2JB0A

Crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 28
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jb0A00
2ERHA 2GZJA 2JAZA 2K0DX 4QKOA 3GKLC 1UJZA 2JBGA 1IMPA 3U43A 3GJNA 2VLOA 2VLQA 4UHPB 1CEIA 5EW5E 4F37A 2GZFA 2VLNA 1EMVA 1BXIA 1MZ8A 7CEIA 1UNKA 1GXGA 1FR2A 2GZEA 1GXHA 1AYIA 1ZNVA 1IMQA 2VLPA 2GZIA 2GZGA 2K5XA 2NO8A 1E0HA 2WPTA 2JB0A 2GYKA
chains in the Genus database with same CATH superfamily
3CXCO 2JAZA 2PNGA 2KOOA 3G4SP 4XFZA 5DCKA 1IMPA 1L0HA 2VLOA 4UHPB 1QVFO 2JYGA 2CWOA 2M8LA 2M5RA 3LMOA 2K5XA 1D1DA 4IPYA 2FVEA 5BS1A 2LKIA 2Z46A 3CCRP 2JQ4A 3U43A 5EW5E 2AFEA 1VQ7P 1K30A 2OTJP 3M1MA 4NEOA 2MR8A 3HZQA 3EJBA 2KOPA 3DS2A 3LRYA 2LF4A 2LMLA 5JPAA 3CCLP 3GJNA 2K0YA 3DS3A 1VQ6P 2X2BA 1KLPA 2JU1A 2AFDA 1GPJA 2KODA 2K92A 2KGAA 1YIJP 1Q7YQ 1UJZA 2P9XA 3G28A 4U0BA 1VQ9P 3EJDA 1M6EX 2GZGA 2NO8A 2PEOA 1KC8Q 2KGEA 2K0DX 2PEKA 2LTEA 2K94A 3DTJA 1W2BO 1IUQA 1QVGO 2MY5A 2KG6A 2GZFA 4WYMA 1GXGA 1FR2A 1K8AQ 2KG8A 2KOSA 2XT1A 1AF8A 2M8NA 4PWVB 5BS2A 3OW2O 2LOLA 4COPA 1A43A 3CCMP 1JJ2O 3WBHA 2FVFA 5HGMA 2MVUA 2N6YA 4PH1A 1ACPA 4PH0A 2FADA 1BXIA 1F80D 4H2YC 2FQ2A 2JYLA 1VKUA 3CCQP 4H2WC 2KR5A 5HGLA 4U0AA 2L9FA 2EHTA 2JBGA 4HKGA 3G26A 5I4TG 2OTLP 2N5HA 3CCUP 2XZ0D 1IMQA 2DNWA 1VQ5P 3G21A 4XRQA 2BHVA 1Q81Q 1NJIQ 1S72P 2CQ8A 1OR5A 2KGDA 1M74A 3G1IA 2FVAA 2K2QA 2EFJA 1KD1Q 1M1KQ 1M6NA 1VQOP 5F2NA 2QNWA 2VLQA 1N8RQ 2KOQA 1RO2A 5HV8A 2M8PA 2EG5A 4H2XC 4XROA 3G71P 1EOQA 2FAEA 2GDWA 1YJNP 2PEJA 3EJEA 1Z6MA 1VQ4P 1A8OA 5F2OA 1DV5A 3B4QA 3HYBA 4QKOA 1AUMA 2OARA 5F2KA 2KGCA 3CC2P 3CPWO 1DNYA 5HVCA 4IZ6A 4M0IA 3DPHA 1T8KA 1GXHA 3DS1A 1ZNVA 1Q86Q 2QA4P 2VLPA 3RG2A 3DS4A 1VQNP 1E0HA 1VQLP 2LPKA 3NY7B 3GKLC 1KQSO 3DS0A 2N6ZA 3CMAP 2L4BA 1MZ8A 2MD9A 2JGPA 1YITP 2KWLA 2JO0A 2FQ1A 1RNIA 4BPGA 2Z45A 4XFYA 2L6EA 4U0DA 3CCEP 2KG9A 1YI2P 1VHNA 4U0FA 3CMEP 1BAJA 2FQ0A 2MF4A 2ROQA 5EJDA 4U0CA 4MRTC 4QNBA 1L0IA 5KP7B 2PEQA 2CGQA 2PEIA 1YHQP 3CCJP 1VQ8P 3H4EA 1QRJA 2N5IA 2K0XA 4R0MA 4GR6A 3RG6C 1VQKP 3G0VA 2L22A 3B5IA 3Q20A 2EHSA 4XFXA 2GDYA 3I55P 4COCA 3GZLA 2LL8A 4BPFA 1EIAA 2DGYA 2Z44A 3CCVP 2WPTA 3CC4P 3VRLC 3G29A 1K9MQ 1RO0A 5HGNA 2LIWA 2VSQA 2EIAA 2MVVA 4F37A 5CZDB 3CC7P 4CA3A 2AF8A 4BPHA 3I56P 1YJWP 3CCSP 2JU2A 1HQBA 1NQ4A 2ERHA 3E2DA 3CD6P 2PY8A 1M90Q 2BUOA 4U0EA 3GZMA 2E1MA 2LIUA 2MR7A 2VLNA 1EMVA 2L0QA 1UNKA 2KORA 1AYIA 5KP6B 1K73Q 2FACA 3H0DA 2GDXA 2GZIA 2QEXP 3DS5A 3NTEA 3G6EP 2GYKA 2GZJA 2N98A 4DG9A 5KP8B 3MGEA 4PXHB 1CEIA 2FHSC 3CE7A 2CG5B 2GZEA 1Q82Q 2K93A 4GR2A 1HY8A 2ONTA 1VQMP 2JB0A 1VQPP 3G1GA 1YJ9P 2PEMA 3P05A 2N50A 3H47A 2XV6A 7CEIA 5HGOA 2KW2A 2CNRA 1X3OA 1E6JP 1ZMBA 2PENA 2XZ1C 2AVAA 2XXMA
chains in the Genus database with same CATH topology
2ERHA 2GZJA 2JAZA 2K0DX 4QKOA 3GKLC 1UJZA 2JBGA 1IMPA 3U43A 3GJNA 2VLOA 2VLQA 4UHPB 1CEIA 5EW5E 4F37A 2GZFA 2VLNA 1EMVA 1BXIA 1MZ8A 7CEIA 1UNKA 1GXGA 1FR2A 2GZEA 1GXHA 1AYIA 1ZNVA 1IMQA 2VLPA 2GZIA 2GZGA 2K5XA 2NO8A 1E0HA 2WPTA 2JB0A 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERH A;  2GZJ A;  2JAZ A;  2K0D X;  4QKO A;  3GKL C;  1UJZ A;  2JBG A;  1IMP A;  3U43 A;  3GJN A;  2VLO A;  2VLQ A;  4UHP B;  1CEI A;  5EW5 E;  4F37 A;  2GZF A;  2VLN A;  1EMV A;  1BXI A;  1MZ8 A;  7CEI A;  1UNK A;  1GXG A;  1FR2 A;  2GZE A;  1GXH A;  1AYI A;  1ZNV A;  1IMQ A;  2VLP A;  2GZI A;  2GZG A;  2K5X A;  2NO8 A;  1E0H A;  2WPT A;  2JB0 A;  2GYK A; 
#chains in the Genus database with same CATH topology
 3CXC O;  2JAZ A;  2PNG A;  2KOO A;  3G4S P;  4XFZ A;  5DCK A;  1IMP A;  1L0H A;  2VLO A;  4UHP B;  1QVF O;  2JYG A;  2CWO A;  2M8L A;  2M5R A;  3LMO A;  2K5X A;  1D1D A;  4IPY A;  2FVE A;  5BS1 A;  2LKI A;  2Z46 A;  3CCR P;  2JQ4 A;  3U43 A;  5EW5 E;  2AFE A;  1VQ7 P;  1K30 A;  2OTJ P;  3M1M A;  4NEO A;  2MR8 A;  3HZQ A;  3EJB A;  2KOP A;  3DS2 A;  3LRY A;  2LF4 A;  2LML A;  5JPA A;  3CCL P;  3GJN A;  2K0Y A;  3DS3 A;  1VQ6 P;  2X2B A;  1KLP A;  2JU1 A;  2AFD A;  1GPJ A;  2KOD A;  2K92 A;  2KGA A;  1YIJ P;  1Q7Y Q;  1UJZ A;  2P9X A;  3G28 A;  4U0B A;  1VQ9 P;  3EJD A;  1M6E X;  2GZG A;  2NO8 A;  2PEO A;  1KC8 Q;  2KGE A;  2K0D X;  2PEK A;  2LTE A;  2K94 A;  3DTJ A;  1W2B O;  1IUQ A;  1QVG O;  2MY5 A;  2KG6 A;  2GZF A;  4WYM A;  1GXG A;  1FR2 A;  1K8A Q;  2KG8 A;  2KOS A;  2XT1 A;  1AF8 A;  2M8N A;  4PWV B;  5BS2 A;  3OW2 O;  2LOL A;  4COP A;  1A43 A;  3CCM P;  1JJ2 O;  3WBH A;  2FVF A;  5HGM A;  2MVU A;  2N6Y A;  4PH1 A;  1ACP A;  4PH0 A;  2FAD A;  1BXI A;  1F80 D;  4H2Y C;  2FQ2 A;  2JYL A;  1VKU A;  3CCQ P;  4H2W C;  2KR5 A;  5HGL A;  4U0A A;  2L9F A;  2EHT A;  2JBG A;  4HKG A;  3G26 A;  5I4T G;  2OTL P;  2N5H A;  3CCU P;  2XZ0 D;  1IMQ A;  2DNW A;  1VQ5 P;  3G21 A;  4XRQ A;  2BHV A;  1Q81 Q;  1NJI Q;  1S72 P;  2CQ8 A;  1OR5 A;  2KGD A;  1M74 A;  3G1I A;  2FVA A;  2K2Q A;  2EFJ A;  1KD1 Q;  1M1K Q;  1M6N A;  1VQO P;  5F2N A;  2QNW A;  2VLQ A;  1N8R Q;  2KOQ A;  1RO2 A;  5HV8 A;  2M8P A;  2EG5 A;  4H2X C;  4XRO A;  3G71 P;  1EOQ A;  2FAE A;  2GDW A;  1YJN P;  2PEJ A;  3EJE A;  1Z6M A;  1VQ4 P;  1A8O A;  5F2O A;  1DV5 A;  3B4Q A;  3HYB A;  4QKO A;  1AUM A;  2OAR A;  5F2K A;  2KGC A;  3CC2 P;  3CPW O;  1DNY A;  5HVC A;  4IZ6 A;  4M0I A;  3DPH A;  1T8K A;  1GXH A;  3DS1 A;  1ZNV A;  1Q86 Q;  2QA4 P;  2VLP A;  3RG2 A;  3DS4 A;  1VQN P;  1E0H A;  1VQL P;  2LPK A;  3NY7 B;  3GKL C;  1KQS O;  3DS0 A;  2N6Z A;  3CMA P;  2L4B A;  1MZ8 A;  2MD9 A;  2JGP A;  1YIT P;  2KWL A;  2JO0 A;  2FQ1 A;  1RNI A;  4BPG A;  2Z45 A;  4XFY A;  2L6E A;  4U0D A;  3CCE P;  2KG9 A;  1YI2 P;  1VHN A;  4U0F A;  3CME P;  1BAJ A;  2FQ0 A;  2MF4 A;  2ROQ A;  5EJD A;  4U0C A;  4MRT C;  4QNB A;  1L0I A;  5KP7 B;  2PEQ A;  2CGQ A;  2PEI A;  1YHQ P;  3CCJ P;  1VQ8 P;  3H4E A;  1QRJ A;  2N5I A;  2K0X A;  4R0M A;  4GR6 A;  3RG6 C;  1VQK P;  3G0V A;  2L22 A;  3B5I A;  3Q20 A;  2EHS A;  4XFX A;  2GDY A;  3I55 P;  4COC A;  3GZL A;  2LL8 A;  4BPF A;  1EIA A;  2DGY A;  2Z44 A;  3CCV P;  2WPT A;  3CC4 P;  3VRL C;  3G29 A;  1K9M Q;  1RO0 A;  5HGN A;  2LIW A;  2VSQ A;  2EIA A;  2MVV A;  4F37 A;  5CZD B;  3CC7 P;  4CA3 A;  2AF8 A;  4BPH A;  3I56 P;  1YJW P;  3CCS P;  2JU2 A;  1HQB A;  1NQ4 A;  2ERH A;  3E2D A;  3CD6 P;  2PY8 A;  1M90 Q;  2BUO A;  4U0E A;  3GZM A;  2E1M A;  2LIU A;  2MR7 A;  2VLN A;  1EMV A;  2L0Q A;  1UNK A;  2KOR A;  1AYI A;  5KP6 B;  1K73 Q;  2FAC A;  3H0D A;  2GDX A;  2GZI A;  2QEX P;  3DS5 A;  3NTE A;  3G6E P;  2GYK A;  2GZJ A;  2N98 A;  4DG9 A;  5KP8 B;  3MGE A;  4PXH B;  1CEI A;  2FHS C;  3CE7 A;  2CG5 B;  2GZE A;  1Q82 Q;  2K93 A;  4GR2 A;  1HY8 A;  2ONT A;  1VQM P;  2JB0 A;  1VQP P;  3G1G A;  1YJ9 P;  2PEM A;  3P05 A;  2N50 A;  3H47 A;  2XV6 A;  7CEI A;  5HGO A;  2KW2 A;  2CNR A;  1X3O A;  1E6J P;  1ZMB A;  2PEN A;  2XZ1 C;  2AVA A;  2XXM A; 
#chains in the Genus database with same CATH homology
 2ERH A;  2GZJ A;  2JAZ A;  2K0D X;  4QKO A;  3GKL C;  1UJZ A;  2JBG A;  1IMP A;  3U43 A;  3GJN A;  2VLO A;  2VLQ A;  4UHP B;  1CEI A;  5EW5 E;  4F37 A;  2GZF A;  2VLN A;  1EMV A;  1BXI A;  1MZ8 A;  7CEI A;  1UNK A;  1GXG A;  1FR2 A;  2GZE A;  1GXH A;  1AYI A;  1ZNV A;  1IMQ A;  2VLP A;  2GZI A;  2GZG A;  2K5X A;  2NO8 A;  1E0H A;  2WPT A;  2JB0 A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...