2XV6A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords CAPSID PROTEIN P24
total genus 28
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xv6A00
4U0CA 1EIAA 3H47A 3G1IA 2XT1A 3VRLC 4U0AA 4WYMA 4XRQA 3LRYA 4XROA 4XFYA 2BUOA 2L6EA 3G21A 5HGNA 2XXMA 4U0BA 1AUMA 4XFXA 5HGOA 1EOQA 4QNBA 3DS0A 1A43A 3MGEA 4IPYA 1A8OA 2LF4A 5DCKA 5HGLA 5JPAA 4PH1A 2JYGA 2JO0A 2ONTA 2JYLA 3DTJA 2M8PA 1QRJA 4M0IA 2M8LA 3H4EA 3G1GA 3DS5A 3DS2A 3NTEA 3DS4A 3DPHA 5HGMA 3G29A 4U0DA 3P05A 4COPA 4COCA 4PH0A 1D1DA 1E6JP 4U0FA 2XV6A 3DS1A 2KODA 2EIAA 3G28A 4U0EA 1BAJA 3DS3A 4XFZA 3G26A 5I4TG 3G0VA 2M8NA
chains in the Genus database with same CATH superfamily
4WYMA 1ZNVA 1VQ5P 2KGCA 4IPYA 3CE7A 1L0IA 2JYGA 1M6EX 2PEKA 3HZQA 2KOPA 2ROQA 2PENA 4BPGA 1BAJA 1VQKP 3CC4P 3Q20A 1MZ8A 2FVAA 1K9MQ 4QKOA 3DS5A 2GZEA 2X2BA 2VLNA 3I55P 3DPHA 2L22A 4CA3A 2FACA 3DS3A 1Q7YQ 4XFZA 2MVUA 3G0VA 2GZJA 1YJ9P 4U0CA 5F2OA 1HY8A 2LKIA 3LRYA 3CCLP 2XXMA 2K92A 2KGAA 2NO8A 2KG6A 2BHVA 1VQ8P 2QNWA 1M90Q 2GZFA 2XV6A 5KP8B 2KODA 2QEXP 5I4TG 4H2WC 3H0DA 4PWVB 2MD9A 3CCMP 4XFXA 2KGEA 5HGLA 3GZMA 2N6YA 3LMOA 2MF4A 4HKGA 2CQ8A 3GKLC 1ZMBA 2CG5B 3EJBA 3G21A 2PEIA 4QNBA 2P9XA 3CCRP 1N8RQ 5EJDA 2KORA 1VKUA 3H4EA 2CWOA 1UNKA 2Z44A 3DS4A 3CCVP 3P05A 2QA4P 1M1KQ 1Q86Q 1L0HA 2FVEA 1YITP 2MY5A 1S72P 2AF8A 2FQ0A 2AFEA 4XFYA 3G71P 5BS2A 1A8OA 2EFJA 2KR5A 2JO0A 3G6EP 3CD6P 4COCA 2JB0A 2KG9A 1IMQA 4MRTC 3HYBA 2VLQA 3CC7P 1VQNP 5CZDB 5KP7B 2L4BA 2GDWA 2BUOA 2L6EA 5F2KA 1VQPP 5KP6B 2FADA 3DTJA 1AF8A 2JBGA 3U43A 2VSQA 2OTJP 4PH0A 4DG9A 3B5IA 2FHSC 3RG2A 2VLOA 1RNIA 1EIAA 2LL8A 4U0AA 1FR2A 2JGPA 3MGEA 5DCKA 2KOQA 4PH1A 1VQMP 2Z45A 1NQ4A 2JYLA 3E2DA 4R0MA 2PEMA 3CCJP 2K94A 2MR7A 4XRQA 1EOQA 1YIJP 1K73Q 3CXCO 2ONTA 4BPFA 1M74A 2E1MA 2PNGA 2EHTA 4U0EA 2AVAA 2XZ1C 3CCUP 3WBHA 1VHNA 2DNWA 1DNYA 1VQLP 2KGDA 1A43A 3DS0A 1M6NA 2LF4A 1VQOP 2FVFA 5EW5E 7CEIA 4M0IA 3CCQP 5HGMA 3DS1A 5HV8A 1VQ7P 1YI2P 2N5HA 3G26A 1Q81Q 2K5XA 1BXIA 4PXHB 2GZGA 3H47A 2L9FA 3OW2O 2XT1A 3GZLA 3RG6C 1X3OA 5HGOA 4BPHA 4NEOA 2LPKA 2M5RA 2LTEA 2Z46A 1F80D 2L0QA 2M8LA 2GZIA 5HVCA 3G29A 1E0HA 1IMPA 3CPWO 1K8AQ 3G28A 1RO0A 1UJZA 3CC2P 1YJWP 2OTLP 1IUQA 1AUMA 2CNRA 3I56P 2KWLA 2M8PA 2VLPA 3CMEP 1KQSO 1KD1Q 1Z6MA 2PEOA 1CEIA 1OR5A 4U0FA 4F37A 3M1MA 2EIAA 3G4SP 2PEJA 2MVVA 4XROA 2FQ1A 1YJNP 2N5IA 4UHPB 1GXGA 2AFDA 3NY7B 3GJNA 2KW2A 1K30A 3DS2A 3NTEA 2GDYA 2EHSA 2KOSA 2KG8A 1VQ4P 2K0XA 2LIUA 2LOLA 1GXHA 3G1IA 2FAEA 2LIWA 2WPTA 1ACPA 2GYKA 2MR8A 1T8KA 2PY8A 1GPJA 2K93A 5BS1A 1D1DA 1E6JP 2N50A 2N98A 1DV5A 2EG5A 2JU1A 3B4QA 2JU2A 2GDXA 2CGQA 5HGNA 1EMVA 1VQ6P 5JPAA 1W2BO 2N6ZA 1HQBA 4GR2A 1KLPA 1QVGO 4H2XC 1KC8Q 1QVFO 2JAZA 3EJEA 3CCSP 4H2YC 4IZ6A 2OARA 4COPA 2KOOA 5F2NA 2DGYA 2K0DX 2M8NA 3VRLC 1VQ9P 1NJIQ 2FQ2A 2LMLA 2K2QA 2K0YA 4U0BA 2ERHA 2PEQA 1YHQP 1QRJA 3G1GA 2XZ0D 4GR6A 3CCEP 4U0DA 1RO2A 1AYIA 3CMAP 3EJDA 2JQ4A 1Q82Q 1JJ2O
chains in the Genus database with same CATH topology
1ZMBA 4XRQA 4WYMA 4XROA 3G21A 1VQ5P 2PEIA 1EOQA 4QNBA 1YJNP 4IPYA 2P9XA 3CCRP 1N8RQ 1YIJP 1K73Q 3CXCO 2JYGA 2ONTA 1M6EX 2PEKA 3H4EA 1K30A 2CWOA 3DS2A 3HZQA 3NTEA 1M74A 2Z44A 3DS4A 2E1MA 3CCVP 3P05A 2PENA 2QA4P 4U0EA 1VQ4P 1BAJA 1M1KQ 1VQKP 3CCUP 1Q86Q 3CC4P 1YITP 1S72P 3Q20A 3WBHA 3G1IA 4XFYA 1VQLP 1K9MQ 3G71P 5BS2A 3DS0A 1A43A 1M6NA 1A8OA 2EFJA 2LF4A 1VQOP 1Q82Q 2JO0A 3G6EP 4M0IA 3CD6P 3DS5A 2PY8A 3CCQP 3I55P 3DPHA 5HGMA 4COCA 5BS1A 1D1DA 1E6JP 3DS1A 1VQ7P 1YI2P 2EG5A 3DS3A 1Q7YQ 4XFZA 3G26A 3G0VA 1Q81Q 3CC7P 1YJ9P 4U0CA 5F2OA 3H47A 3OW2O 1VQNP 2XT1A 3LRYA 3RG6C 5HGNA 2BUOA 2L6EA 5HGOA 3CCLP 2XXMA 1VQ6P 5F2KA 1VQPP 5JPAA 1W2BO 2BHVA 4GR2A 2Z46A 3DTJA 1QVGO 2M8LA 1VQ8P 1KC8Q 1QVFO 3CCSP 1M90Q 2OTJP 3G29A 2OARA 4COPA 4PH0A 2XV6A 3B5IA 5F2NA 2KODA 3CPWO 3G28A 2QEXP 1K8AQ 1RO0A 2DGYA 5I4TG 1JJ2O 3CC2P 2M8NA 1RNIA 1EIAA 3H0DA 3VRLC 1VQ9P 4U0AA 1YJWP 1NJIQ 2OTLP 3CCMP 1IUQA 4XFXA 4U0BA 1AUMA 3MGEA 5HGLA 5DCKA 2PEQA 4PH1A 3I56P 1VQMP 1YHQP 2Z45A 2JYLA 2M8PA 1QRJA 3E2DA 3CMEP 3G1GA 1KQSO 1KD1Q 2PEOA 2PEMA 4GR6A 3CCEP 4U0DA 1RO2A 3CMAP 4U0FA 3CCJP 3M1MA 2EIAA 3G4SP 2PEJA 3HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0C A;  1EIA A;  3H47 A;  3G1I A;  2XT1 A;  3VRL C;  4U0A A;  4WYM A;  4XRQ A;  3LRY A;  4XRO A;  4XFY A;  2BUO A;  2L6E A;  3G21 A;  5HGN A;  2XXM A;  4U0B A;  1AUM A;  4XFX A;  5HGO A;  1EOQ A;  4QNB A;  3DS0 A;  1A43 A;  3MGE A;  4IPY A;  1A8O A;  2LF4 A;  5DCK A;  5HGL A;  5JPA A;  4PH1 A;  2JYG A;  2JO0 A;  2ONT A;  2JYL A;  3DTJ A;  2M8P A;  1QRJ A;  4M0I A;  2M8L A;  3H4E A;  3G1G A;  3DS5 A;  3DS2 A;  3NTE A;  3DS4 A;  3DPH A;  5HGM A;  3G29 A;  4U0D A;  3P05 A;  4COP A;  4COC A;  4PH0 A;  1D1D A;  1E6J P;  4U0F A;  2XV6 A;  3DS1 A;  2KOD A;  2EIA A;  3G28 A;  4U0E A;  1BAJ A;  3DS3 A;  4XFZ A;  3G26 A;  5I4T G;  3G0V A;  2M8N A; 
#chains in the Genus database with same CATH topology
 4WYM A;  1ZNV A;  1VQ5 P;  2KGC A;  4IPY A;  3CE7 A;  1L0I A;  2JYG A;  1M6E X;  2PEK A;  3HZQ A;  2KOP A;  2ROQ A;  2PEN A;  4BPG A;  1BAJ A;  1VQK P;  3CC4 P;  3Q20 A;  1MZ8 A;  2FVA A;  1K9M Q;  4QKO A;  3DS5 A;  2GZE A;  2X2B A;  2VLN A;  3I55 P;  3DPH A;  2L22 A;  4CA3 A;  2FAC A;  3DS3 A;  1Q7Y Q;  4XFZ A;  2MVU A;  3G0V A;  2GZJ A;  1YJ9 P;  4U0C A;  5F2O A;  1HY8 A;  2LKI A;  3LRY A;  3CCL P;  2XXM A;  2K92 A;  2KGA A;  2NO8 A;  2KG6 A;  2BHV A;  1VQ8 P;  2QNW A;  1M90 Q;  2GZF A;  2XV6 A;  5KP8 B;  2KOD A;  2QEX P;  5I4T G;  4H2W C;  3H0D A;  4PWV B;  2MD9 A;  3CCM P;  4XFX A;  2KGE A;  5HGL A;  3GZM A;  2N6Y A;  3LMO A;  2MF4 A;  4HKG A;  2CQ8 A;  3GKL C;  1ZMB A;  2CG5 B;  3EJB A;  3G21 A;  2PEI A;  4QNB A;  2P9X A;  3CCR P;  1N8R Q;  5EJD A;  2KOR A;  1VKU A;  3H4E A;  2CWO A;  1UNK A;  2Z44 A;  3DS4 A;  3CCV P;  3P05 A;  2QA4 P;  1M1K Q;  1Q86 Q;  1L0H A;  2FVE A;  1YIT P;  2MY5 A;  1S72 P;  2AF8 A;  2FQ0 A;  2AFE A;  4XFY A;  3G71 P;  5BS2 A;  1A8O A;  2EFJ A;  2KR5 A;  2JO0 A;  3G6E P;  3CD6 P;  4COC A;  2JB0 A;  2KG9 A;  1IMQ A;  4MRT C;  3HYB A;  2VLQ A;  3CC7 P;  1VQN P;  5CZD B;  5KP7 B;  2L4B A;  2GDW A;  2BUO A;  2L6E A;  5F2K A;  1VQP P;  5KP6 B;  2FAD A;  3DTJ A;  1AF8 A;  2JBG A;  3U43 A;  2VSQ A;  2OTJ P;  4PH0 A;  4DG9 A;  3B5I A;  2FHS C;  3RG2 A;  2VLO A;  1RNI A;  1EIA A;  2LL8 A;  4U0A A;  1FR2 A;  2JGP A;  3MGE A;  5DCK A;  2KOQ A;  4PH1 A;  1VQM P;  2Z45 A;  1NQ4 A;  2JYL A;  3E2D A;  4R0M A;  2PEM A;  3CCJ P;  2K94 A;  2MR7 A;  4XRQ A;  1EOQ A;  1YIJ P;  1K73 Q;  3CXC O;  2ONT A;  4BPF A;  1M74 A;  2E1M A;  2PNG A;  2EHT A;  4U0E A;  2AVA A;  2XZ1 C;  3CCU P;  3WBH A;  1VHN A;  2DNW A;  1DNY A;  1VQL P;  2KGD A;  1A43 A;  3DS0 A;  1M6N A;  2LF4 A;  1VQO P;  2FVF A;  5EW5 E;  7CEI A;  4M0I A;  3CCQ P;  5HGM A;  3DS1 A;  5HV8 A;  1VQ7 P;  1YI2 P;  2N5H A;  3G26 A;  1Q81 Q;  2K5X A;  1BXI A;  4PXH B;  2GZG A;  3H47 A;  2L9F A;  3OW2 O;  2XT1 A;  3GZL A;  3RG6 C;  1X3O A;  5HGO A;  4BPH A;  4NEO A;  2LPK A;  2M5R A;  2LTE A;  2Z46 A;  1F80 D;  2L0Q A;  2M8L A;  2GZI A;  5HVC A;  3G29 A;  1E0H A;  1IMP A;  3CPW O;  1K8A Q;  3G28 A;  1RO0 A;  1UJZ A;  3CC2 P;  1YJW P;  2OTL P;  1IUQ A;  1AUM A;  2CNR A;  3I56 P;  2KWL A;  2M8P A;  2VLP A;  3CME P;  1KQS O;  1KD1 Q;  1Z6M A;  2PEO A;  1CEI A;  1OR5 A;  4U0F A;  4F37 A;  3M1M A;  2EIA A;  3G4S P;  2PEJ A;  2MVV A;  4XRO A;  2FQ1 A;  1YJN P;  2N5I A;  4UHP B;  1GXG A;  2AFD A;  3NY7 B;  3GJN A;  2KW2 A;  1K30 A;  3DS2 A;  3NTE A;  2GDY A;  2EHS A;  2KOS A;  2KG8 A;  1VQ4 P;  2K0X A;  2LIU A;  2LOL A;  1GXH A;  3G1I A;  2FAE A;  2LIW A;  2WPT A;  1ACP A;  2GYK A;  2MR8 A;  1T8K A;  2PY8 A;  1GPJ A;  2K93 A;  5BS1 A;  1D1D A;  1E6J P;  2N50 A;  2N98 A;  1DV5 A;  2EG5 A;  2JU1 A;  3B4Q A;  2JU2 A;  2GDX A;  2CGQ A;  5HGN A;  1EMV A;  1VQ6 P;  5JPA A;  1W2B O;  2N6Z A;  1HQB A;  4GR2 A;  1KLP A;  1QVG O;  4H2X C;  1KC8 Q;  1QVF O;  2JAZ A;  3EJE A;  3CCS P;  4H2Y C;  4IZ6 A;  2OAR A;  4COP A;  2KOO A;  5F2N A;  2DGY A;  2K0D X;  2M8N A;  3VRL C;  1VQ9 P;  1NJI Q;  2FQ2 A;  2LML A;  2K2Q A;  2K0Y A;  4U0B A;  2ERH A;  2PEQ A;  1YHQ P;  1QRJ A;  3G1G A;  2XZ0 D;  4GR6 A;  3CCE P;  4U0D A;  1RO2 A;  1AYI A;  3CMA P;  3EJD A;  2JQ4 A;  1Q82 Q;  1JJ2 O; 
#chains in the Genus database with same CATH homology
 1ZMB A;  4XRQ A;  4WYM A;  4XRO A;  3G21 A;  1VQ5 P;  2PEI A;  1EOQ A;  4QNB A;  1YJN P;  4IPY A;  2P9X A;  3CCR P;  1N8R Q;  1YIJ P;  1K73 Q;  3CXC O;  2JYG A;  2ONT A;  1M6E X;  2PEK A;  3H4E A;  1K30 A;  2CWO A;  3DS2 A;  3HZQ A;  3NTE A;  1M74 A;  2Z44 A;  3DS4 A;  2E1M A;  3CCV P;  3P05 A;  2PEN A;  2QA4 P;  4U0E A;  1VQ4 P;  1BAJ A;  1M1K Q;  1VQK P;  3CCU P;  1Q86 Q;  3CC4 P;  1YIT P;  1S72 P;  3Q20 A;  3WBH A;  3G1I A;  4XFY A;  1VQL P;  1K9M Q;  3G71 P;  5BS2 A;  3DS0 A;  1A43 A;  1M6N A;  1A8O A;  2EFJ A;  2LF4 A;  1VQO P;  1Q82 Q;  2JO0 A;  3G6E P;  4M0I A;  3CD6 P;  3DS5 A;  2PY8 A;  3CCQ P;  3I55 P;  3DPH A;  5HGM A;  4COC A;  5BS1 A;  1D1D A;  1E6J P;  3DS1 A;  1VQ7 P;  1YI2 P;  2EG5 A;  3DS3 A;  1Q7Y Q;  4XFZ A;  3G26 A;  3G0V A;  1Q81 Q;  3CC7 P;  1YJ9 P;  4U0C A;  5F2O A;  3H47 A;  3OW2 O;  1VQN P;  2XT1 A;  3LRY A;  3RG6 C;  5HGN A;  2BUO A;  2L6E A;  5HGO A;  3CCL P;  2XXM A;  1VQ6 P;  5F2K A;  1VQP P;  5JPA A;  1W2B O;  2BHV A;  4GR2 A;  2Z46 A;  3DTJ A;  1QVG O;  2M8L A;  1VQ8 P;  1KC8 Q;  1QVF O;  3CCS P;  1M90 Q;  2OTJ P;  3G29 A;  2OAR A;  4COP A;  4PH0 A;  2XV6 A;  3B5I A;  5F2N A;  2KOD A;  3CPW O;  3G28 A;  2QEX P;  1K8A Q;  1RO0 A;  2DGY A;  5I4T G;  1JJ2 O;  3CC2 P;  2M8N A;  1RNI A;  1EIA A;  3H0D A;  3VRL C;  1VQ9 P;  4U0A A;  1YJW P;  1NJI Q;  2OTL P;  3CCM P;  1IUQ A;  4XFX A;  4U0B A;  1AUM A;  3MGE A;  5HGL A;  5DCK A;  2PEQ A;  4PH1 A;  3I56 P;  1VQM P;  1YHQ P;  2Z45 A;  2JYL A;  2M8P A;  1QRJ A;  3E2D A;  3CME P;  3G1G A;  1KQS O;  1KD1 Q;  2PEO A;  2PEM A;  4GR6 A;  3CCE P;  4U0D A;  1RO2 A;  3CMA P;  4U0F A;  3CCJ P;  3M1M A;  2EIA A;  3G4S P;  2PEJ A;  3HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...