3CC7P

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc7P02
3G4SP 2OTJP 1VQ6P 1W2BO 1VQ9P 1K9MQ 3I55P 1VQPP 1VQ7P 1JJ2O 1VQ4P 1S72P 1VQ5P 1YHQP 1KQSO 3CCJP 3G6EP 3CD6P 1K73Q 3CPWO 1QVGO 3G71P 3CCVP 1KC8Q 3CMAP 1VQLP 3I56P 1Q7YQ 3OW2O 2QEXP 3CMEP 3CCSP 1K8AQ 1VQKP 1VQNP 3CCMP 1YI2P 1Q81Q 3CCQP 1Q82Q 3CXCO 1N8RQ 3CC4P 1YJNP 2OTLP 3CC2P 3CCLP 3CC7P 1YITP 3CCEP 1M1KQ 1QVFO 3CCRP 1YIJP 1YJ9P 3CCUP 2QA4P 1YJWP 1M90Q 1Q86Q 1NJIQ 1KD1Q 1VQ8P 1VQMP 1VQOP
chains in the Genus database with same CATH superfamily
1VQ9P 5AVWB 3CWBE 1NAFA 2P9XA 1MZ9A 2E5YA 4AQRD 2ROQA 2ZAEB 3AEEC 1SQQG 1QX8A 4U0DA 2WITA 3LIDA 1SFCB 3H1KG 3GHGC 5KKZB 3HD7C 2GZIA 3HE4B 3MIWA 2JR8A 5GTHE 3TGUJ 3H1JD 3IF4A 4H2XC 1KZUB 3B4SA 3GF3A 1YQ3C 5BU5A 1YBKA 2KZJA 5C39A 1KC8Q 3S1KA 1CI6B 1QEXA 2GZEA 1YI2P 1SQQJ 1AVYA 5KP8B 2GA1A 2XT1A 1S3JA 1VQMP 3H1KD 5CBOA 3HD7B 1IFPA 2KGDA 3H1IJ 1WT6A 2K93A 2K1AA 3HZQA 2BEZF 2C9LY 2N6YA 1SQXE 2C0WA 2R3SA 2P58A 5AW5B 1EXJA 1BGYE 4R0MA 3CC7P 3IR9A 2N5HA 1BE3G 1VQ8P 2GUVA 3MZWB 3G9RA 2HG5D 4OH8B 2I8DA 3AE7C 3R4YA 1NTKG 2N9BA 4L75A 4GIFA 2KNCB 3GG2A 3NFQA 3B4QA 1M1KQ 1FZBA 3CXHE 4IL6H 2N1TC 2P10A 1NTKK 2PEQA 2LXBA 5KLIC 3H1LE 2WWWA 1RO0A 1JY2N 1BE3D 3KXDA 3HTKB 1EC5A 2KOQA 3TDKA 3PLNA 3H1HJ 1GW4A 1GTWA 2D2CD 3CCQP 4H0LD 2WSEH 1NTKD 1YJ9P 3VTPC 2FHSC 1PV3A 1SQPE 3M06A 2N50A 2KORA 1M57D 4PD4E 1KLPA 3HUSA 3M9QA 5KLIB 3AE6C 1NAYA 2IPPA 2EHTA 2P1JA 1KILD 2QA4P 1RHZB 2JAZA 2L9FA 4ASWA 1SLQA 3TYYA 2QSIA 1KTMA 2K94A 1FBMA 2MR7A 3BCCJ 2N6ZA 1VQ5P 4QNBA 2NPSC 5HGLA 2DW3A 2IBZG 3DS1A 3Q3DA 2A06G 5HGMA 2WSFJ 1XTCC 1L2PA 3F5HA 3L75G 1PPJE 2LKIA 2WPTA 1KILA 2MKVA 2KODA 1GD2E 2M5AA 3WBHA 2QM7A 1JTHA 1U7JA 2YMKA 1N73A 4IFDK 2LIUA 3EJEA 2NPSB 3E2DA 1NWQA 2IBZD 2KG6A 4U0EA 2A06D 2XNXA 2L91A 1HVVA 2FFDA 2Q5UA 1PP9G 5AVVB 3L75D 2J5UA 2MR8A 3WUVA 1FDIA 1L0LJ 2WTYA 1VF5D 2KG9A 1GK6A 3AEDC 4F37A 3HE5A 4BPFA 1OR5A 5KLVJ 1RF1C 3L71D 2WPVB 2RKLA 5CCHD 4WB4A 1BXIA 1PP9D 1MKMA 5AW9B 4EOTA 2H88C 1NTMG 2R32A 3N4XA 4WY4A 3WU2E 5APUA 1S2EA 3KQGA 1YJWP 5KP7B 1W2EA 1NTMK 3L4FA 4AYCA 1BSNA 4RJTA 1DH3A 1GDTA 1SS1A 2K9JA 3DPHA 3VYIA 5AVTB 5CCHA 2H43A 2AFDA 2L4BA 3G28A 2K0DX 1NTZG 2J59M 1UNKA 1PIXA 3H1JE 1EZVG 3A7OA 1NTMD 3V2QA 5KAFH 3O8ZA 1GXHA 1LTTC 2PGDA 1L4AA 1NTZK 1PZQA 4OVNF 4BRYB 3L73D 3V4WA 3UIAA 3U1CA 2LMLA 1FR2A 4U0FA 1ZXGA 4U0BA 3CMEP 1L0IA 3C8VA 1LWUA 3P05A 1W5CE 5F2NA 3VRLC 1NTZD 2ZJSE 3S4RA 3JCUE 3JSVC 5CJ0A 2G3AA 2W6AA 3DS5A 4MRTC 4YXDC 1HJ0A 4XA4A 4U3FE 3KHUA 5APSA 3G3ZA 3A0HH 1GL2D 1MUUA 2WVRA 4GOFA 4UB6E 2O1JA 1IJDB 3V2RA 2Z44A 1EMVA 2N98A 2E75D 4U7JA 3VMZA 3L74G 2PP6A 4ASVA 1WMKA 1N86A 1E0HA 1LTGC 1RE3A 5CBNA 3C1LA 2C9NY 3H47A 4HKGA 1GL2A 5CHXA 2WT7A 2V7QH 1JJ2O 1KFNA 4H44D 2JU2A 1SQXJ 2JKVA 1BGYJ 2MVVA 1JO5A 3SSUA 4YPCA 3L74D 2EIAA 5KJ7D 1YITP 3U59A 1JCDA 1HTLC 1T2KD 2E74B 5B66H 2QM8A 4HB1A 1L0NE 3HUSC 3QWOC 2WQYC 2QJYB 3M0DA 3JC22 1USEA 3G26A 1S1CX 4IFMA 1YIJP 2D2CC 1PEOA 3H1LJ 5KJ7A 2HODA 2FYUK 4H0LC 2ERHA 1S4XA 1URQC 2CPBA 3G6EP 2IYOA 3GZMA 1VPCA 3AEBC 2CQ8A 2YNYA 4JQ0D 4BWNA 1FU1A 3B5ND 5E79H 3HUSB 1BCCG 1N2DC 2FYUD 1SQPJ 1YTZI 3KPEA 3B71A 2JWAA 1D1DA 5EJDA 1NKZB 3FXEA 3L70G 2QNWA 1KILC 2YIUC 2D2CB 5AVRB 3A0BH 3VOPA 4H0LB 3VMYA 2LPKA 1LT1A 1URQB 1N73C 1PGQA 1Q82Q 1PPJG 2EG5A 1AF8A 3RGUA 1P84I 4RESB 4ZKPA 3AECC 2JGPA 1FJKA 2KZIA 4IL6E 2KLVA 1BAJA 2FFDC 3OA7A 1BCCD 4DT0A 1A02F 1NKNA 2LR2A 3L70D 2KXPB 2YIUB 1VDFA 3AEFC 5M1BA 2OARA 3TNUA 1E6JP 3L71E 1HH0A 1NU1E 2JYLA 1N73B 2FQ1A 1OFCX 1VHNA 2ZYDA 5TISH 2DGYA 2L0QA 2OYIA 2KGAA 3BATA 3BRTB 1S5LH 3IFMA 2E76D 1PEUA 3CL3D 3GLMA 3RL0D 4L73A 4BXLA 4NPDA 1IZNB 3CCLP 4WY4C 2JJLA 1VF5C 1U57A 1H89A 3NY7B 2HPCA 3RBZA 3VP9A 2Y9YA 4D6TE 3HE5B 4GR6A 2ZT9D 2AEFA 4R4LA 1LP1B 1ZR2A 1DX7A 3MGNA 2EFJA 2E43A 2M8LA 5CCHC 1RQVA 2I1KA 3M9HA 4YTPC 4I7ZC 4M3LA 4IPYA 3L73E 1SP4A 4H2WC 4WY4B 3I55P 3W67A 1VF5B 1VL2A 2YKPA 1P84H 1L4AC 4C7NA 1KQLA 2KOOA 5CMZA 4H13D 5CJ4A 2BUOA 4DZOA 2JYGA 1LWUC 3IAOA 2K9JB 1YQ4C 1K05A 3GMAA 2GZFA 1SQQK 2I1JA 3H1IG 2WPSA 1X79B 2JU1A 4DJGA 1IFJA 2CPSA 4I2LC 1AQTA 4PJ0H 4NPEA 4LLHA 4UHPB 3TGUD 1QVGO 1Y8AA 3A2AA 1JB0J 1L4AB 3C9IA 3Q5PA 1OW6A 2PEJA 4K3AA 3PH0A 2KK7A 1SQQD 3GHGB 1GXGA 4JPZB 1X3OA 2KSJA 1KQSO 3M0AA 3H1ID 2WSFH 2GZGA 4XROA 1SQBE 4U0CA 1FS0E 3EFGA 1ZN5A 3KZIH 1RE3C 1NJIQ 4YXWH 2R5DA 1GL2C 2Y0CA 5HV8A 2FVEA 3B5IA 1ZRTE 4NPFX 1JY2O 3ABVC 4BPGA 4U3FJ 5APYA 3ITKA 3H1HG 4NEOA 1J1EC 1OX3A 1DD3A 3B8EB 2KS1A 3KDPB 2BASA 3EFFK 1EXIA 1EDJA 2MY5A 3E7KA 5KAFE 3FXDA 3M9BA 5AVUB 2RH0A 1GL2B 2Z5HA 3V5BA 4H44C 3LIEA 1EZVI 1RH5B 3AE2C 4OWFA 1P84D 3M0DC 5AW8B 3MUDA 2KOSA 3H1HD 1J1EB 5KAIH 2QJPC 5GTIH 5KJ7C 4GR2A 5HGOA 3V6IA 1VQPP 1BSHA 1N7SD 1PGOA 3BCCG 4TT3H 2N1TB 4Y99C 1RE4A 3AE3C 1T2KC 1OW8A 4M0IA 3FWLA 2GUSA 3CX5D 4PH0A 1FE6A 2M3EA 1AYIA 2N5IA 1G2CB 3A0HE 3RK2C 5BS2A 3G21A 4N78D 1KYOE 1X8YA 2WPRA 2OTJP 3EJDA 2QJPB 1L0NJ 1N7SA 3M1MA 4UB8H 2BHVA 5CZDB 3MTUE 1AJYA 3BCCD 2B89A 4Y99B 2Z46A 3RG6C 1N7LA 5AVZB 3G1GA 2KI7B 1YTZT 2IX7C 2Q1KA 3KYQA 1EIAA 3L72E 1VQ4P 5DCKA 3RK2B 1IFIA 5H2FH 1G1IA 3CPWO 1L0LG 1SQVE 2KOPA 4I6MC 2W6JH 5KLVG 1FDMA 3CCEP 3L35A 1LTIC 3FX0A 2WSCH 1L0LK 2K88A 5EW5E 5APXA 5KLVK 2OYIC 2R3CA 1K04A 4DG9A 2O01J 5B66E 1QL1A 1DIPA 1VQKP 3HYBA 1OVVA 2IYPA 4MN4C 2ZYAA 4XFXA 1L0LD 1AQ5A 1OMIA 1ZOYC 2KB7P 1VQ6P 3TNUB 2B87A 5KLVD 2LXCB 2K5XA 1S9KE 3TF5A 2LTEA 2OYIB 3GW6A 3MP7B 1R5SA 2E76C 3A5TA 1NU1J 2YXRB 2ITAA 1NVOA 5DJTB 3RL0C 1SFCD 3VP8A 1GPJA 1M7LA 2GDXA 3LRYA 1RF1B 3BRVB 3HRNA 4PV1C 2HPCB 2ZYGA 2ZT9C 1OVRA 4O9BA 2KW2A 2BCCG 2J58A 1Q86Q 3CWBG 4D6TJ 5TJHA 2KGCA 5K5GB 1GZLA 1JY3P 3TGUE 1IMPA 3HE4A 1KB9D 2YKOA 3L37A 3OW2O 2B88A 3LW5J 1XTGB 3GF7A 4PV1B 4H13C 4C7NB 2Z45A 3H1KE 2BCCJ 3RG2A 2PNGA 3CWBJ 1CI6A 1T3JA 2QE7H 5TISE 1YHQP 2EHSA 1F80D 1EZVD 1H88A 1AA0A 2QG4A 1S5LE 2AXTE 5HVCA 1K30A 2IDBA 2L5GB 2RMZA 4OGQD 1M1JA 4H13B 3Q2YA 1BDCA 1QL2A 1FZAA 1SQXG 2JBGA 2PEKA 5B5EH 1ACPA 1BGYG 1T3UA 2M3BA 3SWFA 1AUMA 5HGNA 3D71A 2E1MA 4CPGA 1SQXK 1OWAA 4HJGH 1FZEA 2MF4A 4B86A 2HYNA 3H32A 1BE3E 2L6EA 4N3YB 1NH4A 3CCJP 1SQBJ 2K0XA 1USDA 2M5RA 4GOEA 4HH2A 4CA3A 1SQXD 2VRSA 2PY8A 1NTKE 3R2PA 5EFWB 1BGYD 1T8ZA 2POHA 3H1LG 1ZR4A 2ZXEB 3MUDC 4I1LA 2KIKA 4JF7A 1LGHB 1KORA 2C0XA 2FYNC 5BVZA 2KS1B 4R4MA 2AEMA 2PAJA 1IFNA 1RE4C 3CMAP 2FQ0A 2PEIA 1KILE 1GK4A 1SQPG 1JY3N 4EIJA 1R5LA 3CXHD 4IL6X 3G1IA 4GDOA 1PGPA 4XFZA 3H1LD 1OW7A 1SQPK 1BDDA 1N7SC 1ZP0C 4KJMA 3CCSP 2KGEA 1VQNP 2KP8A 4H2YC 4WYMA 3S9OA 2OTLP 1PGJA 3GJNA 2H89C 3KZIE 2YO2A 1LTAC 4W7ZA 3OJAB 4RKUJ 1SQPD 4U0AA 3LMOA 3H6PA 2CWOA 2OYOA 4PD4D 1QLED 2WZ7A 1UJZA 2IBZE 1TU3F 2A06E 2WMMA 2LIWA 5AVSB 2AEJA 2GDWA 3B5NA 3VMXA 4L76A 1UIIA 3L75E 3AE8C 3T97A 2ZVOB 5APQA 1KN7A 1KILB 2YXQB 2M5AB 1UIXA 3V2NA 3CX5I 1JTHB 3K5BA 2LL8A 1CSBA 3Q5SA 3DS3A 4Y28J 3L72J 3ZDMA 1JMMA 1HGZA 1JNMA 1PPJD 3EQ2A 2V7QJ 1VQ7P 5KAIE 5GTIE 5L8RJ 1S72P 2GZJA 1SQVJ 3P8MC 1PP9E 4JYBA 1YYCA 2FFDB 2PEMA 2P7JA 5CCGD 1DNYA 2AVAA 2FXPA 1YJNP 2WPQA 1HBWA 1ZLLA 2FKWB 5KTBA 5DJUB 2KSEA 1KFMA 2RN0A 3DS2A 3I56P 2B87B 4W80A 2DNWA 4UB8E 4UB6H 1DEEG 4C7RA 1MFTA 3MD0A 1RQUA 3L36A 4WBAA 2JP3A 3CI9A 5CCGA 1NTME 2XZ1C 2A45G 3II6A 3G29A 2XV5A 4IOIH 1AFOA 2FYZA 1LTBC 1OXZA 2K0YA 5H2FE 2W27A 1OZHA 3H1JG 1J1DC 2XKMA 1MZ8A 1IUQA 3NXSA 1QRJA 1JM0A 2JDIH 1NTZE 1AV1A 3DS4A 7CEIA 2KWLA 2ZXXA 1EZVE 3AEAC 3CX5H 4LGDE 4I7ZB 1Q90D 1GU5A 4XFYA 1K8AQ 3USSA 2CK3H 3H1JJ 2NO8A 4IZ6A 2XV6A 1Y47A 5AW1B 1H0TA 1LNQA 2LF4A 1M1JC 1J1DB 1KV4A 1NO4A 2LOLA 1LWUB 4U3FG 1HUCA 3E1RA 1RF0A 2FY8A 2QVAA 2QRXA 2K92A 5I4TG 2O3JA 2Q6QA 3H1KJ 5AW7B 2Q3IA 4PXHB 4BPHA 3G0VA 2HFED 1HJBA 4WWIA 1LJ2A 1M6NA 1A02J 3Q5RA 4OGQC 2MJZA 3CLQA 1IK9A 2W83C 2IZ1A 2Z4EA 4COCA 3V2PA 1M1JB 1Q7YQ 1KB9I 1JCCA 2E75C 2FVFA 2QIWA 3L74E 2E74D 3CCMP 1FOSF 4U3FD 1DV5A 1GW3A 3RK3D 3AE4C 3QH9A 1IMQA 5F2OA 2E42A 2FACA 3P7KA 5AVXB 3D6ZA 2Y0EA 4EI2A 2O01H 3SWYA 1RO2A 4OGQB 1VQLP 2JQ4A 2WT7B 3H32B 4KT0J 2O1KA 2E75B 2M8RA 2CNRA 1SVFA 1BE3J 4XFJA 4QKOA 2NZ2A 1EDKA 2JO1A 3RBXA 2CG5B 2HLOA 1EDLA 3P32A 1NHLA 1L0NG 2KLUA 3I5CA 2Y9ZA 2XU6A 1G1JA 1NTKJ 2ZFCA 2FYUE 2KR5A 2Y0DA 1L0NK 3N7NA 1EQ7A 1LTJA 3RL0g 2R5BA 4H44B 3AE9C 1URQD 4L74A 3TSIA 1Z6MA 1K9MQ 3V4QA 2OYHA 2JB0A 2KUBA 2HODB 5B5EE 1FC2C 3MGEA 1VKUA 2JWDA 4GODA 4WVZA 1L0ND 2W6BA 4HYTB 2M0BA 3Q20A 2K2QA 1M56D 1KB9H 1URQA 3B5NC 1BCCE 1NQ4A 1LT9A 3U1AA 2OQQA 3L70E 4K35A 2FAEA 1N8RQ 3LW5H 2PEOA 3O6QA 4N6JA 1HGVA 3P8CD 1FZCA 2VLQA 3G4SP 1FAVA 2MD9A 4EDFA 2YO3A 3CXHI 1CZQA 1RNIA 3F89A 3B5NB 3CCVP 1JMBA 3U43A 3L71G 4W7YA 3T97B 1NU1G 3EJBA 5APVA 5GTHH 2KOGA 2N9YB 1LTSC 3A3YB 3L75J 2NRGA 1GU4A 1M74A 3VN0A 4ZKUA 4RO0A 2KG8A 1JEKA 4PH1A 1NU1K 2Z5IA 2H7HA 3TK1A 2K3RA 4WY4D 5JPAA 1ZMBA 1FDOA 1KQGB 3L71J 5APWA 1KQFB 4PD4I 2WSEJ 1LP1A 5CCGC 4D6TG 5E79E 4DOJA 2Q9IA 1NU1D 1QGKB 1PP9J 2M8PA 1KYOI 1HY8A 1IFDA 3GKLC 1L0HA 1MV8A 1S5LX 2E5TA 2YKQA 3A0BE 3BVHA 4XE5B 1FZFA 3WMM0 1X0TA 4COPA 4GKGA 4AUWA 3L73G 1RY3A 2QJKC 1L4AD 1IO4A 2E76B 5AW0B 3RL0B 1SFCA 4D6TD 3H25A 2AF8A 3HD7D 2VLNA 1X9VA 3WUUA 2VLPA 4TLFA 2AFEA 3NTEA 1NTMJ 4IFFA 3CXHH 4HKZH 2BQ1E 1SQQE 2ZT9B 3M91A 3L73J 3SWKA 1T6AA 3H4EA 1E79H 3PJSK 1IFMA 2BCCD 2QJKB 5AVYB 4ZMDA 1FZGA 3H1IE 3H0DA 4QMAA 2IFNA 3CE7A 1PL5A 3CWBD 3AE1C 1RF0C 2GM4A 3GHGA 4A7PA 3HD7A 1Q81Q 1NTZJ 2PFXA 1NGMB 2WSCJ 1A43A 1WRGA 4C46A 2XDJA 4PD4H 1NYHA 1SQBG 1H0TB 5AVQB 3IN6A 2FXOA 2FADA 3RK3E 2PENA 3CC2P 1KYOH 1DD4A 1SQBK 3CCRP 1EDIA 2G8YA 1FJPA 1J2JB 2JEEA 2VSQA 1ZV8A 1W2BO 1AVOA 2KNCA 4JYCA 3VMAA 2M8NA 1OIPA 1IK7A 2O01N 3G71P 2A45I 1P84E 2N1TD 3NTNA 1SQBD 3H1HE 3SFEC 1JUNA 3NMDA 2E74C 3HTKA 3CCUP 5AW3B 1JY3O 1M90Q 3RK3C 2W8ZA 2P2UA 1T8KA 2P67A 2QJYC 5AW2B 2UWJE 1ZRTD 1NOHA 3L74J 2GYKA 3CX5E 2CGQA 4PJ0E 2GDYA 1PFIA 1U7MA 1ZNVA 2N1TA 1Z56A 4N78E 1MFZA 1KD1Q 1LTJC 2XXMA 3AEGC 2AXCA 4XRQA 4EYYQ 1Q2NA 2ONTA 1ZW0A 2JO0A 1D7MA 3RK3B 2KYVA 3CD6P 2OYHC 1G2CA 3BCCE 2FYNB 2FYUG 3PTZA 3RK2D 5BU8B 5AW6B 2FVAA 4Z1MH 1M8OB 2XZRA 4LC1A 2NPSD 3AE5C 1LTJB 1LT9C 3GZLA 1A8OA 1K73Q 2OGUA 1H8AA 2WSSH 2B9BA 3WU2H 2FYUJ 3OAKA 1KMIZ 1DEBA 2PRRA 1R8EA 2FBWC 3P8CE 2OYHB 1N7SB 3D70A 3L72G 2A45H 1FZCC 3PP5A 2FXMA 3DS0A 1KYOD 3PRJA 1GMJA 2NPSA 1SQVG 1HQBA 1E5WA 2XNDH 1FOSE 3DTJA 4GT1A 1LT9B 1L0LE 2K37A 1SQVK 4PWVB 1QVFO 1BCCJ 1HF9A 1JOCA 2X2BA 3SFDC 5KLVE 2IFMA 3MHVA 3O6QB 3L70J 2Q7CA 3L72D 2FQ2A 1FZCB 5BS1A 2VLOA 3D6YA 1SQVD 3CXCO 2Q3EA 2HR3A 2YMYA 1M6EX 3JCUH 2ZVNB 3E1IA 4KHXA 3BASA 1HWTC 2AXTH 3W68A 4DCKA 3EWKA 2QEXP 2W90A 3FGAD 2L22A 3FWNA 4JBZA 1RF1A 3Q1MA 1OVUA 1CW5A 5AW4B 1PEMA 1Y9BA 2LKMA 4PV1D 1ZMEC 2IZ0A 1PEQA 1IC2A 2OTKE 2SPZA 1X22A 1KB9E 5APTA 1CEIA 5KP6B 2MVUA 1SFCC 4ZNCA 5KKZC 1JY2P 1EOQA 3PHLA 5F2KA 1S9KD 2K9YA 2H8PD 2V4HA 3CC4P 2BEQD 3WUTA 4BRYA 2XZ0D 2IBZI 2R44A 1VQOP 3TGUG 2BCCE
chains in the Genus database with same CATH topology
2LF4A 3VRLC 3DS0A 1W2BO 3B5IA 1K9MQ 1VQ9P 1VQ7P 1EIAA 1VQ4P 5DCKA 1S72P 4GR6A 1RO0A 2M8PA 3DS5A 3G6EP 2P9XA 2M8NA 3DTJA 3CPWO 3G71P 3CMAP 2EFJA 3OW2O 5I4TG 3MGEA 2PEMA 4U0DA 3CCQP 2M8LA 2PEIA 1YJNP 4COPA 3CCEP 3Q20A 2Z45A 3G0VA 1QVFO 1YJ9P 3CCUP 1M90Q 4IPYA 1M6NA 3G1IA 2Z44A 1D1DA 3I55P 4XFZA 1YHQP 4COCA 3DS2A 5BS1A 1KC8Q 3I56P 1Q7YQ 1K30A 3CCSP 3HYBA 1VQKP 1VQNP 3CCMP 2BUOA 3NTEA 4WYMA 1YI2P 1Q82Q 1N8RQ 3CXCO 2PEOA 2EG5A 2BQ1E 2OTLP 2JYGA 4XFXA 3H47A 1YJWP 1KD1Q 2XT1A 2QA4P 1M6EX 2XXMA 1VQMP 3G29A 5F2OA 3G4SP 4XRQA 4GR2A 3H4EA 5HGOA 1VQ6P 1VQPP 1BAJA 1JJ2O 3HZQA 1RNIA 2ONTA 4U0AA 2JO0A 1VQ5P 2PEKA 3H0DA 4QNBA 3CD6P 2CWOA 5HGLA 1QVGO 1RO2A 3DS1A 3CCVP 4M0IA 1VQLP 2QEXP 3DPHA 5HGMA 1AUMA 5HGNA 4PH0A 1Q81Q 2E1MA 2OARA 1E6JP 3G28A 2EIAA 3CC7P 1YITP 2PEJA 1IUQA 1A43A 1QRJA 2JYLA 5BS2A 3G21A 1VQ8P 1M74A 1PEMA 2OTJP 2KODA 4PH1A 3DS4A 2DGYA 3WBHA 1PEQA 2L6EA 3LRYA 1KQSO 3CCJP 1A8OA 3M1MA 4U0FA 1K73Q 1EOQA 2BHVA 1PEUA 4XFYA 4U0BA 3CMEP 5F2KA 1K8AQ 4XROA 5JPAA 4U0CA 1ZMBA 2Z46A 3CC4P 3RG6C 2PY8A 3E2DA 2PENA 3CC2P 3CCLP 3G1GA 3G26A 3P05A 1M1KQ 4U0EA 3CCRP 2XV6A 3DS3A 1YIJP 1PEOA 5F2NA 1Q86Q 1NJIQ 2PEQA 1VQOP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  2OTJ P;  1VQ6 P;  1W2B O;  1VQ9 P;  1K9M Q;  3I55 P;  1VQP P;  1VQ7 P;  1JJ2 O;  1VQ4 P;  1S72 P;  1VQ5 P;  1YHQ P;  1KQS O;  3CCJ P;  3G6E P;  3CD6 P;  1K73 Q;  3CPW O;  1QVG O;  3G71 P;  3CCV P;  1KC8 Q;  3CMA P;  1VQL P;  3I56 P;  1Q7Y Q;  3OW2 O;  2QEX P;  3CME P;  3CCS P;  1K8A Q;  1VQK P;  1VQN P;  3CCM P;  1YI2 P;  1Q81 Q;  3CCQ P;  1Q82 Q;  3CXC O;  1N8R Q;  3CC4 P;  1YJN P;  2OTL P;  3CC2 P;  3CCL P;  3CC7 P;  1YIT P;  3CCE P;  1M1K Q;  1QVF O;  3CCR P;  1YIJ P;  1YJ9 P;  3CCU P;  2QA4 P;  1YJW P;  1M90 Q;  1Q86 Q;  1NJI Q;  1KD1 Q;  1VQ8 P;  1VQM P;  1VQO P; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  5AVW B;  3CWB E;  1NAF A;  2P9X A;  1MZ9 A;  2E5Y A;  4AQR D;  2ROQ A;  2ZAE B;  3AEE C;  1SQQ G;  1QX8 A;  4U0D A;  2WIT A;  3LID A;  1SFC B;  3H1K G;  3GHG C;  5KKZ B;  3HD7 C;  2GZI A;  3HE4 B;  3MIW A;  2JR8 A;  5GTH E;  3TGU J;  3H1J D;  3IF4 A;  4H2X C;  1KZU B;  3B4S A;  3GF3 A;  1YQ3 C;  5BU5 A;  1YBK A;  2KZJ A;  5C39 A;  1KC8 Q;  3S1K A;  1CI6 B;  1QEX A;  2GZE A;  1YI2 P;  1SQQ J;  1AVY A;  5KP8 B;  2GA1 A;  2XT1 A;  1S3J A;  1VQM P;  3H1K D;  5CBO A;  3HD7 B;  1IFP A;  2KGD A;  3H1I J;  1WT6 A;  2K93 A;  2K1A A;  3HZQ A;  2BEZ F;  2C9L Y;  2N6Y A;  1SQX E;  2C0W A;  2R3S A;  2P58 A;  5AW5 B;  1EXJ A;  1BGY E;  4R0M A;  3CC7 P;  3IR9 A;  2N5H A;  1BE3 G;  1VQ8 P;  2GUV A;  3MZW B;  3G9R A;  2HG5 D;  4OH8 B;  2I8D A;  3AE7 C;  3R4Y A;  1NTK G;  2N9B A;  4L75 A;  4GIF A;  2KNC B;  3GG2 A;  3NFQ A;  3B4Q A;  1M1K Q;  1FZB A;  3CXH E;  4IL6 H;  2N1T C;  2P10 A;  1NTK K;  2PEQ A;  2LXB A;  5KLI C;  3H1L E;  2WWW A;  1RO0 A;  1JY2 N;  1BE3 D;  3KXD A;  3HTK B;  1EC5 A;  2KOQ A;  3TDK A;  3PLN A;  3H1H J;  1GW4 A;  1GTW A;  2D2C D;  3CCQ P;  4H0L D;  2WSE H;  1NTK D;  1YJ9 P;  3VTP C;  2FHS C;  1PV3 A;  1SQP E;  3M06 A;  2N50 A;  2KOR A;  1M57 D;  4PD4 E;  1KLP A;  3HUS A;  3M9Q A;  5KLI B;  3AE6 C;  1NAY A;  2IPP A;  2EHT A;  2P1J A;  1KIL D;  2QA4 P;  1RHZ B;  2JAZ A;  2L9F A;  4ASW A;  1SLQ A;  3TYY A;  2QSI A;  1KTM A;  2K94 A;  1FBM A;  2MR7 A;  3BCC J;  2N6Z A;  1VQ5 P;  4QNB A;  2NPS C;  5HGL A;  2DW3 A;  2IBZ G;  3DS1 A;  3Q3D A;  2A06 G;  5HGM A;  2WSF J;  1XTC C;  1L2P A;  3F5H A;  3L75 G;  1PPJ E;  2LKI A;  2WPT A;  1KIL A;  2MKV A;  2KOD A;  1GD2 E;  2M5A A;  3WBH A;  2QM7 A;  1JTH A;  1U7J A;  2YMK A;  1N73 A;  4IFD K;  2LIU A;  3EJE A;  2NPS B;  3E2D A;  1NWQ A;  2IBZ D;  2KG6 A;  4U0E A;  2A06 D;  2XNX A;  2L91 A;  1HVV A;  2FFD A;  2Q5U A;  1PP9 G;  5AVV B;  3L75 D;  2J5U A;  2MR8 A;  3WUV A;  1FDI A;  1L0L J;  2WTY A;  1VF5 D;  2KG9 A;  1GK6 A;  3AED C;  4F37 A;  3HE5 A;  4BPF A;  1OR5 A;  5KLV J;  1RF1 C;  3L71 D;  2WPV B;  2RKL A;  5CCH D;  4WB4 A;  1BXI A;  1PP9 D;  1MKM A;  5AW9 B;  4EOT A;  2H88 C;  1NTM G;  2R32 A;  3N4X A;  4WY4 A;  3WU2 E;  5APU A;  1S2E A;  3KQG A;  1YJW P;  5KP7 B;  1W2E A;  1NTM K;  3L4F A;  4AYC A;  1BSN A;  4RJT A;  1DH3 A;  1GDT A;  1SS1 A;  2K9J A;  3DPH A;  3VYI A;  5AVT B;  5CCH A;  2H43 A;  2AFD A;  2L4B A;  3G28 A;  2K0D X;  1NTZ G;  2J59 M;  1UNK A;  1PIX A;  3H1J E;  1EZV G;  3A7O A;  1NTM D;  3V2Q A;  5KAF H;  3O8Z A;  1GXH A;  1LTT C;  2PGD A;  1L4A A;  1NTZ K;  1PZQ A;  4OVN F;  4BRY B;  3L73 D;  3V4W A;  3UIA A;  3U1C A;  2LML A;  1FR2 A;  4U0F A;  1ZXG A;  4U0B A;  3CME P;  1L0I A;  3C8V A;  1LWU A;  3P05 A;  1W5C E;  5F2N A;  3VRL C;  1NTZ D;  2ZJS E;  3S4R A;  3JCU E;  3JSV C;  5CJ0 A;  2G3A A;  2W6A A;  3DS5 A;  4MRT C;  4YXD C;  1HJ0 A;  4XA4 A;  4U3F E;  3KHU A;  5APS A;  3G3Z A;  3A0H H;  1GL2 D;  1MUU A;  2WVR A;  4GOF A;  4UB6 E;  2O1J A;  1IJD B;  3V2R A;  2Z44 A;  1EMV A;  2N98 A;  2E75 D;  4U7J A;  3VMZ A;  3L74 G;  2PP6 A;  4ASV A;  1WMK A;  1N86 A;  1E0H A;  1LTG C;  1RE3 A;  5CBN A;  3C1L A;  2C9N Y;  3H47 A;  4HKG A;  1GL2 A;  5CHX A;  2WT7 A;  2V7Q H;  1JJ2 O;  1KFN A;  4H44 D;  2JU2 A;  1SQX J;  2JKV A;  1BGY J;  2MVV A;  1JO5 A;  3SSU A;  4YPC A;  3L74 D;  2EIA A;  5KJ7 D;  1YIT P;  3U59 A;  1JCD A;  1HTL C;  1T2K D;  2E74 B;  5B66 H;  2QM8 A;  4HB1 A;  1L0N E;  3HUS C;  3QWO C;  2WQY C;  2QJY B;  3M0D A;  3JC2 2;  1USE A;  3G26 A;  1S1C X;  4IFM A;  1YIJ P;  2D2C C;  1PEO A;  3H1L J;  5KJ7 A;  2HOD A;  2FYU K;  4H0L C;  2ERH A;  1S4X A;  1URQ C;  2CPB A;  3G6E P;  2IYO A;  3GZM A;  1VPC A;  3AEB C;  2CQ8 A;  2YNY A;  4JQ0 D;  4BWN A;  1FU1 A;  3B5N D;  5E79 H;  3HUS B;  1BCC G;  1N2D C;  2FYU D;  1SQP J;  1YTZ I;  3KPE A;  3B71 A;  2JWA A;  1D1D A;  5EJD A;  1NKZ B;  3FXE A;  3L70 G;  2QNW A;  1KIL C;  2YIU C;  2D2C B;  5AVR B;  3A0B H;  3VOP A;  4H0L B;  3VMY A;  2LPK A;  1LT1 A;  1URQ B;  1N73 C;  1PGQ A;  1Q82 Q;  1PPJ G;  2EG5 A;  1AF8 A;  3RGU A;  1P84 I;  4RES B;  4ZKP A;  3AEC C;  2JGP A;  1FJK A;  2KZI A;  4IL6 E;  2KLV A;  1BAJ A;  2FFD C;  3OA7 A;  1BCC D;  4DT0 A;  1A02 F;  1NKN A;  2LR2 A;  3L70 D;  2KXP B;  2YIU B;  1VDF A;  3AEF C;  5M1B A;  2OAR A;  3TNU A;  1E6J P;  3L71 E;  1HH0 A;  1NU1 E;  2JYL A;  1N73 B;  2FQ1 A;  1OFC X;  1VHN A;  2ZYD A;  5TIS H;  2DGY A;  2L0Q A;  2OYI A;  2KGA A;  3BAT A;  3BRT B;  1S5L H;  3IFM A;  2E76 D;  1PEU A;  3CL3 D;  3GLM A;  3RL0 D;  4L73 A;  4BXL A;  4NPD A;  1IZN B;  3CCL P;  4WY4 C;  2JJL A;  1VF5 C;  1U57 A;  1H89 A;  3NY7 B;  2HPC A;  3RBZ A;  3VP9 A;  2Y9Y A;  4D6T E;  3HE5 B;  4GR6 A;  2ZT9 D;  2AEF A;  4R4L A;  1LP1 B;  1ZR2 A;  1DX7 A;  3MGN A;  2EFJ A;  2E43 A;  2M8L A;  5CCH C;  1RQV A;  2I1K A;  3M9H A;  4YTP C;  4I7Z C;  4M3L A;  4IPY A;  3L73 E;  1SP4 A;  4H2W C;  4WY4 B;  3I55 P;  3W67 A;  1VF5 B;  1VL2 A;  2YKP A;  1P84 H;  1L4A C;  4C7N A;  1KQL A;  2KOO A;  5CMZ A;  4H13 D;  5CJ4 A;  2BUO A;  4DZO A;  2JYG A;  1LWU C;  3IAO A;  2K9J B;  1YQ4 C;  1K05 A;  3GMA A;  2GZF A;  1SQQ K;  2I1J A;  3H1I G;  2WPS A;  1X79 B;  2JU1 A;  4DJG A;  1IFJ A;  2CPS A;  4I2L C;  1AQT A;  4PJ0 H;  4NPE A;  4LLH A;  4UHP B;  3TGU D;  1QVG O;  1Y8A A;  3A2A A;  1JB0 J;  1L4A B;  3C9I A;  3Q5P A;  1OW6 A;  2PEJ A;  4K3A A;  3PH0 A;  2KK7 A;  1SQQ D;  3GHG B;  1GXG A;  4JPZ B;  1X3O A;  2KSJ A;  1KQS O;  3M0A A;  3H1I D;  2WSF H;  2GZG A;  4XRO A;  1SQB E;  4U0C A;  1FS0 E;  3EFG A;  1ZN5 A;  3KZI H;  1RE3 C;  1NJI Q;  4YXW H;  2R5D A;  1GL2 C;  2Y0C A;  5HV8 A;  2FVE A;  3B5I A;  1ZRT E;  4NPF X;  1JY2 O;  3ABV C;  4BPG A;  4U3F J;  5APY A;  3ITK A;  3H1H G;  4NEO A;  1J1E C;  1OX3 A;  1DD3 A;  3B8E B;  2KS1 A;  3KDP B;  2BAS A;  3EFF K;  1EXI A;  1EDJ A;  2MY5 A;  3E7K A;  5KAF E;  3FXD A;  3M9B A;  5AVU B;  2RH0 A;  1GL2 B;  2Z5H A;  3V5B A;  4H44 C;  3LIE A;  1EZV I;  1RH5 B;  3AE2 C;  4OWF A;  1P84 D;  3M0D C;  5AW8 B;  3MUD A;  2KOS A;  3H1H D;  1J1E B;  5KAI H;  2QJP C;  5GTI H;  5KJ7 C;  4GR2 A;  5HGO A;  3V6I A;  1VQP P;  1BSH A;  1N7S D;  1PGO A;  3BCC G;  4TT3 H;  2N1T B;  4Y99 C;  1RE4 A;  3AE3 C;  1T2K C;  1OW8 A;  4M0I A;  3FWL A;  2GUS A;  3CX5 D;  4PH0 A;  1FE6 A;  2M3E A;  1AYI A;  2N5I A;  1G2C B;  3A0H E;  3RK2 C;  5BS2 A;  3G21 A;  4N78 D;  1KYO E;  1X8Y A;  2WPR A;  2OTJ P;  3EJD A;  2QJP B;  1L0N J;  1N7S A;  3M1M A;  4UB8 H;  2BHV A;  5CZD B;  3MTU E;  1AJY A;  3BCC D;  2B89 A;  4Y99 B;  2Z46 A;  3RG6 C;  1N7L A;  5AVZ B;  3G1G A;  2KI7 B;  1YTZ T;  2IX7 C;  2Q1K A;  3KYQ A;  1EIA A;  3L72 E;  1VQ4 P;  5DCK A;  3RK2 B;  1IFI A;  5H2F H;  1G1I A;  3CPW O;  1L0L G;  1SQV E;  2KOP A;  4I6M C;  2W6J H;  5KLV G;  1FDM A;  3CCE P;  3L35 A;  1LTI C;  3FX0 A;  2WSC H;  1L0L K;  2K88 A;  5EW5 E;  5APX A;  5KLV K;  2OYI C;  2R3C A;  1K04 A;  4DG9 A;  2O01 J;  5B66 E;  1QL1 A;  1DIP A;  1VQK P;  3HYB A;  1OVV A;  2IYP A;  4MN4 C;  2ZYA A;  4XFX A;  1L0L D;  1AQ5 A;  1OMI A;  1ZOY C;  2KB7 P;  1VQ6 P;  3TNU B;  2B87 A;  5KLV D;  2LXC B;  2K5X A;  1S9K E;  3TF5 A;  2LTE A;  2OYI B;  3GW6 A;  3MP7 B;  1R5S A;  2E76 C;  3A5T A;  1NU1 J;  2YXR B;  2ITA A;  1NVO A;  5DJT B;  3RL0 C;  1SFC D;  3VP8 A;  1GPJ A;  1M7L A;  2GDX A;  3LRY A;  1RF1 B;  3BRV B;  3HRN A;  4PV1 C;  2HPC B;  2ZYG A;  2ZT9 C;  1OVR A;  4O9B A;  2KW2 A;  2BCC G;  2J58 A;  1Q86 Q;  3CWB G;  4D6T J;  5TJH A;  2KGC A;  5K5G B;  1GZL A;  1JY3 P;  3TGU E;  1IMP A;  3HE4 A;  1KB9 D;  2YKO A;  3L37 A;  3OW2 O;  2B88 A;  3LW5 J;  1XTG B;  3GF7 A;  4PV1 B;  4H13 C;  4C7N B;  2Z45 A;  3H1K E;  2BCC J;  3RG2 A;  2PNG A;  3CWB J;  1CI6 A;  1T3J A;  2QE7 H;  5TIS E;  1YHQ P;  2EHS A;  1F80 D;  1EZV D;  1H88 A;  1AA0 A;  2QG4 A;  1S5L E;  2AXT E;  5HVC A;  1K30 A;  2IDB A;  2L5G B;  2RMZ A;  4OGQ D;  1M1J A;  4H13 B;  3Q2Y A;  1BDC A;  1QL2 A;  1FZA A;  1SQX G;  2JBG A;  2PEK A;  5B5E H;  1ACP A;  1BGY G;  1T3U A;  2M3B A;  3SWF A;  1AUM A;  5HGN A;  3D71 A;  2E1M A;  4CPG A;  1SQX K;  1OWA A;  4HJG H;  1FZE A;  2MF4 A;  4B86 A;  2HYN A;  3H32 A;  1BE3 E;  2L6E A;  4N3Y B;  1NH4 A;  3CCJ P;  1SQB J;  2K0X A;  1USD A;  2M5R A;  4GOE A;  4HH2 A;  4CA3 A;  1SQX D;  2VRS A;  2PY8 A;  1NTK E;  3R2P A;  5EFW B;  1BGY D;  1T8Z A;  2POH A;  3H1L G;  1ZR4 A;  2ZXE B;  3MUD C;  4I1L A;  2KIK A;  4JF7 A;  1LGH B;  1KOR A;  2C0X A;  2FYN C;  5BVZ A;  2KS1 B;  4R4M A;  2AEM A;  2PAJ A;  1IFN A;  1RE4 C;  3CMA P;  2FQ0 A;  2PEI A;  1KIL E;  1GK4 A;  1SQP G;  1JY3 N;  4EIJ A;  1R5L A;  3CXH D;  4IL6 X;  3G1I A;  4GDO A;  1PGP A;  4XFZ A;  3H1L D;  1OW7 A;  1SQP K;  1BDD A;  1N7S C;  1ZP0 C;  4KJM A;  3CCS P;  2KGE A;  1VQN P;  2KP8 A;  4H2Y C;  4WYM A;  3S9O A;  2OTL P;  1PGJ A;  3GJN A;  2H89 C;  3KZI E;  2YO2 A;  1LTA C;  4W7Z A;  3OJA B;  4RKU J;  1SQP D;  4U0A A;  3LMO A;  3H6P A;  2CWO A;  2OYO A;  4PD4 D;  1QLE D;  2WZ7 A;  1UJZ A;  2IBZ E;  1TU3 F;  2A06 E;  2WMM A;  2LIW A;  5AVS B;  2AEJ A;  2GDW A;  3B5N A;  3VMX A;  4L76 A;  1UII A;  3L75 E;  3AE8 C;  3T97 A;  2ZVO B;  5APQ A;  1KN7 A;  1KIL B;  2YXQ B;  2M5A B;  1UIX A;  3V2N A;  3CX5 I;  1JTH B;  3K5B A;  2LL8 A;  1CSB A;  3Q5S A;  3DS3 A;  4Y28 J;  3L72 J;  3ZDM A;  1JMM A;  1HGZ A;  1JNM A;  1PPJ D;  3EQ2 A;  2V7Q J;  1VQ7 P;  5KAI E;  5GTI E;  5L8R J;  1S72 P;  2GZJ A;  1SQV J;  3P8M C;  1PP9 E;  4JYB A;  1YYC A;  2FFD B;  2PEM A;  2P7J A;  5CCG D;  1DNY A;  2AVA A;  2FXP A;  1YJN P;  2WPQ A;  1HBW A;  1ZLL A;  2FKW B;  5KTB A;  5DJU B;  2KSE A;  1KFM A;  2RN0 A;  3DS2 A;  3I56 P;  2B87 B;  4W80 A;  2DNW A;  4UB8 E;  4UB6 H;  1DEE G;  4C7R A;  1MFT A;  3MD0 A;  1RQU A;  3L36 A;  4WBA A;  2JP3 A;  3CI9 A;  5CCG A;  1NTM E;  2XZ1 C;  2A45 G;  3II6 A;  3G29 A;  2XV5 A;  4IOI H;  1AFO A;  2FYZ A;  1LTB C;  1OXZ A;  2K0Y A;  5H2F E;  2W27 A;  1OZH A;  3H1J G;  1J1D C;  2XKM A;  1MZ8 A;  1IUQ A;  3NXS A;  1QRJ A;  1JM0 A;  2JDI H;  1NTZ E;  1AV1 A;  3DS4 A;  7CEI A;  2KWL A;  2ZXX A;  1EZV E;  3AEA C;  3CX5 H;  4LGD E;  4I7Z B;  1Q90 D;  1GU5 A;  4XFY A;  1K8A Q;  3USS A;  2CK3 H;  3H1J J;  2NO8 A;  4IZ6 A;  2XV6 A;  1Y47 A;  5AW1 B;  1H0T A;  1LNQ A;  2LF4 A;  1M1J C;  1J1D B;  1KV4 A;  1NO4 A;  2LOL A;  1LWU B;  4U3F G;  1HUC A;  3E1R A;  1RF0 A;  2FY8 A;  2QVA A;  2QRX A;  2K92 A;  5I4T G;  2O3J A;  2Q6Q A;  3H1K J;  5AW7 B;  2Q3I A;  4PXH B;  4BPH A;  3G0V A;  2HFE D;  1HJB A;  4WWI A;  1LJ2 A;  1M6N A;  1A02 J;  3Q5R A;  4OGQ C;  2MJZ A;  3CLQ A;  1IK9 A;  2W83 C;  2IZ1 A;  2Z4E A;  4COC A;  3V2P A;  1M1J B;  1Q7Y Q;  1KB9 I;  1JCC A;  2E75 C;  2FVF A;  2QIW A;  3L74 E;  2E74 D;  3CCM P;  1FOS F;  4U3F D;  1DV5 A;  1GW3 A;  3RK3 D;  3AE4 C;  3QH9 A;  1IMQ A;  5F2O A;  2E42 A;  2FAC A;  3P7K A;  5AVX B;  3D6Z A;  2Y0E A;  4EI2 A;  2O01 H;  3SWY A;  1RO2 A;  4OGQ B;  1VQL P;  2JQ4 A;  2WT7 B;  3H32 B;  4KT0 J;  2O1K A;  2E75 B;  2M8R A;  2CNR A;  1SVF A;  1BE3 J;  4XFJ A;  4QKO A;  2NZ2 A;  1EDK A;  2JO1 A;  3RBX A;  2CG5 B;  2HLO A;  1EDL A;  3P32 A;  1NHL A;  1L0N G;  2KLU A;  3I5C A;  2Y9Z A;  2XU6 A;  1G1J A;  1NTK J;  2ZFC A;  2FYU E;  2KR5 A;  2Y0D A;  1L0N K;  3N7N A;  1EQ7 A;  1LTJ A;  3RL0 g;  2R5B A;  4H44 B;  3AE9 C;  1URQ D;  4L74 A;  3TSI A;  1Z6M A;  1K9M Q;  3V4Q A;  2OYH A;  2JB0 A;  2KUB A;  2HOD B;  5B5E E;  1FC2 C;  3MGE A;  1VKU A;  2JWD A;  4GOD A;  4WVZ A;  1L0N D;  2W6B A;  4HYT B;  2M0B A;  3Q20 A;  2K2Q A;  1M56 D;  1KB9 H;  1URQ A;  3B5N C;  1BCC E;  1NQ4 A;  1LT9 A;  3U1A A;  2OQQ A;  3L70 E;  4K35 A;  2FAE A;  1N8R Q;  3LW5 H;  2PEO A;  3O6Q A;  4N6J A;  1HGV A;  3P8C D;  1FZC A;  2VLQ A;  3G4S P;  1FAV A;  2MD9 A;  4EDF A;  2YO3 A;  3CXH I;  1CZQ A;  1RNI A;  3F89 A;  3B5N B;  3CCV P;  1JMB A;  3U43 A;  3L71 G;  4W7Y A;  3T97 B;  1NU1 G;  3EJB A;  5APV A;  5GTH H;  2KOG A;  2N9Y B;  1LTS C;  3A3Y B;  3L75 J;  2NRG A;  1GU4 A;  1M74 A;  3VN0 A;  4ZKU A;  4RO0 A;  2KG8 A;  1JEK A;  4PH1 A;  1NU1 K;  2Z5I A;  2H7H A;  3TK1 A;  2K3R A;  4WY4 D;  5JPA A;  1ZMB A;  1FDO A;  1KQG B;  3L71 J;  5APW A;  1KQF B;  4PD4 I;  2WSE J;  1LP1 A;  5CCG C;  4D6T G;  5E79 E;  4DOJ A;  2Q9I A;  1NU1 D;  1QGK B;  1PP9 J;  2M8P A;  1KYO I;  1HY8 A;  1IFD A;  3GKL C;  1L0H A;  1MV8 A;  1S5L X;  2E5T A;  2YKQ A;  3A0B E;  3BVH A;  4XE5 B;  1FZF A;  3WMM 0;  1X0T A;  4COP A;  4GKG A;  4AUW A;  3L73 G;  1RY3 A;  2QJK C;  1L4A D;  1IO4 A;  2E76 B;  5AW0 B;  3RL0 B;  1SFC A;  4D6T D;  3H25 A;  2AF8 A;  3HD7 D;  2VLN A;  1X9V A;  3WUU A;  2VLP A;  4TLF A;  2AFE A;  3NTE A;  1NTM J;  4IFF A;  3CXH H;  4HKZ H;  2BQ1 E;  1SQQ E;  2ZT9 B;  3M91 A;  3L73 J;  3SWK A;  1T6A A;  3H4E A;  1E79 H;  3PJS K;  1IFM A;  2BCC D;  2QJK B;  5AVY B;  4ZMD A;  1FZG A;  3H1I E;  3H0D A;  4QMA A;  2IFN A;  3CE7 A;  1PL5 A;  3CWB D;  3AE1 C;  1RF0 C;  2GM4 A;  3GHG A;  4A7P A;  3HD7 A;  1Q81 Q;  1NTZ J;  2PFX A;  1NGM B;  2WSC J;  1A43 A;  1WRG A;  4C46 A;  2XDJ A;  4PD4 H;  1NYH A;  1SQB G;  1H0T B;  5AVQ B;  3IN6 A;  2FXO A;  2FAD A;  3RK3 E;  2PEN A;  3CC2 P;  1KYO H;  1DD4 A;  1SQB K;  3CCR P;  1EDI A;  2G8Y A;  1FJP A;  1J2J B;  2JEE A;  2VSQ A;  1ZV8 A;  1W2B O;  1AVO A;  2KNC A;  4JYC A;  3VMA A;  2M8N A;  1OIP A;  1IK7 A;  2O01 N;  3G71 P;  2A45 I;  1P84 E;  2N1T D;  3NTN A;  1SQB D;  3H1H E;  3SFE C;  1JUN A;  3NMD A;  2E74 C;  3HTK A;  3CCU P;  5AW3 B;  1JY3 O;  1M90 Q;  3RK3 C;  2W8Z A;  2P2U A;  1T8K A;  2P67 A;  2QJY C;  5AW2 B;  2UWJ E;  1ZRT D;  1NOH A;  3L74 J;  2GYK A;  3CX5 E;  2CGQ A;  4PJ0 E;  2GDY A;  1PFI A;  1U7M A;  1ZNV A;  2N1T A;  1Z56 A;  4N78 E;  1MFZ A;  1KD1 Q;  1LTJ C;  2XXM A;  3AEG C;  2AXC A;  4XRQ A;  4EYY Q;  1Q2N A;  2ONT A;  1ZW0 A;  2JO0 A;  1D7M A;  3RK3 B;  2KYV A;  3CD6 P;  2OYH C;  1G2C A;  3BCC E;  2FYN B;  2FYU G;  3PTZ A;  3RK2 D;  5BU8 B;  5AW6 B;  2FVA A;  4Z1M H;  1M8O B;  2XZR A;  4LC1 A;  2NPS D;  3AE5 C;  1LTJ B;  1LT9 C;  3GZL A;  1A8O A;  1K73 Q;  2OGU A;  1H8A A;  2WSS H;  2B9B A;  3WU2 H;  2FYU J;  3OAK A;  1KMI Z;  1DEB A;  2PRR A;  1R8E A;  2FBW C;  3P8C E;  2OYH B;  1N7S B;  3D70 A;  3L72 G;  2A45 H;  1FZC C;  3PP5 A;  2FXM A;  3DS0 A;  1KYO D;  3PRJ A;  1GMJ A;  2NPS A;  1SQV G;  1HQB A;  1E5W A;  2XND H;  1FOS E;  3DTJ A;  4GT1 A;  1LT9 B;  1L0L E;  2K37 A;  1SQV K;  4PWV B;  1QVF O;  1BCC J;  1HF9 A;  1JOC A;  2X2B A;  3SFD C;  5KLV E;  2IFM A;  3MHV A;  3O6Q B;  3L70 J;  2Q7C A;  3L72 D;  2FQ2 A;  1FZC B;  5BS1 A;  2VLO A;  3D6Y A;  1SQV D;  3CXC O;  2Q3E A;  2HR3 A;  2YMY A;  1M6E X;  3JCU H;  2ZVN B;  3E1I A;  4KHX A;  3BAS A;  1HWT C;  2AXT H;  3W68 A;  4DCK A;  3EWK A;  2QEX P;  2W90 A;  3FGA D;  2L22 A;  3FWN A;  4JBZ A;  1RF1 A;  3Q1M A;  1OVU A;  1CW5 A;  5AW4 B;  1PEM A;  1Y9B A;  2LKM A;  4PV1 D;  1ZME C;  2IZ0 A;  1PEQ A;  1IC2 A;  2OTK E;  2SPZ A;  1X22 A;  1KB9 E;  5APT A;  1CEI A;  5KP6 B;  2MVU A;  1SFC C;  4ZNC A;  5KKZ C;  1JY2 P;  1EOQ A;  3PHL A;  5F2K A;  1S9K D;  2K9Y A;  2H8P D;  2V4H A;  3CC4 P;  2BEQ D;  3WUT A;  4BRY A;  2XZ0 D;  2IBZ I;  2R44 A;  1VQO P;  3TGU G;  2BCC E; 
#chains in the Genus database with same CATH homology
 2LF4 A;  3VRL C;  3DS0 A;  1W2B O;  3B5I A;  1K9M Q;  1VQ9 P;  1VQ7 P;  1EIA A;  1VQ4 P;  5DCK A;  1S72 P;  4GR6 A;  1RO0 A;  2M8P A;  3DS5 A;  3G6E P;  2P9X A;  2M8N A;  3DTJ A;  3CPW O;  3G71 P;  3CMA P;  2EFJ A;  3OW2 O;  5I4T G;  3MGE A;  2PEM A;  4U0D A;  3CCQ P;  2M8L A;  2PEI A;  1YJN P;  4COP A;  3CCE P;  3Q20 A;  2Z45 A;  3G0V A;  1QVF O;  1YJ9 P;  3CCU P;  1M90 Q;  4IPY A;  1M6N A;  3G1I A;  2Z44 A;  1D1D A;  3I55 P;  4XFZ A;  1YHQ P;  4COC A;  3DS2 A;  5BS1 A;  1KC8 Q;  3I56 P;  1Q7Y Q;  1K30 A;  3CCS P;  3HYB A;  1VQK P;  1VQN P;  3CCM P;  2BUO A;  3NTE A;  4WYM A;  1YI2 P;  1Q82 Q;  1N8R Q;  3CXC O;  2PEO A;  2EG5 A;  2BQ1 E;  2OTL P;  2JYG A;  4XFX A;  3H47 A;  1YJW P;  1KD1 Q;  2XT1 A;  2QA4 P;  1M6E X;  2XXM A;  1VQM P;  3G29 A;  5F2O A;  3G4S P;  4XRQ A;  4GR2 A;  3H4E A;  5HGO A;  1VQ6 P;  1VQP P;  1BAJ A;  1JJ2 O;  3HZQ A;  1RNI A;  2ONT A;  4U0A A;  2JO0 A;  1VQ5 P;  2PEK A;  3H0D A;  4QNB A;  3CD6 P;  2CWO A;  5HGL A;  1QVG O;  1RO2 A;  3DS1 A;  3CCV P;  4M0I A;  1VQL P;  2QEX P;  3DPH A;  5HGM A;  1AUM A;  5HGN A;  4PH0 A;  1Q81 Q;  2E1M A;  2OAR A;  1E6J P;  3G28 A;  2EIA A;  3CC7 P;  1YIT P;  2PEJ A;  1IUQ A;  1A43 A;  1QRJ A;  2JYL A;  5BS2 A;  3G21 A;  1VQ8 P;  1M74 A;  1PEM A;  2OTJ P;  2KOD A;  4PH1 A;  3DS4 A;  2DGY A;  3WBH A;  1PEQ A;  2L6E A;  3LRY A;  1KQS O;  3CCJ P;  1A8O A;  3M1M A;  4U0F A;  1K73 Q;  1EOQ A;  2BHV A;  1PEU A;  4XFY A;  4U0B A;  3CME P;  5F2K A;  1K8A Q;  4XRO A;  5JPA A;  4U0C A;  1ZMB A;  2Z46 A;  3CC4 P;  3RG6 C;  2PY8 A;  3E2D A;  2PEN A;  3CC2 P;  3CCL P;  3G1G A;  3G26 A;  3P05 A;  1M1K Q;  4U0E A;  3CCR P;  2XV6 A;  3DS3 A;  1YIJ P;  1PEO A;  5F2N A;  1Q86 Q;  1NJI Q;  2PEQ A;  1VQO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...