2XV6A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 28
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xv6A00
2L6EA 2XT1A 3DS2A 2EIAA 4U0BA 4IPYA 4U0EA 3G29A 4XRQA 3DS3A 2XXMA 3DS0A 3G1IA 4PH0A 1AUMA 1BAJA 3DS5A 3DTJA 2JO0A 4QNBA 5HGNA 5HGOA 5DCKA 3H4EA 2JYLA 5HGMA 2KODA 3G0VA 3LRYA 2LF4A 3P05A 2M8NA 4XFZA 1A8OA 2BUOA 3VRLC 4COCA 4U0AA 5HGLA 3DS4A 4XFYA 1QRJA 5I4TG 4U0CA 3H47A 3MGEA 1A43A 2ONTA 2M8LA 2JYGA 4XROA 1E6JP 4COPA 1EIAA 1D1DA 1EOQA 3NTEA 2XV6A 4WYMA 5JPAA 4PH1A 3G28A 3DS1A 2M8PA 3G21A 3G26A 4U0FA 3DPHA 4M0IA 4XFXA 3G1GA 4U0DA
chains in the Genus database with same CATH superfamily
4U0BA 1VQLP 2AF8A 2FVEA 3EJBA 4PXHB 5HGNA 2VLOA 3CCEP 2Z46A 3G0VA 2JAZA 2FVFA 2Z45A 1M6NA 2OARA 4BPGA 2ROQA 3HZQA 1HY8A 1E6JP 4MRTC 2XV6A 3H47A 3DPHA 2LL8A 5JPAA 3G1GA 4BPFA 2LMLA 1NJIQ 2GZGA 1NQ4A 3DS3A 1X3OA 1W2BO 2LF4A 5EJDA 3CC2P 1RO0A 5KP7B 1GPJA 2JU2A 1D1DA 1EMVA 2K5XA 2L4BA 3G26A 2P9XA 2VSQA 2VLPA 2XT1A 2FADA 1YJNP 3M1MA 2FACA 1L0HA 1AUMA 2KGEA 4NEOA 1Q82Q 2N5HA 3EJDA 2PNGA 2MR8A 4U0CA 3MGEA 5EW5E 1MZ8A 1Z6MA 2FAEA 5F2OA 2JU1A 3DS0A 5KP6B 3B5IA 1KQSO 2PEKA 2JYLA 3H0DA 3CXCO 1A8OA 2L9FA 2GDXA 1GXGA 1QVFO 2OTJP 3CCUP 3CCJP 2JQ4A 4WYMA 2PEMA 2FQ2A 3GKLC 2L6EA 4IPYA 3E2DA 2GDWA 2DGYA 2K0XA 1YITP 1IMQA 4XFYA 3RG2A 2KG8A 3CMAP 2LOLA 1KD1Q 2CNRA 1M90Q 1M1KQ 2PY8A 1BAJA 2JO0A 4GR6A 2OTLP 3GJNA 2KGAA 2K92A 2PEOA 1BXIA 2FQ0A 3DS4A 4UHPB 4F37A 5F2KA 2VLQA 1VQ8P 1JJ2O 1EIAA 2KR5A 3G21A 2L0QA 4XRQA 2QA4P 2GZIA 2X2BA 2K0YA 2QEXP 3CC7P 5DCKA 5HGMA 1DNYA 3EJEA 3LRYA 2QNWA 1RNIA 2MVVA 5HGLA 2N6YA 3I55P 3LMOA 2LTEA 1K30A 4PH1A 1Q86Q 4CA3A 4GR2A 3OW2O 2EHTA 2KOSA 5F2NA 1YI2P 3CCRP 1CEIA 1Q7YQ 2BHVA 2FQ1A 2K2QA 1VQ5P 3NY7B 2JGPA 1RO2A 2PENA 2KGDA 3Q20A 1K73Q 1EOQA 1L0IA 3GZLA 1GXHA 1ZMBA 1KC8Q 2MY5A 3RG6C 5HVCA 2CGQA 2M8NA 1Q81Q 2KW2A 1OR5A 1QRJA 5BS1A 2K0DX 2JYGA 3CE7A 4HKGA 2MF4A 3DS1A 4U0FA 1K8AQ 2ERHA 4H2YC 2LIUA 4QNBA 4R0MA 1F80D 5HGOA 1N8RQ 5BS2A 2M5RA 3VRLC 2WPTA 4COCA 2DNWA 2N50A 2E1MA 3B4QA 1A43A 2MR7A 3NTEA 4DG9A 2GDYA 1VHNA 2KOOA 2N6ZA 4U0AA 7CEIA 4U0DA 2GYKA 3CD6P 2KG9A 1K9MQ 1M6EX 1KLPA 1VQPP 2KWLA 2FHSC 2KORA 5KP8B 3P05A 1VQ9P 1FR2A 2AVAA 1AYIA 2EHSA 5I4TG 1IMPA 1ZNVA 2PEQA 2LPKA 2M8LA 3CCMP 4XROA 4COPA 1M74A 2MVUA 5HV8A 2EIAA 3U43A 3G4SP 2NO8A 1T8KA 4H2WC 2CWOA 3I56P 4PWVB 3WBHA 1VQMP 3G71P 1VQ7P 3CCSP 3GZMA 3CCVP 1VKUA 1YJ9P 3CC4P 4M0IA 1HQBA 2AFDA 3CCQP 1E0HA 2GZJA 1YIJP 2KGCA 2K94A 2JBGA 1IUQA 1UJZA 3CMEP 3G28A 2M8PA 1VQNP 2CQ8A 4IZ6A 3G29A 3G1IA 1DV5A 1YJWP 2FVAA 2N98A 1VQ6P 2K93A 2KOQA 3HYBA 2GZEA 2JB0A 2LKIA 2KG6A 1S72P 1VQ4P 4QKOA 5CZDB 2N5IA 1UNKA 2PEIA 3DS2A 4U0EA 2XZ1C 1AF8A 2AFEA 2PEJA 4BPHA 3G6EP 2XZ0D 4XFXA 2EG5A 2XXMA 2CG5B 4PH0A 3DS5A 3DTJA 3CPWO 1QVGO 3H4EA 2L22A 2KODA 4XFZA 2GZFA 2BUOA 2Z44A 1YHQP 1ACPA 2LIWA 3CCLP 2MD9A 2EFJA 2KOPA 2ONTA 4H2XC 2VLNA 1VQKP 1VQOP
chains in the Genus database with same CATH topology
2L6EA 1KC8Q 3RG6C 4U0BA 1VQLP 4IPYA 3E2DA 3CCQP 5HGNA 3CCEP 2DGYA 2Z46A 3G0VA 1YITP 1YIJP 2M8NA 1Q81Q 2Z45A 1M6NA 2OARA 4XFYA 1QRJA 3CMAP 3HZQA 5BS1A 1IUQA 2JYGA 1E6JP 1KD1Q 2XV6A 3CMEP 3G28A 3DS1A 2M8PA 3H47A 4U0FA 3DPHA 5JPAA 1M90Q 3G1GA 1M1KQ 1VQNP 1K8AQ 1NJIQ 3G29A 3DS3A 3G1IA 2PY8A 1YJWP 1BAJA 1W2BO 2JO0A 4QNBA 1VQ6P 5HGOA 1N8RQ 4GR6A 5BS2A 3HYBA 2LF4A 3CC2P 2OTLP 1RO0A 3VRLC 2PEOA 4COCA 2E1MA 3DS4A 5F2KA 1VQ8P 1JJ2O 1A43A 1EIAA 1VQ4P 1S72P 3NTEA 1D1DA 3G26A 3G21A 2P9XA 4U0AA 4U0DA 4XRQA 2PEIA 2XT1A 3DS2A 3CD6P 2QA4P 1YJNP 1K9MQ 1M6EX 4U0EA 3M1MA 1AUMA 2QEXP 3CC7P 1VQPP 5DCKA 5HGMA 1Q82Q 3LRYA 1RNIA 3P05A 1VQ9P 2PEJA 5HGLA 3I55P 5I4TG 4U0CA 3MGEA 2PEQA 2M8LA 3CCMP 4XROA 4COPA 3G6EP 1K30A 1M74A 4PH1A 1Q86Q 4XFXA 5F2OA 2EIAA 4GR2A 3G4SP 2EG5A 2XXMA 3DS0A 3OW2O 4PH0A 5F2NA 1YI2P 3B5IA 3DS5A 3CCRP 1KQSO 2PEKA 3DTJA 3CPWO 1QVGO 2CWOA 2JYLA 3H4EA 3I56P 3WBHA 1VQMP 2KODA 3H0DA 1Q7YQ 2BHVA 4XFZA 3CXCO 1A8OA 2BUOA 2Z44A 1YHQP 1VQ5P 3G71P 3CCLP 1RO2A 1VQ7P 2PENA 2EFJA 3CCSP 3CCVP 2OTJP 2ONTA 1QVFO 3Q20A 1K73Q 3CCUP 3CCJP 1EOQA 4WYMA 2PEMA 1YJ9P 3CC4P 1VQKP 1VQOP 4M0IA 1ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6E A;  2XT1 A;  3DS2 A;  2EIA A;  4U0B A;  4IPY A;  4U0E A;  3G29 A;  4XRQ A;  3DS3 A;  2XXM A;  3DS0 A;  3G1I A;  4PH0 A;  1AUM A;  1BAJ A;  3DS5 A;  3DTJ A;  2JO0 A;  4QNB A;  5HGN A;  5HGO A;  5DCK A;  3H4E A;  2JYL A;  5HGM A;  2KOD A;  3G0V A;  3LRY A;  2LF4 A;  3P05 A;  2M8N A;  4XFZ A;  1A8O A;  2BUO A;  3VRL C;  4COC A;  4U0A A;  5HGL A;  3DS4 A;  4XFY A;  1QRJ A;  5I4T G;  4U0C A;  3H47 A;  3MGE A;  1A43 A;  2ONT A;  2M8L A;  2JYG A;  4XRO A;  1E6J P;  4COP A;  1EIA A;  1D1D A;  1EOQ A;  3NTE A;  2XV6 A;  4WYM A;  5JPA A;  4PH1 A;  3G28 A;  3DS1 A;  2M8P A;  3G21 A;  3G26 A;  4U0F A;  3DPH A;  4M0I A;  4XFX A;  3G1G A;  4U0D A; 
#chains in the Genus database with same CATH topology
 4U0B A;  1VQL P;  2AF8 A;  2FVE A;  3EJB A;  4PXH B;  5HGN A;  2VLO A;  3CCE P;  2Z46 A;  3G0V A;  2JAZ A;  2FVF A;  2Z45 A;  1M6N A;  2OAR A;  4BPG A;  2ROQ A;  3HZQ A;  1HY8 A;  1E6J P;  4MRT C;  2XV6 A;  3H47 A;  3DPH A;  2LL8 A;  5JPA A;  3G1G A;  4BPF A;  2LML A;  1NJI Q;  2GZG A;  1NQ4 A;  3DS3 A;  1X3O A;  1W2B O;  2LF4 A;  5EJD A;  3CC2 P;  1RO0 A;  5KP7 B;  1GPJ A;  2JU2 A;  1D1D A;  1EMV A;  2K5X A;  2L4B A;  3G26 A;  2P9X A;  2VSQ A;  2VLP A;  2XT1 A;  2FAD A;  1YJN P;  3M1M A;  2FAC A;  1L0H A;  1AUM A;  2KGE A;  4NEO A;  1Q82 Q;  2N5H A;  3EJD A;  2PNG A;  2MR8 A;  4U0C A;  3MGE A;  5EW5 E;  1MZ8 A;  1Z6M A;  2FAE A;  5F2O A;  2JU1 A;  3DS0 A;  5KP6 B;  3B5I A;  1KQS O;  2PEK A;  2JYL A;  3H0D A;  3CXC O;  1A8O A;  2L9F A;  2GDX A;  1GXG A;  1QVF O;  2OTJ P;  3CCU P;  3CCJ P;  2JQ4 A;  4WYM A;  2PEM A;  2FQ2 A;  3GKL C;  2L6E A;  4IPY A;  3E2D A;  2GDW A;  2DGY A;  2K0X A;  1YIT P;  1IMQ A;  4XFY A;  3RG2 A;  2KG8 A;  3CMA P;  2LOL A;  1KD1 Q;  2CNR A;  1M90 Q;  1M1K Q;  2PY8 A;  1BAJ A;  2JO0 A;  4GR6 A;  2OTL P;  3GJN A;  2KGA A;  2K92 A;  2PEO A;  1BXI A;  2FQ0 A;  3DS4 A;  4UHP B;  4F37 A;  5F2K A;  2VLQ A;  1VQ8 P;  1JJ2 O;  1EIA A;  2KR5 A;  3G21 A;  2L0Q A;  4XRQ A;  2QA4 P;  2GZI A;  2X2B A;  2K0Y A;  2QEX P;  3CC7 P;  5DCK A;  5HGM A;  1DNY A;  3EJE A;  3LRY A;  2QNW A;  1RNI A;  2MVV A;  5HGL A;  2N6Y A;  3I55 P;  3LMO A;  2LTE A;  1K30 A;  4PH1 A;  1Q86 Q;  4CA3 A;  4GR2 A;  3OW2 O;  2EHT A;  2KOS A;  5F2N A;  1YI2 P;  3CCR P;  1CEI A;  1Q7Y Q;  2BHV A;  2FQ1 A;  2K2Q A;  1VQ5 P;  3NY7 B;  2JGP A;  1RO2 A;  2PEN A;  2KGD A;  3Q20 A;  1K73 Q;  1EOQ A;  1L0I A;  3GZL A;  1GXH A;  1ZMB A;  1KC8 Q;  2MY5 A;  3RG6 C;  5HVC A;  2CGQ A;  2M8N A;  1Q81 Q;  2KW2 A;  1OR5 A;  1QRJ A;  5BS1 A;  2K0D X;  2JYG A;  3CE7 A;  4HKG A;  2MF4 A;  3DS1 A;  4U0F A;  1K8A Q;  2ERH A;  4H2Y C;  2LIU A;  4QNB A;  4R0M A;  1F80 D;  5HGO A;  1N8R Q;  5BS2 A;  2M5R A;  3VRL C;  2WPT A;  4COC A;  2DNW A;  2N50 A;  2E1M A;  3B4Q A;  1A43 A;  2MR7 A;  3NTE A;  4DG9 A;  2GDY A;  1VHN A;  2KOO A;  2N6Z A;  4U0A A;  7CEI A;  4U0D A;  2GYK A;  3CD6 P;  2KG9 A;  1K9M Q;  1M6E X;  1KLP A;  1VQP P;  2KWL A;  2FHS C;  2KOR A;  5KP8 B;  3P05 A;  1VQ9 P;  1FR2 A;  2AVA A;  1AYI A;  2EHS A;  5I4T G;  1IMP A;  1ZNV A;  2PEQ A;  2LPK A;  2M8L A;  3CCM P;  4XRO A;  4COP A;  1M74 A;  2MVU A;  5HV8 A;  2EIA A;  3U43 A;  3G4S P;  2NO8 A;  1T8K A;  4H2W C;  2CWO A;  3I56 P;  4PWV B;  3WBH A;  1VQM P;  3G71 P;  1VQ7 P;  3CCS P;  3GZM A;  3CCV P;  1VKU A;  1YJ9 P;  3CC4 P;  4M0I A;  1HQB A;  2AFD A;  3CCQ P;  1E0H A;  2GZJ A;  1YIJ P;  2KGC A;  2K94 A;  2JBG A;  1IUQ A;  1UJZ A;  3CME P;  3G28 A;  2M8P A;  1VQN P;  2CQ8 A;  4IZ6 A;  3G29 A;  3G1I A;  1DV5 A;  1YJW P;  2FVA A;  2N98 A;  1VQ6 P;  2K93 A;  2KOQ A;  3HYB A;  2GZE A;  2JB0 A;  2LKI A;  2KG6 A;  1S72 P;  1VQ4 P;  4QKO A;  5CZD B;  2N5I A;  1UNK A;  2PEI A;  3DS2 A;  4U0E A;  2XZ1 C;  1AF8 A;  2AFE A;  2PEJ A;  4BPH A;  3G6E P;  2XZ0 D;  4XFX A;  2EG5 A;  2XXM A;  2CG5 B;  4PH0 A;  3DS5 A;  3DTJ A;  3CPW O;  1QVG O;  3H4E A;  2L22 A;  2KOD A;  4XFZ A;  2GZF A;  2BUO A;  2Z44 A;  1YHQ P;  1ACP A;  2LIW A;  3CCL P;  2MD9 A;  2EFJ A;  2KOP A;  2ONT A;  4H2X C;  2VLN A;  1VQK P;  1VQO P; 
#chains in the Genus database with same CATH homology
 2L6E A;  1KC8 Q;  3RG6 C;  4U0B A;  1VQL P;  4IPY A;  3E2D A;  3CCQ P;  5HGN A;  3CCE P;  2DGY A;  2Z46 A;  3G0V A;  1YIT P;  1YIJ P;  2M8N A;  1Q81 Q;  2Z45 A;  1M6N A;  2OAR A;  4XFY A;  1QRJ A;  3CMA P;  3HZQ A;  5BS1 A;  1IUQ A;  2JYG A;  1E6J P;  1KD1 Q;  2XV6 A;  3CME P;  3G28 A;  3DS1 A;  2M8P A;  3H47 A;  4U0F A;  3DPH A;  5JPA A;  1M90 Q;  3G1G A;  1M1K Q;  1VQN P;  1K8A Q;  1NJI Q;  3G29 A;  3DS3 A;  3G1I A;  2PY8 A;  1YJW P;  1BAJ A;  1W2B O;  2JO0 A;  4QNB A;  1VQ6 P;  5HGO A;  1N8R Q;  4GR6 A;  5BS2 A;  3HYB A;  2LF4 A;  3CC2 P;  2OTL P;  1RO0 A;  3VRL C;  2PEO A;  4COC A;  2E1M A;  3DS4 A;  5F2K A;  1VQ8 P;  1JJ2 O;  1A43 A;  1EIA A;  1VQ4 P;  1S72 P;  3NTE A;  1D1D A;  3G26 A;  3G21 A;  2P9X A;  4U0A A;  4U0D A;  4XRQ A;  2PEI A;  2XT1 A;  3DS2 A;  3CD6 P;  2QA4 P;  1YJN P;  1K9M Q;  1M6E X;  4U0E A;  3M1M A;  1AUM A;  2QEX P;  3CC7 P;  1VQP P;  5DCK A;  5HGM A;  1Q82 Q;  3LRY A;  1RNI A;  3P05 A;  1VQ9 P;  2PEJ A;  5HGL A;  3I55 P;  5I4T G;  4U0C A;  3MGE A;  2PEQ A;  2M8L A;  3CCM P;  4XRO A;  4COP A;  3G6E P;  1K30 A;  1M74 A;  4PH1 A;  1Q86 Q;  4XFX A;  5F2O A;  2EIA A;  4GR2 A;  3G4S P;  2EG5 A;  2XXM A;  3DS0 A;  3OW2 O;  4PH0 A;  5F2N A;  1YI2 P;  3B5I A;  3DS5 A;  3CCR P;  1KQS O;  2PEK A;  3DTJ A;  3CPW O;  1QVG O;  2CWO A;  2JYL A;  3H4E A;  3I56 P;  3WBH A;  1VQM P;  2KOD A;  3H0D A;  1Q7Y Q;  2BHV A;  4XFZ A;  3CXC O;  1A8O A;  2BUO A;  2Z44 A;  1YHQ P;  1VQ5 P;  3G71 P;  3CCL P;  1RO2 A;  1VQ7 P;  2PEN A;  2EFJ A;  3CCS P;  3CCV P;  2OTJ P;  2ONT A;  1QVF O;  3Q20 A;  1K73 Q;  3CCU P;  3CCJ P;  1EOQ A;  4WYM A;  2PEM A;  1YJ9 P;  3CC4 P;  1VQK P;  1VQO P;  4M0I A;  1ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...