2XV6A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 28
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xv6A00
3DTJA 4XFXA 5HGMA 4U0AA 5JPAA 2M8PA 2M8LA 4U0DA 1A8OA 5HGOA 3DS1A 3DS4A 3G28A 3G29A 3G26A 2L6EA 3G21A 3LRYA 3DS3A 5HGNA 1AUMA 1A43A 2LF4A 3H4EA 4M0IA 2XT1A 2XV6A 3G1GA 4COCA 2ONTA 3P05A 4COPA 4WYMA 4QNBA 3DS5A 4U0FA 3G0VA 1QRJA 1EOQA 3DS0A 2KODA 4IPYA 2JYLA 4PH1A 4U0BA 4XFZA 2XXMA 1E6JP 1D1DA 4XROA 5I4TG 3MGEA 4U0CA 3NTEA 2JYGA 5DCKA 4XRQA 2EIAA 3VRLC 1BAJA 3DPHA 5HGLA 3DS2A 1EIAA 4U0EA 4XFYA 3G1IA 2JO0A 2M8NA 3H47A 2BUOA 4PH0A
chains in the Genus database with same CATH superfamily
4PWVB 2MF4A 2E1MA 5EW5E 4COPA 2N6ZA 2CG5B 3CC2P 2K93A 4HKGA 3E2DA 1D1DA 3M1MA 5F2NA 3CCEP 2GYKA 5CZDB 3CXCO 1JJ2O 2BUOA 1VQ6P 2PEMA 3LMOA 3H4EA 3CCQP 4NEOA 1GXHA 2PEKA 2JYGA 3EJDA 3VRLC 5EJDA 3DPHA 2GDXA 5BS1A 1AF8A 3CCMP 1VQPP 5BS2A 1IUQA 1A8OA 2QNWA 1AYIA 2JQ4A 1VQ8P 2ONTA 3P05A 3CC4P 2JU2A 2KGEA 1YI2P 1BXIA 2PEIA 2K92A 2EIAA 1VQLP 1ACPA 2PEQA 4H2YC 1Q86Q 1DV5A 2VSQA 5KP6B 2L4BA 1K30A 2KGDA 1DNYA 4R0MA 2GZFA 2GZEA 2K94A 3G21A 2QEXP 1YITP 1ZNVA 2AFDA 3G6EP 3GZMA 2JB0A 1M74A 1E6JP 1M6NA 3HYBA 2EG5A 4IZ6A 1GXGA 2KORA 1KD1Q 2PY8A 1MZ8A 1NJIQ 3G29A 3G26A 2M5RA 1L0HA 1A43A 3GZLA 2ERHA 4U0BA 2MD9A 1HQBA 4PH1A 2JBGA 3CD6P 2GDYA 2KG6A 2PENA 1VHNA 2KWLA 3RG2A 3CMAP 1M1KQ 1L0IA 4BPGA 3H47A 4H2WC 5HGMA 2N98A 1YJNP 3G28A 3RG6C 3DS3A 2LF4A 2XT1A 1VQOP 4COCA 3B4QA 2KOOA 1NQ4A 4MRTC 7CEIA 2LMLA 2AF8A 5HGLA 2GZIA 2X2BA 2NO8A 2VLNA 1E0HA 4GR6A 3CCJP 2BHVA 2Z44A 1RO2A 2KGAA 2GDWA 3LRYA 2L6EA 1AUMA 2VLPA 2EHSA 2OARA 2K2QA 1N8RQ 1KLPA 2LTEA 3GKLC 3GJNA 2N50A 1VQKP 1YIJP 2JGPA 2VLQA 2L22A 4XFYA 1EIAA 3G1IA 2Z45A 1YJ9P 3Q20A 5HV8A 1CEIA 3G71P 3CCSP 2CQ8A 2CGQA 3EJBA 5HGNA 2MVVA 1QVFO 4BPHA 1QRJA 2GZJA 2LIWA 4CA3A 1BAJA 2AVAA 3HZQA 1IMPA 2P9XA 2PNGA 2M8NA 4DG9A 2FHSC 2PEOA 2VLOA 4XFXA 1VQ9P 4U0DA 1VQ5P 2EHTA 3DS5A 2JAZA 3G0VA 1VQNP 2LL8A 4XFZA 4XROA 1K73Q 2DGYA 2QA4P 2CNRA 1QVGO 4QKOA 2FQ0A 5JPAA 4PXHB 1Q7YQ 2KGCA 1VQMP 1EOQA 1T8KA 1Z6MA 2FVFA 2PEJA 5F2KA 3CPWO 4PH0A 3DTJA 2OTJP 5HGOA 3CMEP 2AFEA 2DNWA 2GZGA 2LIUA 3CCRP 3G1GA 3CC7P 4WYMA 4QNBA 3I55P 1VQ7P 2FVAA 2WPTA 1Q82Q 1HY8A 3EJEA 1OR5A 2KR5A 3DS2A 4U0EA 2EFJA 2N6YA 1ZMBA 2K0XA 1UJZA 3G4SP 1F80D 1S72P 4F37A 1EMVA 1KC8Q 4M0IA 2XV6A 3H0DA 3OW2O 3DS0A 1M6EX 2LPKA 2FQ1A 2XZ0D 4U0CA 2KG9A 2N5HA 2FACA 5HVCA 2ROQA 2MVUA 3CCLP 4U0AA 2M8LA 2LKIA 1FR2A 2MR7A 1UNKA 3B5IA 2K5XA 3NY7B 4U0FA 4IPYA 1YJWP 4GR2A 5I4TG 4UHPB 3NTEA 3U43A 2FAEA 1GPJA 1Q81Q 2OTLP 2KOPA 2N5IA 2FQ2A 3CCUP 2K0YA 2M8PA 1RNIA 2KG8A 1W2BO 3DS4A 5F2OA 3WBHA 3CE7A 2XXMA 3I56P 5KP8B 2KOQA 2L9FA 2Z46A 1M90Q 1K9MQ 2JYLA 4BPFA 1KQSO 4H2XC 2CWOA 1VKUA 2MY5A 2L0QA 1X3OA 2LOLA 3DS1A 2K0DX 2KOSA 2KODA 2FVEA 3MGEA 2JU1A 5DCKA 4XRQA 1K8AQ 1IMQA 2MR8A 2XZ1C 1YHQP 1RO0A 2KW2A 1VQ4P 5KP7B 2JO0A 2FADA 3CCVP
chains in the Genus database with same CATH topology
4XFXA 1VQ9P 1KD1Q 4U0AA 2PY8A 2M8LA 4U0DA 1VQ5P 1NJIQ 2E1MA 3G29A 3G26A 1A43A 3B5IA 4COPA 3DS5A 3CC2P 4U0FA 3G0VA 4U0BA 4IPYA 4PH1A 3E2DA 1VQNP 1D1DA 4XFZA 1YJWP 4GR2A 3CD6P 4XROA 3M1MA 5I4TG 3NTEA 1K73Q 5F2NA 1Q81Q 2PENA 3CCEP 2OTLP 2DGYA 2QA4P 3CXCO 3CMAP 1M1KQ 1JJ2O 1QVGO 3H47A 2BUOA 5JPAA 1Q7YQ 5HGMA 3CCUP 1YJNP 2M8PA 1RNIA 1VQ6P 1VQMP 2PEMA 3G28A 3DS4A 1W2BO 3RG6C 3DS3A 5F2OA 3H4EA 2LF4A 3CCQP 2XT1A 1VQOP 4COCA 3WBHA 1EOQA 2XXMA 3I56P 2PEKA 2JYGA 3VRLC 3DPHA 5HGLA 2Z46A 1M90Q 2PEJA 5F2KA 3CPWO 4PH0A 5BS1A 3CCMP 3DTJA 4GR6A 1VQPP 3CCJP 2OTJP 2BHVA 2Z44A 5BS2A 1RO2A 1IUQA 1A8OA 5HGOA 3CMEP 3LRYA 2L6EA 1AUMA 1K9MQ 1VQ8P 3CCRP 3G1GA 2ONTA 3P05A 3CC7P 4WYMA 4QNBA 2OARA 3CC4P 3I55P 1VQ7P 1YI2P 2JYLA 1Q82Q 1N8RQ 2PEIA 2EIAA 1VQKP 1VQLP 1YIJP 3DS2A 1EIAA 2EFJA 4U0EA 1ZMBA 3G1IA 2PEQA 2Z45A 4XFYA 1KQSO 3G4SP 1YJ9P 2CWOA 1Q86Q 3Q20A 3G71P 1S72P 3CCSP 1K30A 3DS1A 5HGNA 3G21A 1KC8Q 2QEXP 4M0IA 1YITP 2XV6A 3G6EP 1QVFO 3H0DA 3OW2O 1M74A 1QRJA 3DS0A 1M6EX 2KODA 1E6JP 1M6NA 3MGEA 4U0CA 5DCKA 4XRQA 1K8AQ 3HYBA 1BAJA 1YHQP 1RO0A 2EG5A 3HZQA 1VQ4P 3CCLP 2P9XA 2JO0A 2M8NA 2PEOA 3CCVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DTJ A;  4XFX A;  5HGM A;  4U0A A;  5JPA A;  2M8P A;  2M8L A;  4U0D A;  1A8O A;  5HGO A;  3DS1 A;  3DS4 A;  3G28 A;  3G29 A;  3G26 A;  2L6E A;  3G21 A;  3LRY A;  3DS3 A;  5HGN A;  1AUM A;  1A43 A;  2LF4 A;  3H4E A;  4M0I A;  2XT1 A;  2XV6 A;  3G1G A;  4COC A;  2ONT A;  3P05 A;  4COP A;  4WYM A;  4QNB A;  3DS5 A;  4U0F A;  3G0V A;  1QRJ A;  1EOQ A;  3DS0 A;  2KOD A;  4IPY A;  2JYL A;  4PH1 A;  4U0B A;  4XFZ A;  2XXM A;  1E6J P;  1D1D A;  4XRO A;  5I4T G;  3MGE A;  4U0C A;  3NTE A;  2JYG A;  5DCK A;  4XRQ A;  2EIA A;  3VRL C;  1BAJ A;  3DPH A;  5HGL A;  3DS2 A;  1EIA A;  4U0E A;  4XFY A;  3G1I A;  2JO0 A;  2M8N A;  3H47 A;  2BUO A;  4PH0 A; 
#chains in the Genus database with same CATH topology
 4PWV B;  2MF4 A;  2E1M A;  5EW5 E;  4COP A;  2N6Z A;  2CG5 B;  3CC2 P;  2K93 A;  4HKG A;  3E2D A;  1D1D A;  3M1M A;  5F2N A;  3CCE P;  2GYK A;  5CZD B;  3CXC O;  1JJ2 O;  2BUO A;  1VQ6 P;  2PEM A;  3LMO A;  3H4E A;  3CCQ P;  4NEO A;  1GXH A;  2PEK A;  2JYG A;  3EJD A;  3VRL C;  5EJD A;  3DPH A;  2GDX A;  5BS1 A;  1AF8 A;  3CCM P;  1VQP P;  5BS2 A;  1IUQ A;  1A8O A;  2QNW A;  1AYI A;  2JQ4 A;  1VQ8 P;  2ONT A;  3P05 A;  3CC4 P;  2JU2 A;  2KGE A;  1YI2 P;  1BXI A;  2PEI A;  2K92 A;  2EIA A;  1VQL P;  1ACP A;  2PEQ A;  4H2Y C;  1Q86 Q;  1DV5 A;  2VSQ A;  5KP6 B;  2L4B A;  1K30 A;  2KGD A;  1DNY A;  4R0M A;  2GZF A;  2GZE A;  2K94 A;  3G21 A;  2QEX P;  1YIT P;  1ZNV A;  2AFD A;  3G6E P;  3GZM A;  2JB0 A;  1M74 A;  1E6J P;  1M6N A;  3HYB A;  2EG5 A;  4IZ6 A;  1GXG A;  2KOR A;  1KD1 Q;  2PY8 A;  1MZ8 A;  1NJI Q;  3G29 A;  3G26 A;  2M5R A;  1L0H A;  1A43 A;  3GZL A;  2ERH A;  4U0B A;  2MD9 A;  1HQB A;  4PH1 A;  2JBG A;  3CD6 P;  2GDY A;  2KG6 A;  2PEN A;  1VHN A;  2KWL A;  3RG2 A;  3CMA P;  1M1K Q;  1L0I A;  4BPG A;  3H47 A;  4H2W C;  5HGM A;  2N98 A;  1YJN P;  3G28 A;  3RG6 C;  3DS3 A;  2LF4 A;  2XT1 A;  1VQO P;  4COC A;  3B4Q A;  2KOO A;  1NQ4 A;  4MRT C;  7CEI A;  2LML A;  2AF8 A;  5HGL A;  2GZI A;  2X2B A;  2NO8 A;  2VLN A;  1E0H A;  4GR6 A;  3CCJ P;  2BHV A;  2Z44 A;  1RO2 A;  2KGA A;  2GDW A;  3LRY A;  2L6E A;  1AUM A;  2VLP A;  2EHS A;  2OAR A;  2K2Q A;  1N8R Q;  1KLP A;  2LTE A;  3GKL C;  3GJN A;  2N50 A;  1VQK P;  1YIJ P;  2JGP A;  2VLQ A;  2L22 A;  4XFY A;  1EIA A;  3G1I A;  2Z45 A;  1YJ9 P;  3Q20 A;  5HV8 A;  1CEI A;  3G71 P;  3CCS P;  2CQ8 A;  2CGQ A;  3EJB A;  5HGN A;  2MVV A;  1QVF O;  4BPH A;  1QRJ A;  2GZJ A;  2LIW A;  4CA3 A;  1BAJ A;  2AVA A;  3HZQ A;  1IMP A;  2P9X A;  2PNG A;  2M8N A;  4DG9 A;  2FHS C;  2PEO A;  2VLO A;  4XFX A;  1VQ9 P;  4U0D A;  1VQ5 P;  2EHT A;  3DS5 A;  2JAZ A;  3G0V A;  1VQN P;  2LL8 A;  4XFZ A;  4XRO A;  1K73 Q;  2DGY A;  2QA4 P;  2CNR A;  1QVG O;  4QKO A;  2FQ0 A;  5JPA A;  4PXH B;  1Q7Y Q;  2KGC A;  1VQM P;  1EOQ A;  1T8K A;  1Z6M A;  2FVF A;  2PEJ A;  5F2K A;  3CPW O;  4PH0 A;  3DTJ A;  2OTJ P;  5HGO A;  3CME P;  2AFE A;  2DNW A;  2GZG A;  2LIU A;  3CCR P;  3G1G A;  3CC7 P;  4WYM A;  4QNB A;  3I55 P;  1VQ7 P;  2FVA A;  2WPT A;  1Q82 Q;  1HY8 A;  3EJE A;  1OR5 A;  2KR5 A;  3DS2 A;  4U0E A;  2EFJ A;  2N6Y A;  1ZMB A;  2K0X A;  1UJZ A;  3G4S P;  1F80 D;  1S72 P;  4F37 A;  1EMV A;  1KC8 Q;  4M0I A;  2XV6 A;  3H0D A;  3OW2 O;  3DS0 A;  1M6E X;  2LPK A;  2FQ1 A;  2XZ0 D;  4U0C A;  2KG9 A;  2N5H A;  2FAC A;  5HVC A;  2ROQ A;  2MVU A;  3CCL P;  4U0A A;  2M8L A;  2LKI A;  1FR2 A;  2MR7 A;  1UNK A;  3B5I A;  2K5X A;  3NY7 B;  4U0F A;  4IPY A;  1YJW P;  4GR2 A;  5I4T G;  4UHP B;  3NTE A;  3U43 A;  2FAE A;  1GPJ A;  1Q81 Q;  2OTL P;  2KOP A;  2N5I A;  2FQ2 A;  3CCU P;  2K0Y A;  2M8P A;  1RNI A;  2KG8 A;  1W2B O;  3DS4 A;  5F2O A;  3WBH A;  3CE7 A;  2XXM A;  3I56 P;  5KP8 B;  2KOQ A;  2L9F A;  2Z46 A;  1M90 Q;  1K9M Q;  2JYL A;  4BPF A;  1KQS O;  4H2X C;  2CWO A;  1VKU A;  2MY5 A;  2L0Q A;  1X3O A;  2LOL A;  3DS1 A;  2K0D X;  2KOS A;  2KOD A;  2FVE A;  3MGE A;  2JU1 A;  5DCK A;  4XRQ A;  1K8A Q;  1IMQ A;  2MR8 A;  2XZ1 C;  1YHQ P;  1RO0 A;  2KW2 A;  1VQ4 P;  5KP7 B;  2JO0 A;  2FAD A;  3CCV P; 
#chains in the Genus database with same CATH homology
 4XFX A;  1VQ9 P;  1KD1 Q;  4U0A A;  2PY8 A;  2M8L A;  4U0D A;  1VQ5 P;  1NJI Q;  2E1M A;  3G29 A;  3G26 A;  1A43 A;  3B5I A;  4COP A;  3DS5 A;  3CC2 P;  4U0F A;  3G0V A;  4U0B A;  4IPY A;  4PH1 A;  3E2D A;  1VQN P;  1D1D A;  4XFZ A;  1YJW P;  4GR2 A;  3CD6 P;  4XRO A;  3M1M A;  5I4T G;  3NTE A;  1K73 Q;  5F2N A;  1Q81 Q;  2PEN A;  3CCE P;  2OTL P;  2DGY A;  2QA4 P;  3CXC O;  3CMA P;  1M1K Q;  1JJ2 O;  1QVG O;  3H47 A;  2BUO A;  5JPA A;  1Q7Y Q;  5HGM A;  3CCU P;  1YJN P;  2M8P A;  1RNI A;  1VQ6 P;  1VQM P;  2PEM A;  3G28 A;  3DS4 A;  1W2B O;  3RG6 C;  3DS3 A;  5F2O A;  3H4E A;  2LF4 A;  3CCQ P;  2XT1 A;  1VQO P;  4COC A;  3WBH A;  1EOQ A;  2XXM A;  3I56 P;  2PEK A;  2JYG A;  3VRL C;  3DPH A;  5HGL A;  2Z46 A;  1M90 Q;  2PEJ A;  5F2K A;  3CPW O;  4PH0 A;  5BS1 A;  3CCM P;  3DTJ A;  4GR6 A;  1VQP P;  3CCJ P;  2OTJ P;  2BHV A;  2Z44 A;  5BS2 A;  1RO2 A;  1IUQ A;  1A8O A;  5HGO A;  3CME P;  3LRY A;  2L6E A;  1AUM A;  1K9M Q;  1VQ8 P;  3CCR P;  3G1G A;  2ONT A;  3P05 A;  3CC7 P;  4WYM A;  4QNB A;  2OAR A;  3CC4 P;  3I55 P;  1VQ7 P;  1YI2 P;  2JYL A;  1Q82 Q;  1N8R Q;  2PEI A;  2EIA A;  1VQK P;  1VQL P;  1YIJ P;  3DS2 A;  1EIA A;  2EFJ A;  4U0E A;  1ZMB A;  3G1I A;  2PEQ A;  2Z45 A;  4XFY A;  1KQS O;  3G4S P;  1YJ9 P;  2CWO A;  1Q86 Q;  3Q20 A;  3G71 P;  1S72 P;  3CCS P;  1K30 A;  3DS1 A;  5HGN A;  3G21 A;  1KC8 Q;  2QEX P;  4M0I A;  1YIT P;  2XV6 A;  3G6E P;  1QVF O;  3H0D A;  3OW2 O;  1M74 A;  1QRJ A;  3DS0 A;  1M6E X;  2KOD A;  1E6J P;  1M6N A;  3MGE A;  4U0C A;  5DCK A;  4XRQ A;  1K8A Q;  3HYB A;  1BAJ A;  1YHQ P;  1RO0 A;  2EG5 A;  3HZQ A;  1VQ4 P;  3CCL P;  2P9X A;  2JO0 A;  2M8N A;  2PEO A;  3CCV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...