2JB0A

Crystal structure of the mutant h573a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
84
structure length
84
Chain Sequence
LKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords COLICIN E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jb0A00
3U43A 4QKOA 3GJNA 2GZJA 2JAZA 1UNKA 1UJZA 2GZEA 2K5XA 2VLQA 1MZ8A 1ZNVA 2K0DX 5EW5E 2GZFA 2VLPA 4F37A 1GXHA 2VLNA 1EMVA 2JB0A 1CEIA 1AYIA 2VLOA 2GYKA 1FR2A 1GXGA 3GKLC 4UHPB 2JBGA 2GZIA 1IMPA 1E0HA 1IMQA 7CEIA 2NO8A 1BXIA 2ERHA 2WPTA 2GZGA
chains in the Genus database with same CATH superfamily
2PY8A 4PXHB 1QVFO 2GDYA 1ZNVA 4DG9A 1S72P 4XFZA 2CNRA 2LTEA 1AYIA 1M74A 1YJNP 3CCVP 1E0HA 4XFYA 1Q82Q 1A43A 1X3OA 2Z46A 1RNIA 3B5IA 3DS1A 5BS1A 2M8PA 2KG9A 2XZ1C 1VQMP 2EG5A 4U0EA 2GDXA 1AUMA 2N5IA 2JYGA 7CEIA 1YHQP 2GDWA 1K73Q 2KODA 3GZLA 2KGCA 2Z44A 1YJWP 3CMEP 2CWOA 1E6JP 3G29A 4QNBA 2MD9A 2CGQA 2VLOA 3CE7A 1VKUA 2NO8A 1BXIA 3H4EA 4WYMA 2M5RA 3CCUP 2EFJA 2LF4A 3EJDA 2X2BA 2L6EA 3G0VA 2GZFA 2QNWA 4U0BA 2KR5A 2VLNA 1VHNA 5HGMA 1VQ5P 3HYBA 3GKLC 2N6ZA 4NEOA 5EJDA 2XT1A 2AFDA 2LMLA 1RO0A 5I4TG 1VQ8P 2K0XA 4BPFA 5F2KA 1K9MQ 1KLPA 2ROQA 4XRQA 1KQSO 2K0DX 1JJ2O 3CCLP 3DS2A 2PENA 4BPHA 3CXCO 4UHPB 1A8OA 5KP7B 1NQ4A 3I55P 2MVVA 3CCRP 1Z6MA 2FAEA 2N50A 4GR2A 5F2OA 1ZMBA 3DS0A 2AF8A 2JGPA 2EHSA 3DS3A 1VQOP 1L0HA 2KOQA 2K92A 2KWLA 4H2XC 2LKIA 3GJNA 2JAZA 2FQ0A 1UNKA 2E1MA 4H2YC 5F2NA 1VQKP 4COCA 4GR6A 2KG6A 4BPGA 3H47A 2N98A 4XROA 1GXGA 1DV5A 2LIWA 2M8NA 3P05A 5KP8B 3LRYA 3G28A 3B4QA 2GZGA 2ONTA 2GZJA 2GZEA 1HQBA 2CG5B 2BHVA 1GPJA 2N5HA 2KGEA 2LL8A 1VQ6P 1EMVA 2KORA 2FVFA 3CCEP 3G21A 2BUOA 2PEIA 3G71P 2QA4P 2XZ0D 1W2BO 2OTJP 2FQ1A 2WPTA 1T8KA 3CCMP 3G1IA 2KGDA 1M90Q 1VQ7P 1K30A 2FHSC 1VQLP 2EHTA 3LMOA 2K93A 3CC2P 4U0DA 1IMPA 2MVUA 2ERHA 2XXMA 1OR5A 2VSQA 5CZDB 3G6EP 5HGOA 2JU2A 5HV8A 2VLPA 2KG8A 2M8LA 3Q20A 3RG2A 2FVEA 1M6EX 2MR8A 5HGNA 4U0CA 4IZ6A 3EJEA 4XFXA 1HY8A 1M1KQ 2OARA 4COPA 3U43A 3CC7P 4CA3A 2DNWA 4HKGA 2K5XA 2Z45A 3CMAP 2FADA 2N6YA 2PEQA 4U0FA 2L0QA 2EIAA 2K94A 2JB0A 4H2WC 1CEIA 2GYKA 2L9FA 2LOLA 1YJ9P 1KD1Q 1VQNP 2PNGA 1D1DA 3DS4A 3CCJP 2JU1A 2PEMA 3I56P 2DGYA 1UJZA 3CD6P 1RO2A 2MF4A 1MZ8A 2FVAA 2K0YA 1K8AQ 3G4SP 1N8RQ 1Q86Q 3G26A 2KOPA 3G1GA 2CQ8A 2KW2A 4PWVB 3RG6C 5HVCA 3H0DA 1DNYA 3CCSP 2MR7A 2PEKA 2LPKA 3DPHA 2QEXP 1Q7YQ 3EJBA 2PEOA 2VLQA 2KGAA 2FACA 2L22A 5DCKA 5BS2A 1GXHA 1QRJA 3DTJA 3VRLC 3MGEA 1Q81Q 1FR2A 4U0AA 3M1MA 2K2QA 2XV6A 4QKOA 1F80D 2MY5A 4M0IA 1YI2P 2OTLP 4R0MA 3E2DA 2AFEA 2JO0A 4F37A 3HZQA 1VQ4P 1VQ9P 1AF8A 1BAJA 1YIJP 2KOOA 1M6NA 3CCQP 1EIAA 2JBGA 1YITP 2AVAA 4IPYA 4MRTC 3NTEA 1KC8Q 2JYLA 1NJIQ 3DS5A 1ACPA 2PEJA 3OW2O 5JPAA 1EOQA 3CC4P 5KP6B 2LIUA 1L0IA 2KOSA 1VQPP 2L4BA 2GZIA 4PH0A 2P9XA 2JQ4A 4PH1A 5HGLA 3NY7B 2FQ2A 5EW5E 1QVGO 3WBHA 1IMQA 3GZMA 3CPWO 1IUQA
chains in the Genus database with same CATH topology
3U43A 4QKOA 3GJNA 2GZJA 2JAZA 1UNKA 1UJZA 2GZEA 2K5XA 2VLQA 1MZ8A 1ZNVA 2K0DX 5EW5E 2GZFA 2VLPA 4F37A 1GXHA 2VLNA 1EMVA 2JB0A 1CEIA 1AYIA 2VLOA 2GYKA 1FR2A 1GXGA 3GKLC 4UHPB 2JBGA 2GZIA 1IMPA 1E0HA 1IMQA 7CEIA 2NO8A 1BXIA 2ERHA 2WPTA 2GZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U43 A;  4QKO A;  3GJN A;  2GZJ A;  2JAZ A;  1UNK A;  1UJZ A;  2GZE A;  2K5X A;  2VLQ A;  1MZ8 A;  1ZNV A;  2K0D X;  5EW5 E;  2GZF A;  2VLP A;  4F37 A;  1GXH A;  2VLN A;  1EMV A;  2JB0 A;  1CEI A;  1AYI A;  2VLO A;  2GYK A;  1FR2 A;  1GXG A;  3GKL C;  4UHP B;  2JBG A;  2GZI A;  1IMP A;  1E0H A;  1IMQ A;  7CEI A;  2NO8 A;  1BXI A;  2ERH A;  2WPT A;  2GZG A; 
#chains in the Genus database with same CATH topology
 2PY8 A;  4PXH B;  1QVF O;  2GDY A;  1ZNV A;  4DG9 A;  1S72 P;  4XFZ A;  2CNR A;  2LTE A;  1AYI A;  1M74 A;  1YJN P;  3CCV P;  1E0H A;  4XFY A;  1Q82 Q;  1A43 A;  1X3O A;  2Z46 A;  1RNI A;  3B5I A;  3DS1 A;  5BS1 A;  2M8P A;  2KG9 A;  2XZ1 C;  1VQM P;  2EG5 A;  4U0E A;  2GDX A;  1AUM A;  2N5I A;  2JYG A;  7CEI A;  1YHQ P;  2GDW A;  1K73 Q;  2KOD A;  3GZL A;  2KGC A;  2Z44 A;  1YJW P;  3CME P;  2CWO A;  1E6J P;  3G29 A;  4QNB A;  2MD9 A;  2CGQ A;  2VLO A;  3CE7 A;  1VKU A;  2NO8 A;  1BXI A;  3H4E A;  4WYM A;  2M5R A;  3CCU P;  2EFJ A;  2LF4 A;  3EJD A;  2X2B A;  2L6E A;  3G0V A;  2GZF A;  2QNW A;  4U0B A;  2KR5 A;  2VLN A;  1VHN A;  5HGM A;  1VQ5 P;  3HYB A;  3GKL C;  2N6Z A;  4NEO A;  5EJD A;  2XT1 A;  2AFD A;  2LML A;  1RO0 A;  5I4T G;  1VQ8 P;  2K0X A;  4BPF A;  5F2K A;  1K9M Q;  1KLP A;  2ROQ A;  4XRQ A;  1KQS O;  2K0D X;  1JJ2 O;  3CCL P;  3DS2 A;  2PEN A;  4BPH A;  3CXC O;  4UHP B;  1A8O A;  5KP7 B;  1NQ4 A;  3I55 P;  2MVV A;  3CCR P;  1Z6M A;  2FAE A;  2N50 A;  4GR2 A;  5F2O A;  1ZMB A;  3DS0 A;  2AF8 A;  2JGP A;  2EHS A;  3DS3 A;  1VQO P;  1L0H A;  2KOQ A;  2K92 A;  2KWL A;  4H2X C;  2LKI A;  3GJN A;  2JAZ A;  2FQ0 A;  1UNK A;  2E1M A;  4H2Y C;  5F2N A;  1VQK P;  4COC A;  4GR6 A;  2KG6 A;  4BPG A;  3H47 A;  2N98 A;  4XRO A;  1GXG A;  1DV5 A;  2LIW A;  2M8N A;  3P05 A;  5KP8 B;  3LRY A;  3G28 A;  3B4Q A;  2GZG A;  2ONT A;  2GZJ A;  2GZE A;  1HQB A;  2CG5 B;  2BHV A;  1GPJ A;  2N5H A;  2KGE A;  2LL8 A;  1VQ6 P;  1EMV A;  2KOR A;  2FVF A;  3CCE P;  3G21 A;  2BUO A;  2PEI A;  3G71 P;  2QA4 P;  2XZ0 D;  1W2B O;  2OTJ P;  2FQ1 A;  2WPT A;  1T8K A;  3CCM P;  3G1I A;  2KGD A;  1M90 Q;  1VQ7 P;  1K30 A;  2FHS C;  1VQL P;  2EHT A;  3LMO A;  2K93 A;  3CC2 P;  4U0D A;  1IMP A;  2MVU A;  2ERH A;  2XXM A;  1OR5 A;  2VSQ A;  5CZD B;  3G6E P;  5HGO A;  2JU2 A;  5HV8 A;  2VLP A;  2KG8 A;  2M8L A;  3Q20 A;  3RG2 A;  2FVE A;  1M6E X;  2MR8 A;  5HGN A;  4U0C A;  4IZ6 A;  3EJE A;  4XFX A;  1HY8 A;  1M1K Q;  2OAR A;  4COP A;  3U43 A;  3CC7 P;  4CA3 A;  2DNW A;  4HKG A;  2K5X A;  2Z45 A;  3CMA P;  2FAD A;  2N6Y A;  2PEQ A;  4U0F A;  2L0Q A;  2EIA A;  2K94 A;  2JB0 A;  4H2W C;  1CEI A;  2GYK A;  2L9F A;  2LOL A;  1YJ9 P;  1KD1 Q;  1VQN P;  2PNG A;  1D1D A;  3DS4 A;  3CCJ P;  2JU1 A;  2PEM A;  3I56 P;  2DGY A;  1UJZ A;  3CD6 P;  1RO2 A;  2MF4 A;  1MZ8 A;  2FVA A;  2K0Y A;  1K8A Q;  3G4S P;  1N8R Q;  1Q86 Q;  3G26 A;  2KOP A;  3G1G A;  2CQ8 A;  2KW2 A;  4PWV B;  3RG6 C;  5HVC A;  3H0D A;  1DNY A;  3CCS P;  2MR7 A;  2PEK A;  2LPK A;  3DPH A;  2QEX P;  1Q7Y Q;  3EJB A;  2PEO A;  2VLQ A;  2KGA A;  2FAC A;  2L22 A;  5DCK A;  5BS2 A;  1GXH A;  1QRJ A;  3DTJ A;  3VRL C;  3MGE A;  1Q81 Q;  1FR2 A;  4U0A A;  3M1M A;  2K2Q A;  2XV6 A;  4QKO A;  1F80 D;  2MY5 A;  4M0I A;  1YI2 P;  2OTL P;  4R0M A;  3E2D A;  2AFE A;  2JO0 A;  4F37 A;  3HZQ A;  1VQ4 P;  1VQ9 P;  1AF8 A;  1BAJ A;  1YIJ P;  2KOO A;  1M6N A;  3CCQ P;  1EIA A;  2JBG A;  1YIT P;  2AVA A;  4IPY A;  4MRT C;  3NTE A;  1KC8 Q;  2JYL A;  1NJI Q;  3DS5 A;  1ACP A;  2PEJ A;  3OW2 O;  5JPA A;  1EOQ A;  3CC4 P;  5KP6 B;  2LIU A;  1L0I A;  2KOS A;  1VQP P;  2L4B A;  2GZI A;  4PH0 A;  2P9X A;  2JQ4 A;  4PH1 A;  5HGL A;  3NY7 B;  2FQ2 A;  5EW5 E;  1QVG O;  3WBH A;  1IMQ A;  3GZM A;  3CPW O;  1IUQ A; 
#chains in the Genus database with same CATH homology
 3U43 A;  4QKO A;  3GJN A;  2GZJ A;  2JAZ A;  1UNK A;  1UJZ A;  2GZE A;  2K5X A;  2VLQ A;  1MZ8 A;  1ZNV A;  2K0D X;  5EW5 E;  2GZF A;  2VLP A;  4F37 A;  1GXH A;  2VLN A;  1EMV A;  2JB0 A;  1CEI A;  1AYI A;  2VLO A;  2GYK A;  1FR2 A;  1GXG A;  3GKL C;  4UHP B;  2JBG A;  2GZI A;  1IMP A;  1E0H A;  1IMQ A;  7CEI A;  2NO8 A;  1BXI A;  2ERH A;  2WPT A;  2GZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...