A;  3B4S A;  2H7H A;  1PPJ E;  2PEK A;  2E5T A;  3BCC D;  4JF7 A;  2FYZ A;  3AE1 C;  4PD4 D;  1SQB D;  5HVC A;  2YIU B;  4EIJ A;  3V4W A;  2WPQ A;  4NPE A;  2IPP A;  4DCK A;  1L0N J;  1BGY J;  2IYP A;  3NY7 B;  2WSC H;  2K9J B;  4U3F G;  1JCC A;  5AVX B;  2R3S A;  2KB7 P;  1VHN A;  1DV5 A;  2QJP C;  2POH A;  5KKZ C;  4IFF A;  5CCG C;  2VLQ A;  1FZA A;  2LPK A;  1P84 E;  2IFN A;  1MZ9 A;  2AXT E;  3M9H A;  2ZT9 D;  1L2P A;  2XND H;  5F2K A;  3EJB A;  2VLP A;  2GZJ A;  3H0D A;  4ZNC A;  5CJ0 A;  1R5S A;  2A06 G;  2LOL A;  2B88 A;  2CPS A;  4OGQ C;  3VYI A;  5KTB A;  4OWF A;  1ZXG A;  4I6M C;  3MGE A;  3S9O A;  2N6Y A;  2BHV A;  5KP6 B;  5AVY B;  3CME P;  2K94 A;  3KZI E;  4L75 A;  2Q7C A;  1SQQ E;  2O1K A;  2LXB A;  1M57 D;  1SQV J;  4PD4 H;  1BCC E;  2KUB A;  2MY5 A;  1OW8 A;  5AVV B;  5GTI E;  4XA4 A;  3LW5 J;  3VN0 A;  1KOR A;  1KB9 E;  2OAR A;  1PGO A;  1HH0 A;  2YNY A;  5APQ A;  4HH2 A;  3Q2Y A;  1MZ8 A;  3TDK A;  2NPS C;  4IZ6 A;  3DPH A;  3WMM 0;  2E1M A;  4UB6 E;  2P2U A;  3G3Z A;  3N7N A;  4KT0 J;  1OWA A;  1LWU A;  2BCC E;  1L4A A;  3L74 D;  1Q81 Q;  5TJH A;  2DNW A;  2FVE A;  2W83 C;  2KP8 A;  1OR5 A;  2H88 C;  1HJB A;  3NFQ A;  1WT6 A;  1FBM A;  3JCU E;  1URQ A;  2JAZ A;  1X8Y A;  1KIL A;  2Q5U A;  4U0B A;  1GL2 A;  2Z5I A;  5CCH A;  2ZFC A;  4RES B;  1SP4 A;  1VQP P;  2KOD A;  4C46 A;  2QG4 A;  2FXO A;  2JWA A;  4NEO A;  3P32 A;  3RK3 E;  1NWQ A;  1VF5 D;  1NVO A;  1LTS C;  2WPR A;  3F5H A;  4H2W C;  3M0D C;  3JSV C;  3CCM P;  2PEQ A;  2VRS A;  1HWT C;  5APV A;  1GZL A;  1K04 A;  5H2F H;  1RE4 C;  3CX5 D;  2WPV B;  2VLO A;  1QL2 A;  1PV3 A;  1Y8A A;  1JOC A;  4MN4 C;  2FYU K;  3TNU B;  2M8R A;  2L22 A;  1PEQ A;  3AED C;  5KLV K;  2XNX A;  1FDM A;  1LWU B;  2LIW A;  2ZVN B;  2DW3 A;  4F37 A;  2Y0E A;  1BE3 E;  2L6E A;  3AE7 C;  3H1K E;  3L37 A;  1EDK A;  3L71 E;  1EC5 A;  4H2Y C;  2KOO A;  1A8O A;  1N7S D;  5KLI B;  2XXM A;  1GK4 A;  2N1T C;  1KIL B;  1LT9 B;  1Y9B A;  5APX A;  2GZF A;  3I5C A;  1NTK K;  7CEI A;  3RK3 C;  4JQ0 D;  3VMZ A;  1XTC C;  2P9X A;  3ZDM A;  2YMY A;  1R8E A;  3O8Z A;  1M6E X;  4PD4 E;  1OVV A;  1EIA A;  1SQB E;  1LGH B;  1BAJ A;  2PEJ A;  3E1R A;  2MVV A;  2YMK A;  1YJW P;  3TYY A;  1NTZ D;  5KLV G;  3L72 G;  1FU1 A;  1AFO A;  4H0L B;  2EHS A;  5APU A;  1J1E C;  1IK7 A;  1D7M A;  1HGV A;  2WSE H;  4RKU J;  3VMY A;  2WMM A;  3CX5 H;  5BS1 A;  2MR8 A;  3H47 A;  3O6Q B;  3H1J D;  3A0B H;  4PXH B;  1NTK G;  1HUC A;  1UNK A;  3H1L G;  1SLQ A;  4HJG H;  4W7Y A;  3M91 A;  2W27 A;  3LID A;  3NXS A;  1NH4 A;  1ZN5 A;  2E43 A;  2K92 A;  1AQT A;  2LF4 A;  1GW3 A;  2PP6 A;  2QIW A;  1KYO D;  4BPH A;  2NRG A;  3A7O A;  4R0M A;  3H1H D;  1S9K D;  3TGU D;  4WY4 A;  1QLE D;  3FXD A;  1RF0 C;  1LTJ C;  5KJ7 D;  1IFM A;  2QJY B;  3L73 G;  4DJG A;  2OYI B;  2O3J A;  5BS2 A;  3P8C D;  2P1J A;  4M0I A;  4NPF X;  2JYG A;  2OYO A;  1IMP A;  3CCV P;  2Z44 A;  2ZT9 C;  1L0N G;  1BGY G;  4H13 D;  3CCQ P;  2M8P A;  2RMZ A;  2ZXE B;  1PP9 D;  1N7S B;  1PEM A;  3A2A A;  2L9F A;  3AEF C;  3KQG A;  1SQV K;  5CBN A;  1ZR4 A;  1CSB A;  1X0T A;  1DEE G;  2JWD A;  2RN0 A;  2YXR B;  3OAK A;  2WPT A;  4GR2 A;  5HGN A;  5CMZ A;  5KAF H;  2IBZ I;  5M1B A;  2IDB A;  2I1J A;  1KFN A;  1L0L E;  1NTM D;  4N78 D;  1LT9 C;  1LJ2 A;  1QX8 A;  4WY4 B;  2FXP A;  1BSN A;  1KYO H;  1FZC A;  5AW7 B;  1JY3 O;  4UB8 H;  3L70 J;  3MD0 A;  2Q3E A;  3RG2 A;  2O01 N;  2PEO A;  1TU3 F;  2PAJ A;  2VLN A;  2JQ4 A;  2O01 J;  1AYI A;  3AEA C;  5KP7 B;  4IL6 H;  1VDF A;  3IAO A;  2MR7 A;  1SQV G;  1AJY A;  4CPG A;  3CX5 E;  3FX0 A;  1JY3 N;  2XZ1 C;  3A0B E;  2WIT A;  3GHG A;  5AW0 B;  4HYT B;  2KOQ A;  1GXH A;  1JNM A;  3AE5 C;  2OTL P;  1NAY A;  4HKG A;  1OFC X;  3CLQ A;  3W67 A;  4H44 D;  2C9L Y;  1KMI Z;  2B87 B;  3HD7 D;  1NU1 J;  3GJN A;  1JMB A;  2JDI H;  1M1J C;  3UIA A;  1IFN A;  2KIK A;  1NOH A;  1H0T A;  3KHU A;  1JMM A;  3II6 A;  1VF5 C;  4JBZ A;  2N9B A;  2M8L A;  3I55 P;  4XE5 B;  1AF8 A;  1MFZ A;  5BU5 A;  2K93 A;  1OW6 A;  2NZ2 A;  1ZNV A;  3BAT A;  1NTZ E;  1SFC A;  2QVA A;  1E0H A;  1PEO A;  3H1I D;  3CC7 P;  1G1I A;  3CXH D;  1GMJ A;  3V2P A;  1SQX D;  2I8D A;  2J5U A;  3GHG B;  1K8A Q;  4KJM A;  3V2R A;  2FXM A;  1LTA C;  3H1J E;  1RHZ B;  5CBO A;  1N7S C;  2QJK B;  1OZH A;  3AEG C;  3L75 D;  3H1K G;  3L71 G;  1PFI A;  2HPC A;  3PHL A;  3VP8 A;  3A5T A;  1H0T B;  2FFD A;  2FYU J;  1AQ5 A;  2ZYD A;  3A0H H;  4L74 A;  4COP A;  1KYO E;  1EXI A;  1JY2 O;  3WU2 H;  4UB8 E;  4A7P A;  3B5N A;  3H1H E;  1S9K E;  1MFT A;  3TGU E;  1RNI A;  2R32 A;  1YYC A;  3EJD A;  2J59 M;  3T97 A;  2WSF H;  1FOS F;  2GUS A;  2FYN C;  2G8Y A;  4BXL A;  5AVW B;  1G2C B;  1N73 A;  3H1L J;  1JY2 N;  2KYV A;  3P8C E;  2GDW A;  2XU6 A;  3RBZ A;  3G0V A;  5APW A;  3CXH H;  3B8E B;  2AVA A;  1LT1 A;  2HYN A;  1P84 I;  1PP9 E;  2KLU A;  2KW2 A;  3BRV B;  1R5L A;  3HZQ A;  1YI2 P;  3RGU A;  1DNY A;  1RE4 A;  1GU4 A;  5AW3 B;  2ZXX A;  4JPZ B;  1DIP A;  1KN7 A;  1ZMB A;  1NKN A;  3MZW B;  2JO1 A;  2FFD B;  1YHQ P;  3R2P A;  4IFD K;  4GOE A;  4ZKU A;  3NTN A;  1VQM P;  5KJ7 C;  3QH9 A;  1XTG B;  4YPC A;  1NKZ B;  1W2E A;  2WT7 A;  1IC2 A;  1N7L A;  4N78 E;  3B5N B;  5DJT B;  1EDL A;  3PTZ A;  3TF5 A;  2KGC A;  2N1T A;  1GPJ A;  2QSI A;  4H2X C;  2V7Q J;  4BRY A;  2K2Q A;  5B5E E;  3FWL A;  4LGD E;  2R5D A;  1FE6 A;  1L0L K;  4L73 A;  4D6T G;  3RL0 g;  4H13 C;  3LRY A;  3V6I A;  2KZJ A;  1N2D C;  2Q3I A;  2GM4 A;  3EWK A;  2ZJS E;  2E74 D;  1CW5 A;  1SQP D;  1N8R Q;  3RL0 C;  2Y9Y A;  2O1J A;  3MUD C;  2LML A;  2IZ1 A;  3IF4 A;  2JU1 A;  2A45 I;  3PLN A;  4XFX A;  4IOI H;  1QVF O;  2W6B A;  4U0A A;  2MD9 A;  2UWJ E;  3A0H E;  2YXQ B;  3GW6 A;  1CEI A;  2SPZ A;  1G1J A;  1L4A D;  1BCC J;  2K3R A;  3Q3D A;  2W6A A;  2WT7 B;  1L0L G;  3M06 A;  3WU2 E;  1X3O A;  2JP3 A;  3B5I A;  2WPS A;  4EOT A;  1KZU B;  2M0B A;  2KSE A;  2DGY A;  1J1D B;  1KIL D;  5AVR B;  5CCH D;  2JO0 A;  1ZME C;  1NU1 K;  4AYC A;  2AXC A;  2QNW A;  3H1I E;  3CXH E;  3L70 G;  1SQX E;  1LTI C;  3CCE P;  5AVZ B;  5KAI H;  4H44 C;  3HD7 C;  1VPC A;  4R4M A;  4H0L D;  3Q5R A;  3GKL C;  3FGA D;  2Q9I A;  1Q86 Q;  3KPE A;  2OYH A;  3N4X A;  4U3F D;  2K5X A;  3GZL A;  1KFM A;  2XZ0 D;  2KI7 B;  3OA7 A;  3L75 E;  3WUU A;  4U0E A;  3DS2 A;  3QWO C;  1ZOY C;  3L35 A;  2IBZ G;  1NU1 G;  1AVO A;  2AFE A;  2WSC J;  4Y99 C;  2AEJ A;  2FAC A;  4PD4 I;  3IFM A;  2A06 D;  4B86 A;  4R4L A;  3JC2 2;  4ASV A;  1H89 A;  1FJP A;  2MKV A;  1GW4 A;  1FZG A;  2E74 B;  1OX3 A;  4XFZ A;  2YIU C;  1ZP0 C;  2XV5 A;  2YKP A;  1EDI A;  2WTY A;  3V4Q A;  3R4Y A;  1FOS E;  1OMI A;  3H1K J;  4O9B A;  2P67 A;  3L71 J;  4CA3 A;  2OYH B;  2EG5 A;  1L4A B;  5BVZ A;  3B71 A;  4AUW A;  2KWL A;  2KNC A;  3DS0 A;  3CD6 P;  2E75 B;  3U43 A;  1LNQ A;  2QM8 A;  1FC2 C;  1URQ B;  1K30 A;  3D6Z A;  5EW5 E;  5CJ4 A;  1KC8 Q;  1GL2 B;  1SQB J;  4DT0 A;  1HJ0 A;  3DS3 A;  4PV1 B;  3CWB D;  5EFW B;  3CC2 P;  1GXG A;  3BCC E;  1RO0 A;  3CMA P;  5HV8 A;  3TGU G;  1JJ2 O;  2FYU G;  1IFI A;  2Y0D A;  3HUS A;  2W8Z A;  1RH5 B;  3P05 A;  2JEE A;  4WY4 D;  3AEC C;  1IUQ A;  4XFY A;  3G26 A;  2KG9 A;  1UIX A;  3C1L A;  5GTH H;  4GIF A;  5KAI E;  3WUV A;  3GMA A;  1KQF B;  2N6Z A;  1AVY A;  2CK3 H;  1SQP E;  1PP9 G;  2N5H A;  2KK7 A;  2KNC B;  1GTW A;  1JM0 A;  2J58 A;  2PY8 A;  2IFM A;  3CCR P;  2K0D X;  1AA0 A;  4ZKP A;  3MP7 B;  2Y9Z A;  1RE3 A;  1PPJ G;  1PIX A;  2JU2 A;  3E2D A;  4D6T J;  3CL3 D;  2FVA A;  1SVF A;  2D2C D;  5AVU B;  1KIL E;  3W68 A;  3P8M C;  1KD1 Q;  5HGM A;  2PFX A;  3H4E A;  5H2F E;  2FBW C;  2M5A A;  1A02 F;  3M9Q A;  1RF1 A;  2PRR A;  3CX5 I;  1L0H A;  1SQQ K;  3HE4 A;  2Z45 A;  1W2B O;  1RQV A;  5KLV D;  3F89 A;  3L72 D;  1S2E A;  2MJZ A;  1DX7 A;  3H32 A;  3AEB C;  3HRN A;  4I1L A;  3L74 E;  1FJK A;  1L0L J;  1LWU C;  4U3F E;  1L4A C;  2JGP A;  4PH0 A;  2QRX A;  3OJA B;  1LTT C;  3VOP A;  1MUU A;  1NTK D;  3MTU E;  1NO4 A;  5KLI C;  1KIL C;  1EZV D;  1ZLL A;  5AW1 B;  2VSQ A;  1QRJ A;  5CCH C;  2GDY A;  1Q2N A;  2A06 E;  4TLF A;  1SQQ G;  1BDC A;  2WSE J;  1J2J B;  5JPA A;  1BCC G;  3BVH A;  2KOS A;  2M5A B;  1YJ9 P;  2W6J H;  1RF1 B;  5GTH E;  3U1C A;  3M1M A;  5L8R J;  1PL5 A;  2WQY C;  4H0L C;  3HE4 B;  2LTE A;  1GK6 A;  3HE5 A;  3L73 D;  2CWO A;  1VQ6 P;  1SFC D;  5AVS B;  2KG8 A;  3C8V A;  1A43 A;  3EJE A;  1UJZ A;  1X9V A;  1QVG O;  3SFE C;  3RK2 B;  1FR2 A;  2BCC G;  1PGJ A;  4K35 A;  4N3Y B;  1CI6 A;  2A45 G;  5AW5 B;  1L0N D;  1BGY D;  3Q20 A;  5CCG A;  2D2C B;  2EHT A;  2WWW A;  1VL2 A;  3L4F A;  1KYO I;  4GR6 A;  1EMV A;  2OTK E;  1FZB A;  1FZC B;  2E76 B;  1NTZ J;  2XT1 A;  3G71 P;  1YBK A;  3CWB E;  2EIA A;  2R5B A;  1K05 A;  1AUM A;  2G3A A;  3FXE A;  1IZN B;  3HYB A;  2JB0 A;  2QJY C;  1IFJ A;  2PEI A;  3B5N D;  5E79 H;  1M74 A;  2CQ8 A;  3H1J J;  1OXZ A;  1IO4 A;  1S3J A;  2OYI C;  1F80 D;  1X79 B;  5AW2 B;  5HGO A;  2FHS C;  1SQB K;  1KV4 A;  1W5C E;  1JO5 A;  2KGD A;  4GOD A;  3VMX A;  1Q82 Q;  4IPY A;  2NPS A;  1FDO A;  1CI6 B;  1SQV D;  2QJP B;  3G29 A;  1NAF A;  5KKZ B;  1BE3 G;  3D6Y A;  4PJ0 H;  2CPB A;  2JJL A;  3HD7 A;  4AQR D;  3H1H J;  5KAF E;  3TGU J;  1IMQ A;  1DD4 A;  3CI9 A;  2V4H A;  4COC A;  2IZ0 A;  4MRT C;  2KR5 A;  3BRT B;  3CE7 A;  2LL8 A;  2Y0C A;  4OGQ B;  3BCC G;  3CXC O;  4WY4 C;  4EI2 A;  1SQB G;  1SFC B;  1E79 H;  2HOD A;  4GKG A;  4IL6 E;  1PP9 J;  2N1T D;  2FAD A;  3B4Q A;  4I7Z B;  3SFD C;  2BEZ F;  2AEF A;  2AEM A;  1ZRT D;  3MGN A;  2GZI A;  3CCS P;  3DS5 A;  5KLV E;  3L72 E;  3M0D A;  3LIE A;  2C9N Y;  4U0F A;  5GTI H;  1IFD A;  1USE A;  4QNB A;  4UHP B;  2NPS B;  1YTZ T;  2KS1 A;  2QM7 A;  2YKO A;  3PRJ A;  4DZO A;  2HFE D;  4I2L C;  3S4R A;  3SWF A;  1BSH A;  2K9J A;  2HPC B;  3M9B A;  2GUV A;  1JY3 P;  4WB4 A;  3LW5 H;  1YQ4 C;  2D2C C;  1NTK E;  1JB0 J;  2FQ0 A;  1NTM E;  1EZV E;  3H1K D;  3L71 D;  1DEB A;  3HTK A;  5TIS H;  1E5W A;  1HGZ A;  3FWN A;  3T97 B;  1NHL A;  3RG6 C;  2HOD B;  1T6A A;  1NGM B;  5E79 E;  1KB9 I;  3TSI A;  1NJI Q;  1N73 B;  1VQO P;  1KLP A;  3CXH I;  3TK1 A;  3G1G A;  1S4X A;  3BAS A;  3GF3 A;  3CCU P;  3L73 E;  5AW4 B;  1Z56 A;  4C7N A;  4N6J A;  2KS1 B;  3GHG C;  4U0D A;  1HY8 A;  2IX7 C; 
#chains in the Genus database with same CATH homology
 2EG5 A;  3G28 A;  4WYM A;  2DGY A;  2M8L A;  2E1M A;  3HZQ A;  5HGL A;  2P9X A;  1YI2 P;  1Q7Y Q;  1VQ7 P;  2PEK A;  3VRL C;  1RO2 A;  1PEM A;  2M8N A;  3DS0 A;  3I55 P;  5I4T G;  4PH1 A;  1M6E X;  2XV6 A;  1KD1 Q;  5HGM A;  2BQ1 E;  1EIA A;  3Q20 A;  3CD6 P;  1ZMB A;  3H4E A;  1BAJ A;  2PEJ A;  2JO0 A;  1YJW P;  1K30 A;  4XRQ A;  1Q81 Q;  1YHQ P;  1PEO A;  1K9M Q;  1KC8 Q;  3CC7 P;  2OTJ P;  2M8P A;  4GR6 A;  3DS3 A;  1VQM P;  4GR2 A;  5F2O A;  5HGN A;  3CCS P;  2Z45 A;  1W2B O;  3DS5 A;  2XT1 A;  2PEM A;  3CCE P;  3G71 P;  3G6E P;  1VQ9 P;  1VQL P;  2EIA A;  2PEN A;  4U0F A;  3CC2 P;  2QEX P;  4U0B A;  4QNB A;  1AUM A;  3DS4 A;  1VQ4 P;  3NTE A;  2Z46 A;  1RO0 A;  3CMA P;  1K8A Q;  5BS1 A;  3H47 A;  5F2N A;  1JJ2 O;  1Q86 Q;  1PEU A;  3HYB A;  3OW2 O;  1VQP P;  3CCJ P;  2PEI A;  2KOD A;  4PH0 A;  3P05 A;  2PEO A;  4XRO A;  1VQK P;  1M74 A;  2JYL A;  5F2K A;  4U0E A;  3DS2 A;  3H0D A;  1IUQ A;  4XFY A;  3G26 A;  3LRY A;  1YIT P;  5HGO A;  3DTJ A;  3G21 A;  3CCM P;  1D1D A;  2PEQ A;  1KQS O;  1VQ8 P;  3WBH A;  1YJN P;  4COP A;  2LF4 A;  1QRJ A;  2ONT A;  3G4S P;  3MGE A;  1Q82 Q;  4IPY A;  3RG6 C;  1N8R Q;  1K73 Q;  2BHV A;  5JPA A;  1RNI A;  3G29 A;  3CME P;  1M90 Q;  2PY8 A;  1PEQ A;  3CC4 P;  3CCL P;  2OTL P;  1NJI Q;  4XFZ A;  1VQO P;  3CPW O;  4XFX A;  2QA4 P;  1YJ9 P;  1YIJ P;  3G1G A;  3I56 P;  1M6N A;  3M1M A;  2L6E A;  1QVF O;  3CCR P;  1M1K Q;  4U0A A;  1VQ5 P;  4COC A;  4U0C A;  3CCU P;  1A8O A;  1VQN P;  5BS2 A;  2XXM A;  2BUO A;  1E6J P;  2OAR A;  2CWO A;  1VQ6 P;  3G0V A;  4M0I A;  2JYG A;  3E2D A;  3CCV P;  2Z44 A;  1A43 A;  1EOQ A;  3CXC O;  3B5I A;  3G1I A;  4U0D A;  2EFJ A;  1S72 P;  3DPH A;  1QVG O;  5DCK A;  3CCQ P;  3DS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...