2XV6A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 220) in complex with a camelid vhh.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
b'SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 28
structure length 75
sequence length 75
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xv6A00
3G1GA 3G28A 4U0FA 3DS3A 4XFZA 2BUOA 4QNBA 4M0IA 2JO0A 3G21A 1A43A 1E6JP 3G29A 3G1IA 4U0DA 4U0BA 4COPA 5HGOA 2M8LA 3DS4A 2XV6A 3H47A 3VRLC 4WYMA 1D1DA 3DS1A 4U0AA 1AUMA 2XXMA 4XRQA 4COCA 4XFXA 3G0VA 3H4EA 2KODA 3DS5A 3DS2A 4XFYA 1EIAA 2L6EA 3DPHA 3P05A 4XROA 5JPAA 2JYLA 2M8PA 1QRJA 2ONTA 2M8NA 4PH1A 2JYGA 4U0EA 1EOQA 3LRYA 5I4TG 2EIAA 5DCKA 5HGMA 2XT1A 3G26A 1BAJA 4U0CA 3MGEA 5HGLA 5HGNA 4PH0A 2LF4A 1A8OA 3DS0A 3NTEA 3DTJA 4IPYA
chains in the Genus database with same CATH superfamily
3G71P 3DS3A 2LOLA 2MF4A 3G4SP 1Q81Q 1IUQA 1YHQP 2MY5A 2N6ZA 1M6EX 3CC2P 2FACA 2JB0A 2JGPA 1VQNP 3CMAP 5HGNA 3CC7P 1A8OA 4BPGA 2EG5A 2JO0A 2FQ1A 1HY8A 2PEJA 2FAEA 4QKOA 1YI2P 3GZLA 1VQKP 1VHNA 2KG6A 3VRLC 2GZEA 3I55P 2FHSC 1VQLP 1HQBA 1L0HA 3H47A 1K30A 2JU1A 1GXHA 1W2BO 2ERHA 3CCSP 1DV5A 2CWOA 1QRJA 2EFJA 2GZIA 2QA4P 2PEKA 3HYBA 1Z6MA 2GDWA 2NO8A 1UNKA 2VSQA 4COPA 1X3OA 2XV6A 1VQ9P 3EJEA 4XRQA 2PY8A 5F2OA 3DS5A 3DPHA 2MVVA 1RO2A 5EW5E 5DCKA 1M6NA 5HGMA 2K92A 5KP6B 5F2NA 1DNYA 2EHSA 5KP7B 2LMLA 2L9FA 2CG5B 3G21A 3G29A 2M8LA 2VLOA 2X2BA 1T8KA 2E1MA 2GZFA 2GDXA 3DS2A 3CXCO 4BPHA 2KG8A 2KOOA 2MD9A 4F37A 1KLPA 1OR5A 1BAJA 1YJNP 1IMQA 2PEQA 2PEOA 2OTLP 2PENA 2XZ0D 4MRTC 1A43A 1AF8A 1AYIA 1ACPA 2LL8A 4H2YC 3CPWO 2MVUA 1YIJP 2KODA 1E0HA 1K9MQ 2ONTA 2KR5A 3G1GA 2KW2A 3GKLC 1ZNVA 2BHVA 2M5RA 4M0IA 3B5IA 2L4BA 2KOSA 3CCRP 5KP8B 2PEIA 2L22A 4U0AA 4XFYA 3Q20A 2VLNA 2Z46A 2N5HA 2JBGA 5BS1A 2XT1A 7CEIA 1MZ8A 2K94A 1ZMBA 2LPKA 1N8RQ 1Q82Q 1EIAA 2LKIA 2GDYA 4NEOA 1VQMP 2KGDA 2FVAA 3LRYA 3EJBA 5HGLA 2K0XA 4PH0A 3CCJP 3CMEP 1VQ6P 2K2QA 2BUOA 2AVAA 2PEMA 2N98A 2ROQA 3CC4P 2P9XA 4U0BA 2N50A 1VQ8P 3CCEP 2OTJP 2CNRA 1CEIA 3CD6P 1M1KQ 3G26A 2KORA 2QNWA 3LMOA 2GZGA 4XFZA 1JJ2O 4QNBA 2OARA 3GJNA 3CCUP 5HGOA 2Z44A 3DS4A 3G6EP 3H4EA 5HV8A 4UHPB 5EJDA 2FQ2A 1EOQA 4R0MA 1KQSO 4PXHB 1K73Q 1VQ7P 3EJDA 1L0IA 1YJ9P 2GZJA 2JQ4A 2CQ8A 1D1DA 2K93A 4COCA 3CCMP 2LTEA 1VQOP 2L0QA 3U43A 4XROA 1KC8Q 1VQPP 2M8NA 4U0EA 2KOQA 2N6YA 5I4TG 4U0CA 2QEXP 2KGAA 1S72P 3M1MA 3B4QA 2FVFA 2PNGA 4U0FA 4GR2A 1GXGA 1M74A 1K8AQ 2KGEA 2MR7A 3P05A 1VQ5P 5JPAA 4H2XC 1YJWP 2JYGA 4DG9A 3MGEA 3NY7B 2LF4A 5F2KA 2DGYA 3H0DA 1Q86Q 2EHTA 1GPJA 3G1IA 1QVFO 2GYKA 2AFDA 1BXIA 4IZ6A 1NJIQ 2FQ0A 3OW2O 3G0VA 3HZQA 3WBHA 2KG9A 2JYLA 3CE7A 5BS2A 2KWLA 1YITP 2EIAA 2KGCA 2VLQA 1KD1Q 1EMVA 4IPYA 2AF8A 2KOPA 1RO0A 2AFEA 2XXMA 1RNIA 2VLPA 3E2DA 3CCLP 2FADA 2M8PA 4GR6A 1UJZA 3I56P 2FVEA 2Z45A 2CGQA 5CZDB 3G28A 3RG6C 3GZMA 2LIWA 3RG2A 4H2WC 1E6JP 4U0DA 4PWVB 4WYMA 1IMPA 1AUMA 2JAZA 4XFXA 2DNWA 2K5XA 1Q7YQ 2L6EA 1VQ4P 4HKGA 2K0DX 3DS0A 3DTJA 2WPTA 1VKUA 2JU2A 2MR8A 2LIUA 4CA3A 2N5IA 3CCQP 5HVCA 4BPFA 1M90Q 1FR2A 1NQ4A 3DS1A 1QVGO 3CCVP 4PH1A 1F80D 2K0YA 2XZ1C 3NTEA
chains in the Genus database with same CATH topology
5F2NA 2DGYA 3H0DA 3DS3A 3G71P 2BUOA 2PEMA 3G4SP 1Q81Q 1Q86Q 1IUQA 3G21A 1YHQP 3CC4P 2P9XA 3G29A 3G1IA 4U0BA 1VQ8P 1QVFO 2M8LA 1NJIQ 2E1MA 3OW2O 3G0VA 3CCEP 2OTJP 3DS2A 3HZQA 1M6EX 3CXCO 3WBHA 3CC2P 2JYLA 5BS2A 1YITP 3CD6P 1M1KQ 2EIAA 1VQNP 3CMAP 3G26A 1BAJA 5HGNA 3CC7P 1YJNP 1A8OA 1KD1Q 4IPYA 2PEQA 2PEOA 2EG5A 4XFZA 1JJ2O 4QNBA 1RO0A 2OTLP 2OARA 2PENA 2JO0A 1A43A 2PEJA 3CCUP 5HGOA 2Z44A 3DS4A 3G6EP 3CPWO 2XXMA 1RNIA 1YIJP 3H4EA 2KODA 3E2DA 3CCLP 1K9MQ 2M8PA 2ONTA 4GR6A 1EOQA 1KQSO 1YI2P 1VQKP 3I56P 1K73Q 1VQ7P 3VRLC 2Z45A 3G1GA 3I55P 3G28A 2BHVA 1VQLP 4M0IA 3B5IA 3RG6C 1YJ9P 3CCRP 1E6JP 4U0DA 3H47A 1K30A 2PEIA 4WYMA 1D1DA 4U0AA 1AUMA 4COCA 3CCMP 1VQ6P 4XFXA 1VQOP 1W2BO 3CCSP 1Q7YQ 4XFYA 2L6EA 3Q20A 4XROA 2CWOA 1VQ4P 1KC8Q 1VQPP 1QRJA 2EFJA 2M8NA 2Z46A 4U0EA 5I4TG 5BS1A 2QA4P 2XT1A 4U0CA 2QEXP 1S72P 2PEKA 3HYBA 3DS0A 3DTJA 3M1MA 1ZMBA 4U0FA 1N8RQ 3CCQP 4GR2A 1M74A 4COPA 1M90Q 1K8AQ 2XV6A 1Q82Q 1VQ9P 3DS1A 4XRQA 2PY8A 5F2OA 3DS5A 1EIAA 3DPHA 3P05A 1VQ5P 1RO2A 1QVGO 5JPAA 3CCVP 1VQMP 1YJWP 4PH1A 2JYGA 3LRYA 5DCKA 1M6NA 5HGMA 5HGLA 3MGEA 4PH0A 3CCJP 3CMEP 2LF4A 5F2KA 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1G A;  3G28 A;  4U0F A;  3DS3 A;  4XFZ A;  2BUO A;  4QNB A;  4M0I A;  2JO0 A;  3G21 A;  1A43 A;  1E6J P;  3G29 A;  3G1I A;  4U0D A;  4U0B A;  4COP A;  5HGO A;  2M8L A;  3DS4 A;  2XV6 A;  3H47 A;  3VRL C;  4WYM A;  1D1D A;  3DS1 A;  4U0A A;  1AUM A;  2XXM A;  4XRQ A;  4COC A;  4XFX A;  3G0V A;  3H4E A;  2KOD A;  3DS5 A;  3DS2 A;  4XFY A;  1EIA A;  2L6E A;  3DPH A;  3P05 A;  4XRO A;  5JPA A;  2JYL A;  2M8P A;  1QRJ A;  2ONT A;  2M8N A;  4PH1 A;  2JYG A;  4U0E A;  1EOQ A;  3LRY A;  5I4T G;  2EIA A;  5DCK A;  5HGM A;  2XT1 A;  3G26 A;  1BAJ A;  4U0C A;  3MGE A;  5HGL A;  5HGN A;  4PH0 A;  2LF4 A;  1A8O A;  3DS0 A;  3NTE A;  3DTJ A;  4IPY A; 
#chains in the Genus database with same CATH topology
 3G71 P;  3DS3 A;  2LOL A;  2MF4 A;  3G4S P;  1Q81 Q;  1IUQ A;  1YHQ P;  2MY5 A;  2N6Z A;  1M6E X;  3CC2 P;  2FAC A;  2JB0 A;  2JGP A;  1VQN P;  3CMA P;  5HGN A;  3CC7 P;  1A8O A;  4BPG A;  2EG5 A;  2JO0 A;  2FQ1 A;  1HY8 A;  2PEJ A;  2FAE A;  4QKO A;  1YI2 P;  3GZL A;  1VQK P;  1VHN A;  2KG6 A;  3VRL C;  2GZE A;  3I55 P;  2FHS C;  1VQL P;  1HQB A;  1L0H A;  3H47 A;  1K30 A;  2JU1 A;  1GXH A;  1W2B O;  2ERH A;  3CCS P;  1DV5 A;  2CWO A;  1QRJ A;  2EFJ A;  2GZI A;  2QA4 P;  2PEK A;  3HYB A;  1Z6M A;  2GDW A;  2NO8 A;  1UNK A;  2VSQ A;  4COP A;  1X3O A;  2XV6 A;  1VQ9 P;  3EJE A;  4XRQ A;  2PY8 A;  5F2O A;  3DS5 A;  3DPH A;  2MVV A;  1RO2 A;  5EW5 E;  5DCK A;  1M6N A;  5HGM A;  2K92 A;  5KP6 B;  5F2N A;  1DNY A;  2EHS A;  5KP7 B;  2LML A;  2L9F A;  2CG5 B;  3G21 A;  3G29 A;  2M8L A;  2VLO A;  2X2B A;  1T8K A;  2E1M A;  2GZF A;  2GDX A;  3DS2 A;  3CXC O;  4BPH A;  2KG8 A;  2KOO A;  2MD9 A;  4F37 A;  1KLP A;  1OR5 A;  1BAJ A;  1YJN P;  1IMQ A;  2PEQ A;  2PEO A;  2OTL P;  2PEN A;  2XZ0 D;  4MRT C;  1A43 A;  1AF8 A;  1AYI A;  1ACP A;  2LL8 A;  4H2Y C;  3CPW O;  2MVU A;  1YIJ P;  2KOD A;  1E0H A;  1K9M Q;  2ONT A;  2KR5 A;  3G1G A;  2KW2 A;  3GKL C;  1ZNV A;  2BHV A;  2M5R A;  4M0I A;  3B5I A;  2L4B A;  2KOS A;  3CCR P;  5KP8 B;  2PEI A;  2L22 A;  4U0A A;  4XFY A;  3Q20 A;  2VLN A;  2Z46 A;  2N5H A;  2JBG A;  5BS1 A;  2XT1 A;  7CEI A;  1MZ8 A;  2K94 A;  1ZMB A;  2LPK A;  1N8R Q;  1Q82 Q;  1EIA A;  2LKI A;  2GDY A;  4NEO A;  1VQM P;  2KGD A;  2FVA A;  3LRY A;  3EJB A;  5HGL A;  2K0X A;  4PH0 A;  3CCJ P;  3CME P;  1VQ6 P;  2K2Q A;  2BUO A;  2AVA A;  2PEM A;  2N98 A;  2ROQ A;  3CC4 P;  2P9X A;  4U0B A;  2N50 A;  1VQ8 P;  3CCE P;  2OTJ P;  2CNR A;  1CEI A;  3CD6 P;  1M1K Q;  3G26 A;  2KOR A;  2QNW A;  3LMO A;  2GZG A;  4XFZ A;  1JJ2 O;  4QNB A;  2OAR A;  3GJN A;  3CCU P;  5HGO A;  2Z44 A;  3DS4 A;  3G6E P;  3H4E A;  5HV8 A;  4UHP B;  5EJD A;  2FQ2 A;  1EOQ A;  4R0M A;  1KQS O;  4PXH B;  1K73 Q;  1VQ7 P;  3EJD A;  1L0I A;  1YJ9 P;  2GZJ A;  2JQ4 A;  2CQ8 A;  1D1D A;  2K93 A;  4COC A;  3CCM P;  2LTE A;  1VQO P;  2L0Q A;  3U43 A;  4XRO A;  1KC8 Q;  1VQP P;  2M8N A;  4U0E A;  2KOQ A;  2N6Y A;  5I4T G;  4U0C A;  2QEX P;  2KGA A;  1S72 P;  3M1M A;  3B4Q A;  2FVF A;  2PNG A;  4U0F A;  4GR2 A;  1GXG A;  1M74 A;  1K8A Q;  2KGE A;  2MR7 A;  3P05 A;  1VQ5 P;  5JPA A;  4H2X C;  1YJW P;  2JYG A;  4DG9 A;  3MGE A;  3NY7 B;  2LF4 A;  5F2K A;  2DGY A;  3H0D A;  1Q86 Q;  2EHT A;  1GPJ A;  3G1I A;  1QVF O;  2GYK A;  2AFD A;  1BXI A;  4IZ6 A;  1NJI Q;  2FQ0 A;  3OW2 O;  3G0V A;  3HZQ A;  3WBH A;  2KG9 A;  2JYL A;  3CE7 A;  5BS2 A;  2KWL A;  1YIT P;  2EIA A;  2KGC A;  2VLQ A;  1KD1 Q;  1EMV A;  4IPY A;  2AF8 A;  2KOP A;  1RO0 A;  2AFE A;  2XXM A;  1RNI A;  2VLP A;  3E2D A;  3CCL P;  2FAD A;  2M8P A;  4GR6 A;  1UJZ A;  3I56 P;  2FVE A;  2Z45 A;  2CGQ A;  5CZD B;  3G28 A;  3RG6 C;  3GZM A;  2LIW A;  3RG2 A;  4H2W C;  1E6J P;  4U0D A;  4PWV B;  4WYM A;  1IMP A;  1AUM A;  2JAZ A;  4XFX A;  2DNW A;  2K5X A;  1Q7Y Q;  2L6E A;  1VQ4 P;  4HKG A;  2K0D X;  3DS0 A;  3DTJ A;  2WPT A;  1VKU A;  2JU2 A;  2MR8 A;  2LIU A;  4CA3 A;  2N5I A;  3CCQ P;  5HVC A;  4BPF A;  1M90 Q;  1FR2 A;  1NQ4 A;  3DS1 A;  1QVG O;  3CCV P;  4PH1 A;  1F80 D;  2K0Y A;  2XZ1 C;  3NTE A; 
#chains in the Genus database with same CATH homology
 5F2N A;  2DGY A;  3H0D A;  3DS3 A;  3G71 P;  2BUO A;  2PEM A;  3G4S P;  1Q81 Q;  1Q86 Q;  1IUQ A;  3G21 A;  1YHQ P;  3CC4 P;  2P9X A;  3G29 A;  3G1I A;  4U0B A;  1VQ8 P;  1QVF O;  2M8L A;  1NJI Q;  2E1M A;  3OW2 O;  3G0V A;  3CCE P;  2OTJ P;  3DS2 A;  3HZQ A;  1M6E X;  3CXC O;  3WBH A;  3CC2 P;  2JYL A;  5BS2 A;  1YIT P;  3CD6 P;  1M1K Q;  2EIA A;  1VQN P;  3CMA P;  3G26 A;  1BAJ A;  5HGN A;  3CC7 P;  1YJN P;  1A8O A;  1KD1 Q;  4IPY A;  2PEQ A;  2PEO A;  2EG5 A;  4XFZ A;  1JJ2 O;  4QNB A;  1RO0 A;  2OTL P;  2OAR A;  2PEN A;  2JO0 A;  1A43 A;  2PEJ A;  3CCU P;  5HGO A;  2Z44 A;  3DS4 A;  3G6E P;  3CPW O;  2XXM A;  1RNI A;  1YIJ P;  3H4E A;  2KOD A;  3E2D A;  3CCL P;  1K9M Q;  2M8P A;  2ONT A;  4GR6 A;  1EOQ A;  1KQS O;  1YI2 P;  1VQK P;  3I56 P;  1K73 Q;  1VQ7 P;  3VRL C;  2Z45 A;  3G1G A;  3I55 P;  3G28 A;  2BHV A;  1VQL P;  4M0I A;  3B5I A;  3RG6 C;  1YJ9 P;  3CCR P;  1E6J P;  4U0D A;  3H47 A;  1K30 A;  2PEI A;  4WYM A;  1D1D A;  4U0A A;  1AUM A;  4COC A;  3CCM P;  1VQ6 P;  4XFX A;  1VQO P;  1W2B O;  3CCS P;  1Q7Y Q;  4XFY A;  2L6E A;  3Q20 A;  4XRO A;  2CWO A;  1VQ4 P;  1KC8 Q;  1VQP P;  1QRJ A;  2EFJ A;  2M8N A;  2Z46 A;  4U0E A;  5I4T G;  5BS1 A;  2QA4 P;  2XT1 A;  4U0C A;  2QEX P;  1S72 P;  2PEK A;  3HYB A;  3DS0 A;  3DTJ A;  3M1M A;  1ZMB A;  4U0F A;  1N8R Q;  3CCQ P;  4GR2 A;  1M74 A;  4COP A;  1M90 Q;  1K8A Q;  2XV6 A;  1Q82 Q;  1VQ9 P;  3DS1 A;  4XRQ A;  2PY8 A;  5F2O A;  3DS5 A;  1EIA A;  3DPH A;  3P05 A;  1VQ5 P;  1RO2 A;  1QVG O;  5JPA A;  3CCV P;  1VQM P;  1YJW P;  4PH1 A;  2JYG A;  3LRY A;  5DCK A;  1M6N A;  5HGM A;  5HGL A;  3MGE A;  4PH0 A;  3CCJ P;  3CME P;  2LF4 A;  5F2K A;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...