2XV6A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xv6A00
2JYGA 1D1DA 3LRYA 4PH1A 4U0BA 2XV6A 4XFXA 1A43A 2KODA 1E6JP 3DS3A 2LF4A 5HGNA 3G0VA 3G1GA 3DS1A 3P05A 5JPAA 4COPA 3H4EA 1BAJA 3NTEA 3DS0A 2XXMA 4U0EA 4XFZA 2ONTA 2M8NA 5HGMA 5I4TG 4XROA 3G26A 2BUOA 4U0AA 5HGLA 4PH0A 3DPHA 3DS5A 2JO0A 5HGOA 1QRJA 5DCKA 4U0DA 2XT1A 3G21A 2M8PA 3H47A 3DTJA 3DS2A 3DS4A 4QNBA 4WYMA 1A8OA 3G29A 1EOQA 4XRQA 2EIAA 4XFYA 3G1IA 2L6EA 3G28A 4IPYA 4U0CA 3VRLC 1AUMA 4COCA 1EIAA 4M0IA 2M8LA 4U0FA 2JYLA 3MGEA
chains in the Genus database with same CATH superfamily
4XFXA 1VQ7P 2LTEA 5F2NA 1Q7YQ 5KP8B 1RNIA 3G26A 4H2YC 4H2XC 2JAZA 3DS4A 3RG2A 1K8AQ 1K73Q 4BPFA 2EG5A 3G4SP 3CCMP 1VQ8P 1DNYA 5F2KA 2KGAA 1Z6MA 3DS0A 4XROA 2BUOA 2CNRA 1KC8Q 2XZ1C 3DS2A 2M5RA 3CXCO 3VRLC 3G28A 2DNWA 4M0IA 5CZDB 4H2WC 2KOSA 2GZGA 3DS3A 3B5IA 1X3OA 1KD1Q 2XXMA 2LPKA 1VQMP 3CC7P 2JBGA 3DPHA 2AF8A 1IUQA 1CEIA 1M74A 2K94A 2LMLA 3H0DA 1EMVA 2PEMA 1YHQP 3CCLP 2P9XA 2EIAA 3HYBA 1W2BO 2FQ1A 1VQ5P 4PH1A 1YJ9P 2QNWA 1RO2A 2AFDA 1QVFO 2L4BA 1ZMBA 2PENA 2CQ8A 1E0HA 3CCEP 2KGDA 2M8LA 2DGYA 3RG6C 5EW5E 2PEKA 2L0QA 1E6JP 3G71P 2FVAA 3Q20A 1IMQA 5F2OA 2KG8A 1N8RQ 2EHSA 2FVFA 1M6NA 3OW2O 2KR5A 2K93A 5KP6B 1VQ6P 4IZ6A 2N6ZA 3EJEA 3GKLC 2KG6A 2JU2A 2KGCA 4PXHB 4U0FA 3NY7B 1GXGA 2VLPA 4R0MA 2KODA 2L22A 1HQBA 1YJNP 2FQ0A 3H4EA 1KLPA 2CG5B 2Z44A 1VQKP 2M8NA 4HKGA 5HGLA 1Q81Q 5HGOA 4GR6A 2GZJA 3LRYA 2JU1A 4U0BA 2KOOA 2MVVA 3G0VA 1KQSO 4COPA 1BAJA 4U0EA 1F80D 2K0YA 1YITP 1IMPA 2MD9A 2GZIA 2OTJP 2KOQA 2FHSC 2JB0A 1UJZA 2MY5A 1YI2P 3G29A 4XRQA 2K92A 2GDWA 4XFYA 4COCA 5HVCA 1K30A 1GXHA 2FVEA 2LIUA 2NO8A 2GZEA 2KGEA 2ONTA 2LIWA 3WBHA 2E1MA 2KG9A 2FADA 4U0DA 2KWLA 2XT1A 5HV8A 3E2DA 4WYMA 1A8OA 3B4QA 1L0HA 1VKUA 3I56P 4NEOA 3MGEA 3I55P 2FAEA 2XZ0D 2PEIA 3CPWO 2K2QA 2K5XA 1MZ8A 2VLOA 2AVAA 5HGMA 4U0AA 2K0XA 2JO0A 2OARA 1BXIA 1OR5A 1T8KA 5BS2A 1VHNA 2QEXP 2GYKA 2JQ4A 4F37A 1AYIA 2N50A 4PWVB 1M6EX 1VQLP 1M1KQ 2JYGA 2EHTA 3G1GA 3P05A 3NTEA 3CCJP 7CEIA 4QKOA 2PY8A 4UHPB 3U43A 1EOQA 2L9FA 2N5HA 2JGPA 2PEQA 5KP7B 5BS1A 3CMEP 3GZMA 2CGQA 3CMAP 1AF8A 1FR2A 2LL8A 1Q86Q 3DS5A 2OTLP 5DCKA 3DTJA 2VLQA 2MR7A 4BPHA 2PEOA 2KW2A 2FQ2A 4DG9A 1S72P 2X2BA 3CCRP 3M1MA 3CCQP 3DS1A 5JPAA 3GJNA 3CC2P 2MF4A 1VQ4P 1VQOP 1YJWP 2Z45A 1JJ2O 2M8PA 3EJDA 1GPJA 4MRTC 1YIJP 3HZQA 1D1DA 1HY8A 2XV6A 2BHVA 2N5IA 2Z46A 5HGNA 1M90Q 1VQNP 4XFZA 1VQ9P 2KORA 3LMOA 1DV5A 2MR8A 2LKIA 4CA3A 4QNBA 3CE7A 1ACPA 3CCUP 5EJDA 2WPTA 2EFJA 2LF4A 1Q82Q 3CD6P 2K0DX 2ERHA 1K9MQ 2VSQA 5I4TG 2N6YA 3G21A 2GDXA 2QA4P 1QVGO 3G1IA 1UNKA 4IPYA 4U0CA 2N98A 1ZNVA 2PNGA 3EJBA 2MVUA 2ROQA 4PH0A 1NQ4A 2KOPA 2GZFA 3H47A 2GDYA 2VLNA 3CCSP 1AUMA 2FACA 1EIAA 2LOLA 2JYLA 3GZLA 2CWOA 1A43A 1VQPP 4GR2A 3CC4P 1RO0A 3CCVP 1QRJA 2PEJA 3G6EP 1L0IA 2AFEA 1NJIQ 4BPGA 2L6EA
chains in the Genus database with same CATH topology
3I55P 1D1DA 2PEKA 2XV6A 2BHVA 4XFXA 2Z46A 5HGNA 1E6JP 1VQ7P 3G71P 2PEIA 3CPWO 1M90Q 1VQNP 4XFZA 1VQ9P 5F2NA 3Q20A 2M8LA 5HGMA 1Q7YQ 5F2OA 1N8RQ 1RNIA 3G26A 4U0AA 2JO0A 1M6NA 3OW2O 2OARA 1VQ6P 5BS2A 3DS4A 4QNBA 2QEXP 1K8AQ 1K73Q 3CCUP 1M6EX 1VQLP 1M1KQ 4U0FA 2EG5A 2JYGA 2KODA 2EFJA 3G4SP 2LF4A 3CCMP 3G1GA 3P05A 1YJNP 1Q82Q 5F2KA 1VQ8P 3CD6P 3H4EA 3NTEA 3DS0A 2Z44A 3CCJP 1VQKP 2M8NA 1K9MQ 2PY8A 5I4TG 4XROA 2BUOA 5HGLA 1Q81Q 1KC8Q 5HGOA 3G21A 3DS2A 3CXCO 4GR6A 1EOQA 2QA4P 1QVGO 3G1IA 4IPYA 3G28A 4U0CA 3VRLC 4M0IA 2PEQA 3I56P 5BS1A 3LRYA 4U0BA 3CMEP 3DS3A 3G0VA 1KQSO 3B5IA 3CMAP 4COPA 1BAJA 1KD1Q 2XXMA 4U0EA 1VQMP 1YITP 3CC7P 4PH0A 1Q86Q 3DPHA 3DS5A 1IUQA 2OTLP 3RG6C 5DCKA 1M74A 2OTJP 3H47A 3H0DA 3DTJA 2PEMA 1YI2P 3G29A 4XRQA 1YHQP 3CCLP 2P9XA 2EIAA 4XFYA 4COCA 3CCSP 3HYBA 1W2BO 1AUMA 1K30A 1EIAA 2PEOA 2JYLA 1VQ5P 4PH1A 2CWOA 1YJ9P 1S72P 1A43A 1VQPP 3CCRP 3M1MA 3CCQP 3DS1A 5JPAA 4GR2A 3CC2P 2ONTA 3CC4P 1RO2A 3WBHA 1VQ4P 1RO0A 1VQOP 1QVFO 1YJWP 2E1MA 1ZMBA 2PENA 2Z45A 3CCVP 1QRJA 2PEJA 1JJ2O 3CCEP 4U0DA 2XT1A 3G6EP 2M8PA 3E2DA 4WYMA 1A8OA 1NJIQ 2L6EA 1YIJP 3HZQA 2DGYA 3MGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYG A;  1D1D A;  3LRY A;  4PH1 A;  4U0B A;  2XV6 A;  4XFX A;  1A43 A;  2KOD A;  1E6J P;  3DS3 A;  2LF4 A;  5HGN A;  3G0V A;  3G1G A;  3DS1 A;  3P05 A;  5JPA A;  4COP A;  3H4E A;  1BAJ A;  3NTE A;  3DS0 A;  2XXM A;  4U0E A;  4XFZ A;  2ONT A;  2M8N A;  5HGM A;  5I4T G;  4XRO A;  3G26 A;  2BUO A;  4U0A A;  5HGL A;  4PH0 A;  3DPH A;  3DS5 A;  2JO0 A;  5HGO A;  1QRJ A;  5DCK A;  4U0D A;  2XT1 A;  3G21 A;  2M8P A;  3H47 A;  3DTJ A;  3DS2 A;  3DS4 A;  4QNB A;  4WYM A;  1A8O A;  3G29 A;  1EOQ A;  4XRQ A;  2EIA A;  4XFY A;  3G1I A;  2L6E A;  3G28 A;  4IPY A;  4U0C A;  3VRL C;  1AUM A;  4COC A;  1EIA A;  4M0I A;  2M8L A;  4U0F A;  2JYL A;  3MGE A; 
#chains in the Genus database with same CATH topology
 4XFX A;  1VQ7 P;  2LTE A;  5F2N A;  1Q7Y Q;  5KP8 B;  1RNI A;  3G26 A;  4H2Y C;  4H2X C;  2JAZ A;  3DS4 A;  3RG2 A;  1K8A Q;  1K73 Q;  4BPF A;  2EG5 A;  3G4S P;  3CCM P;  1VQ8 P;  1DNY A;  5F2K A;  2KGA A;  1Z6M A;  3DS0 A;  4XRO A;  2BUO A;  2CNR A;  1KC8 Q;  2XZ1 C;  3DS2 A;  2M5R A;  3CXC O;  3VRL C;  3G28 A;  2DNW A;  4M0I A;  5CZD B;  4H2W C;  2KOS A;  2GZG A;  3DS3 A;  3B5I A;  1X3O A;  1KD1 Q;  2XXM A;  2LPK A;  1VQM P;  3CC7 P;  2JBG A;  3DPH A;  2AF8 A;  1IUQ A;  1CEI A;  1M74 A;  2K94 A;  2LML A;  3H0D A;  1EMV A;  2PEM A;  1YHQ P;  3CCL P;  2P9X A;  2EIA A;  3HYB A;  1W2B O;  2FQ1 A;  1VQ5 P;  4PH1 A;  1YJ9 P;  2QNW A;  1RO2 A;  2AFD A;  1QVF O;  2L4B A;  1ZMB A;  2PEN A;  2CQ8 A;  1E0H A;  3CCE P;  2KGD A;  2M8L A;  2DGY A;  3RG6 C;  5EW5 E;  2PEK A;  2L0Q A;  1E6J P;  3G71 P;  2FVA A;  3Q20 A;  1IMQ A;  5F2O A;  2KG8 A;  1N8R Q;  2EHS A;  2FVF A;  1M6N A;  3OW2 O;  2KR5 A;  2K93 A;  5KP6 B;  1VQ6 P;  4IZ6 A;  2N6Z A;  3EJE A;  3GKL C;  2KG6 A;  2JU2 A;  2KGC A;  4PXH B;  4U0F A;  3NY7 B;  1GXG A;  2VLP A;  4R0M A;  2KOD A;  2L22 A;  1HQB A;  1YJN P;  2FQ0 A;  3H4E A;  1KLP A;  2CG5 B;  2Z44 A;  1VQK P;  2M8N A;  4HKG A;  5HGL A;  1Q81 Q;  5HGO A;  4GR6 A;  2GZJ A;  3LRY A;  2JU1 A;  4U0B A;  2KOO A;  2MVV A;  3G0V A;  1KQS O;  4COP A;  1BAJ A;  4U0E A;  1F80 D;  2K0Y A;  1YIT P;  1IMP A;  2MD9 A;  2GZI A;  2OTJ P;  2KOQ A;  2FHS C;  2JB0 A;  1UJZ A;  2MY5 A;  1YI2 P;  3G29 A;  4XRQ A;  2K92 A;  2GDW A;  4XFY A;  4COC A;  5HVC A;  1K30 A;  1GXH A;  2FVE A;  2LIU A;  2NO8 A;  2GZE A;  2KGE A;  2ONT A;  2LIW A;  3WBH A;  2E1M A;  2KG9 A;  2FAD A;  4U0D A;  2KWL A;  2XT1 A;  5HV8 A;  3E2D A;  4WYM A;  1A8O A;  3B4Q A;  1L0H A;  1VKU A;  3I56 P;  4NEO A;  3MGE A;  3I55 P;  2FAE A;  2XZ0 D;  2PEI A;  3CPW O;  2K2Q A;  2K5X A;  1MZ8 A;  2VLO A;  2AVA A;  5HGM A;  4U0A A;  2K0X A;  2JO0 A;  2OAR A;  1BXI A;  1OR5 A;  1T8K A;  5BS2 A;  1VHN A;  2QEX P;  2GYK A;  2JQ4 A;  4F37 A;  1AYI A;  2N50 A;  4PWV B;  1M6E X;  1VQL P;  1M1K Q;  2JYG A;  2EHT A;  3G1G A;  3P05 A;  3NTE A;  3CCJ P;  7CEI A;  4QKO A;  2PY8 A;  4UHP B;  3U43 A;  1EOQ A;  2L9F A;  2N5H A;  2JGP A;  2PEQ A;  5KP7 B;  5BS1 A;  3CME P;  3GZM A;  2CGQ A;  3CMA P;  1AF8 A;  1FR2 A;  2LL8 A;  1Q86 Q;  3DS5 A;  2OTL P;  5DCK A;  3DTJ A;  2VLQ A;  2MR7 A;  4BPH A;  2PEO A;  2KW2 A;  2FQ2 A;  4DG9 A;  1S72 P;  2X2B A;  3CCR P;  3M1M A;  3CCQ P;  3DS1 A;  5JPA A;  3GJN A;  3CC2 P;  2MF4 A;  1VQ4 P;  1VQO P;  1YJW P;  2Z45 A;  1JJ2 O;  2M8P A;  3EJD A;  1GPJ A;  4MRT C;  1YIJ P;  3HZQ A;  1D1D A;  1HY8 A;  2XV6 A;  2BHV A;  2N5I A;  2Z46 A;  5HGN A;  1M90 Q;  1VQN P;  4XFZ A;  1VQ9 P;  2KOR A;  3LMO A;  1DV5 A;  2MR8 A;  2LKI A;  4CA3 A;  4QNB A;  3CE7 A;  1ACP A;  3CCU P;  5EJD A;  2WPT A;  2EFJ A;  2LF4 A;  1Q82 Q;  3CD6 P;  2K0D X;  2ERH A;  1K9M Q;  2VSQ A;  5I4T G;  2N6Y A;  3G21 A;  2GDX A;  2QA4 P;  1QVG O;  3G1I A;  1UNK A;  4IPY A;  4U0C A;  2N98 A;  1ZNV A;  2PNG A;  3EJB A;  2MVU A;  2ROQ A;  4PH0 A;  1NQ4 A;  2KOP A;  2GZF A;  3H47 A;  2GDY A;  2VLN A;  3CCS P;  1AUM A;  2FAC A;  1EIA A;  2LOL A;  2JYL A;  3GZL A;  2CWO A;  1A43 A;  1VQP P;  4GR2 A;  3CC4 P;  1RO0 A;  3CCV P;  1QRJ A;  2PEJ A;  3G6E P;  1L0I A;  2AFE A;  1NJI Q;  4BPG A;  2L6E A; 
#chains in the Genus database with same CATH homology
 3I55 P;  1D1D A;  2PEK A;  2XV6 A;  2BHV A;  4XFX A;  2Z46 A;  5HGN A;  1E6J P;  1VQ7 P;  3G71 P;  2PEI A;  3CPW O;  1M90 Q;  1VQN P;  4XFZ A;  1VQ9 P;  5F2N A;  3Q20 A;  2M8L A;  5HGM A;  1Q7Y Q;  5F2O A;  1N8R Q;  1RNI A;  3G26 A;  4U0A A;  2JO0 A;  1M6N A;  3OW2 O;  2OAR A;  1VQ6 P;  5BS2 A;  3DS4 A;  4QNB A;  2QEX P;  1K8A Q;  1K73 Q;  3CCU P;  1M6E X;  1VQL P;  1M1K Q;  4U0F A;  2EG5 A;  2JYG A;  2KOD A;  2EFJ A;  3G4S P;  2LF4 A;  3CCM P;  3G1G A;  3P05 A;  1YJN P;  1Q82 Q;  5F2K A;  1VQ8 P;  3CD6 P;  3H4E A;  3NTE A;  3DS0 A;  2Z44 A;  3CCJ P;  1VQK P;  2M8N A;  1K9M Q;  2PY8 A;  5I4T G;  4XRO A;  2BUO A;  5HGL A;  1Q81 Q;  1KC8 Q;  5HGO A;  3G21 A;  3DS2 A;  3CXC O;  4GR6 A;  1EOQ A;  2QA4 P;  1QVG O;  3G1I A;  4IPY A;  3G28 A;  4U0C A;  3VRL C;  4M0I A;  2PEQ A;  3I56 P;  5BS1 A;  3LRY A;  4U0B A;  3CME P;  3DS3 A;  3G0V A;  1KQS O;  3B5I A;  3CMA P;  4COP A;  1BAJ A;  1KD1 Q;  2XXM A;  4U0E A;  1VQM P;  1YIT P;  3CC7 P;  4PH0 A;  1Q86 Q;  3DPH A;  3DS5 A;  1IUQ A;  2OTL P;  3RG6 C;  5DCK A;  1M74 A;  2OTJ P;  3H47 A;  3H0D A;  3DTJ A;  2PEM A;  1YI2 P;  3G29 A;  4XRQ A;  1YHQ P;  3CCL P;  2P9X A;  2EIA A;  4XFY A;  4COC A;  3CCS P;  3HYB A;  1W2B O;  1AUM A;  1K30 A;  1EIA A;  2PEO A;  2JYL A;  1VQ5 P;  4PH1 A;  2CWO A;  1YJ9 P;  1S72 P;  1A43 A;  1VQP P;  3CCR P;  3M1M A;  3CCQ P;  3DS1 A;  5JPA A;  4GR2 A;  3CC2 P;  2ONT A;  3CC4 P;  1RO2 A;  3WBH A;  1VQ4 P;  1RO0 A;  1VQO P;  1QVF O;  1YJW P;  2E1M A;  1ZMB A;  2PEN A;  2Z45 A;  3CCV P;  1QRJ A;  2PEJ A;  1JJ2 O;  3CCE P;  4U0D A;  2XT1 A;  3G6E P;  2M8P A;  3E2D A;  4WYM A;  1A8O A;  1NJI Q;  2L6E A;  1YIJ P;  3HZQ A;  2DGY A;  3MGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...