2JB0A

Crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
molecule keywords COLICIN E7 IMMUNITY PROTEIN
total genus 28
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jb0A00
1EMVA 2GZIA 1UJZA 7CEIA 1BXIA 1ZNVA 2NO8A 1UNKA 1AYIA 2GZJA 2GYKA 2VLQA 1CEIA 1GXGA 4UHPB 3U43A 2VLNA 1GXHA 2K5XA 2GZFA 3GKLC 2ERHA 2VLOA 2WPTA 2JBGA 1IMPA 2VLPA 1FR2A 1MZ8A 2GZGA 4F37A 1E0HA 2GZEA 5EW5E 2JAZA 2K0DX 2JB0A 4QKOA 1IMQA 3GJNA
chains in the Genus database with same CATH superfamily
1X3OA 1M74A 4GR6A 5HGNA 3CCLP 1YJWP 5HV8A 4XFYA 1VHNA 2WPTA 2L0QA 2Z44A 1IMPA 2Z46A 4COPA 3G1IA 2GDXA 5HGOA 2OARA 3H4EA 3I56P 2MF4A 4CA3A 3RG2A 2XT1A 2MD9A 5CZDB 2KOSA 3NY7B 2KGDA 2FADA 1M6NA 3P05A 3CXCO 4PH0A 3CC7P 2M5RA 2JBGA 2AVAA 2L4BA 4H2YC 1D1DA 2KOQA 1IMQA 2GZIA 4XRQA 1Q86Q 3G1GA 2K92A 2PEJA 2KOPA 5KP8B 1CEIA 4U0BA 3B5IA 1VQKP 3LRYA 2MY5A 1Q81Q 2MVUA 4U0EA 1OR5A 3CCUP 2ERHA 1RNIA 4GR2A 3WBHA 3MGEA 2JU1A 5EW5E 3HZQA 1HY8A 2FQ1A 2KGCA 2KG8A 1IUQA 2JQ4A 1K9MQ 3U43A 2FVAA 1YI2P 2GZFA 1Z6MA 2AF8A 3EJBA 3OW2O 1DNYA 1MZ8A 1Q7YQ 2FHSC 2JYGA 2ROQA 2PENA 2ONTA 1VKUA 3CC4P 1YITP 2OTJP 3DS5A 2GYKA 2EG5A 2L9FA 2CGQA 2MVVA 2FACA 3DS2A 3DS3A 3G29A 2JGPA 4PXHB 4U0FA 4XFXA 3CD6P 2K0DX 4U0AA 5HGLA 3CCJP 1ZMBA 1NQ4A 1HQBA 2XZ0D 5I4TG 1EOQA 2N6ZA 1VQ4P 2BHVA 1VQ7P 3G28A 2N5IA 1K73Q 2QNWA 3CCRP 2XV6A 4NEOA 3G71P 2AFEA 1JJ2O 3G0VA 1RO0A 2VLOA 2XZ1C 3CCEP 2EHSA 2OTLP 2KORA 2KW2A 2N6YA 4U0DA 1E6JP 3M1MA 1F80D 7CEIA 2PNGA 1BXIA 3CCVP 2VLQA 2FAEA 2X2BA 4IZ6A 5JPAA 1FR2A 2GZEA 5F2OA 2K0YA 2JB0A 3CCMP 2EHTA 1QVGO 3E2DA 2PEOA 2N5HA 1YIJP 4IPYA 2E1MA 2M8NA 5BS2A 3DS4A 1L0IA 2LOLA 1K30A 2JU2A 3CE7A 2FQ0A 1M6EX 4COCA 1UJZA 3CCSP 2KODA 3NTEA 5HVCA 2FVEA 3CMAP 4UHPB 1QRJA 3I55P 2VLNA 2N98A 1KLPA 1ACPA 3GKLC 2LMLA 2LF4A 3DS1A 2GZGA 1YJ9P 2JAZA 2PY8A 3G26A 5EJDA 2NO8A 1AYIA 2JYLA 2CNRA 1W2BO 4PWVB 3RG6C 1QVFO 2K0XA 1AF8A 3DTJA 4U0CA 2Z45A 3LMOA 3HYBA 5KP7B 1E0HA 2KGAA 1VQ9P 4M0IA 4DG9A 2XXMA 2PEQA 1KD1Q 2GZJA 2L22A 5KP6B 1AUMA 1YHQP 1L0HA 2MR8A 1VQOP 3B4QA 2M8PA 1GXHA 4H2WC 3H47A 4QNBA 2PEMA 3DS0A 3CPWO 1VQPP 1A8OA 1RO2A 1S72P 4HKGA 1ZNVA 2GDYA 1KC8Q 1N8RQ 2KGEA 3GZMA 1EIAA 3G6EP 2LIUA 2PEKA 3VRLC 3Q20A 1VQ6P 3H0DA 2MR7A 2CWOA 4MRTC 4F37A 1K8AQ 2LPKA 4H2XC 3GJNA 1BAJA 2KOOA 1VQ5P 1UNKA 1GXGA 1VQMP 2P9XA 2N50A 2PEIA 2GDWA 2KG9A 4XROA 2VLPA 3CMEP 4QKOA 4BPFA 2KR5A 1M90Q 1A43A 5F2KA 1VQNP 3GZLA 2CG5B 5F2NA 1GPJA 2LL8A 4R0MA 1T8KA 2L6EA 5HGMA 5DCKA 2LTEA 1YJNP 2FVFA 1Q82Q 3DPHA 2KWLA 1DV5A 4BPHA 1VQLP 2K94A 2QA4P 1KQSO 2KG6A 2BUOA 2EFJA 3G4SP 2QEXP 2K5XA 1NJIQ 3EJEA 2FQ2A 1VQ8P 2DGYA 4PH1A 4BPGA 1EMVA 2K93A 2K2QA 4WYMA 3CC2P 1M1KQ 3EJDA 4XFZA 2LIWA 2VSQA 2EIAA 3G21A 5BS1A 2CQ8A 2AFDA 3CCQP 2LKIA 2JO0A 2M8LA 2DNWA
chains in the Genus database with same CATH topology
1EMVA 2GZIA 1UJZA 7CEIA 1BXIA 1ZNVA 2NO8A 1UNKA 1AYIA 2GZJA 2GYKA 2VLQA 1CEIA 1GXGA 4UHPB 3U43A 2VLNA 1GXHA 2K5XA 2GZFA 3GKLC 2ERHA 2VLOA 2WPTA 2JBGA 1IMPA 2VLPA 1FR2A 1MZ8A 2GZGA 4F37A 1E0HA 2GZEA 5EW5E 2JAZA 2K0DX 2JB0A 4QKOA 1IMQA 3GJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EMV A;  2GZI A;  1UJZ A;  7CEI A;  1BXI A;  1ZNV A;  2NO8 A;  1UNK A;  1AYI A;  2GZJ A;  2GYK A;  2VLQ A;  1CEI A;  1GXG A;  4UHP B;  3U43 A;  2VLN A;  1GXH A;  2K5X A;  2GZF A;  3GKL C;  2ERH A;  2VLO A;  2WPT A;  2JBG A;  1IMP A;  2VLP A;  1FR2 A;  1MZ8 A;  2GZG A;  4F37 A;  1E0H A;  2GZE A;  5EW5 E;  2JAZ A;  2K0D X;  2JB0 A;  4QKO A;  1IMQ A;  3GJN A; 
#chains in the Genus database with same CATH topology
 1X3O A;  1M74 A;  4GR6 A;  5HGN A;  3CCL P;  1YJW P;  5HV8 A;  4XFY A;  1VHN A;  2WPT A;  2L0Q A;  2Z44 A;  1IMP A;  2Z46 A;  4COP A;  3G1I A;  2GDX A;  5HGO A;  2OAR A;  3H4E A;  3I56 P;  2MF4 A;  4CA3 A;  3RG2 A;  2XT1 A;  2MD9 A;  5CZD B;  2KOS A;  3NY7 B;  2KGD A;  2FAD A;  1M6N A;  3P05 A;  3CXC O;  4PH0 A;  3CC7 P;  2M5R A;  2JBG A;  2AVA A;  2L4B A;  4H2Y C;  1D1D A;  2KOQ A;  1IMQ A;  2GZI A;  4XRQ A;  1Q86 Q;  3G1G A;  2K92 A;  2PEJ A;  2KOP A;  5KP8 B;  1CEI A;  4U0B A;  3B5I A;  1VQK P;  3LRY A;  2MY5 A;  1Q81 Q;  2MVU A;  4U0E A;  1OR5 A;  3CCU P;  2ERH A;  1RNI A;  4GR2 A;  3WBH A;  3MGE A;  2JU1 A;  5EW5 E;  3HZQ A;  1HY8 A;  2FQ1 A;  2KGC A;  2KG8 A;  1IUQ A;  2JQ4 A;  1K9M Q;  3U43 A;  2FVA A;  1YI2 P;  2GZF A;  1Z6M A;  2AF8 A;  3EJB A;  3OW2 O;  1DNY A;  1MZ8 A;  1Q7Y Q;  2FHS C;  2JYG A;  2ROQ A;  2PEN A;  2ONT A;  1VKU A;  3CC4 P;  1YIT P;  2OTJ P;  3DS5 A;  2GYK A;  2EG5 A;  2L9F A;  2CGQ A;  2MVV A;  2FAC A;  3DS2 A;  3DS3 A;  3G29 A;  2JGP A;  4PXH B;  4U0F A;  4XFX A;  3CD6 P;  2K0D X;  4U0A A;  5HGL A;  3CCJ P;  1ZMB A;  1NQ4 A;  1HQB A;  2XZ0 D;  5I4T G;  1EOQ A;  2N6Z A;  1VQ4 P;  2BHV A;  1VQ7 P;  3G28 A;  2N5I A;  1K73 Q;  2QNW A;  3CCR P;  2XV6 A;  4NEO A;  3G71 P;  2AFE A;  1JJ2 O;  3G0V A;  1RO0 A;  2VLO A;  2XZ1 C;  3CCE P;  2EHS A;  2OTL P;  2KOR A;  2KW2 A;  2N6Y A;  4U0D A;  1E6J P;  3M1M A;  1F80 D;  7CEI A;  2PNG A;  1BXI A;  3CCV P;  2VLQ A;  2FAE A;  2X2B A;  4IZ6 A;  5JPA A;  1FR2 A;  2GZE A;  5F2O A;  2K0Y A;  2JB0 A;  3CCM P;  2EHT A;  1QVG O;  3E2D A;  2PEO A;  2N5H A;  1YIJ P;  4IPY A;  2E1M A;  2M8N A;  5BS2 A;  3DS4 A;  1L0I A;  2LOL A;  1K30 A;  2JU2 A;  3CE7 A;  2FQ0 A;  1M6E X;  4COC A;  1UJZ A;  3CCS P;  2KOD A;  3NTE A;  5HVC A;  2FVE A;  3CMA P;  4UHP B;  1QRJ A;  3I55 P;  2VLN A;  2N98 A;  1KLP A;  1ACP A;  3GKL C;  2LML A;  2LF4 A;  3DS1 A;  2GZG A;  1YJ9 P;  2JAZ A;  2PY8 A;  3G26 A;  5EJD A;  2NO8 A;  1AYI A;  2JYL A;  2CNR A;  1W2B O;  4PWV B;  3RG6 C;  1QVF O;  2K0X A;  1AF8 A;  3DTJ A;  4U0C A;  2Z45 A;  3LMO A;  3HYB A;  5KP7 B;  1E0H A;  2KGA A;  1VQ9 P;  4M0I A;  4DG9 A;  2XXM A;  2PEQ A;  1KD1 Q;  2GZJ A;  2L22 A;  5KP6 B;  1AUM A;  1YHQ P;  1L0H A;  2MR8 A;  1VQO P;  3B4Q A;  2M8P A;  1GXH A;  4H2W C;  3H47 A;  4QNB A;  2PEM A;  3DS0 A;  3CPW O;  1VQP P;  1A8O A;  1RO2 A;  1S72 P;  4HKG A;  1ZNV A;  2GDY A;  1KC8 Q;  1N8R Q;  2KGE A;  3GZM A;  1EIA A;  3G6E P;  2LIU A;  2PEK A;  3VRL C;  3Q20 A;  1VQ6 P;  3H0D A;  2MR7 A;  2CWO A;  4MRT C;  4F37 A;  1K8A Q;  2LPK A;  4H2X C;  3GJN A;  1BAJ A;  2KOO A;  1VQ5 P;  1UNK A;  1GXG A;  1VQM P;  2P9X A;  2N50 A;  2PEI A;  2GDW A;  2KG9 A;  4XRO A;  2VLP A;  3CME P;  4QKO A;  4BPF A;  2KR5 A;  1M90 Q;  1A43 A;  5F2K A;  1VQN P;  3GZL A;  2CG5 B;  5F2N A;  1GPJ A;  2LL8 A;  4R0M A;  1T8K A;  2L6E A;  5HGM A;  5DCK A;  2LTE A;  1YJN P;  2FVF A;  1Q82 Q;  3DPH A;  2KWL A;  1DV5 A;  4BPH A;  1VQL P;  2K94 A;  2QA4 P;  1KQS O;  2KG6 A;  2BUO A;  2EFJ A;  3G4S P;  2QEX P;  2K5X A;  1NJI Q;  3EJE A;  2FQ2 A;  1VQ8 P;  2DGY A;  4PH1 A;  4BPG A;  1EMV A;  2K93 A;  2K2Q A;  4WYM A;  3CC2 P;  1M1K Q;  3EJD A;  4XFZ A;  2LIW A;  2VSQ A;  2EIA A;  3G21 A;  5BS1 A;  2CQ8 A;  2AFD A;  3CCQ P;  2LKI A;  2JO0 A;  2M8L A;  2DNW A; 
#chains in the Genus database with same CATH homology
 1EMV A;  2GZI A;  1UJZ A;  7CEI A;  1BXI A;  1ZNV A;  2NO8 A;  1UNK A;  1AYI A;  2GZJ A;  2GYK A;  2VLQ A;  1CEI A;  1GXG A;  4UHP B;  3U43 A;  2VLN A;  1GXH A;  2K5X A;  2GZF A;  3GKL C;  2ERH A;  2VLO A;  2WPT A;  2JBG A;  1IMP A;  2VLP A;  1FR2 A;  1MZ8 A;  2GZG A;  4F37 A;  1E0H A;  2GZE A;  5EW5 E;  2JAZ A;  2K0D X;  2JB0 A;  4QKO A;  1IMQ A;  3GJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...