3CC7P

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc7P02
3CCUP 1K9MQ 3G6EP 2QEXP 1W2BO 1Q82Q 1VQOP 1Q86Q 1JJ2O 2OTJP 3CCVP 1QVFO 1VQMP 3I56P 1YJ9P 1YJNP 1VQ7P 1YITP 1VQPP 1YHQP 1YJWP 1Q7YQ 1YIJP 3CPWO 3CCJP 1Q81Q 1KD1Q 1VQ9P 1VQNP 1VQKP 2OTLP 1S72P 3CCRP 1K8AQ 1M1KQ 3I55P 3G71P 3OW2O 3CCMP 1QVGO 2QA4P 1VQ5P 1KC8Q 1VQ4P 3CC4P 1VQLP 1KQSO 3CCQP 3CCSP 1YI2P 3CC2P 3CCEP 3CC7P 1N8RQ 3CCLP 1VQ8P 1VQ6P 3CD6P 3CXCO 1K73Q 3G4SP 1M90Q 1NJIQ 3CMEP 3CMAP
chains in the Genus database with same CATH superfamily
2LMLA 3FXDA 3RL0C 1HJBA 1E79H 1WRGA 1NYHA 2Y0DA 4JQ0D 3HRNA 5M1BA 5APXA 1YJWP 5AVWB 3MZWB 1EXJA 2FVAA 1MFTA 2JYLA 2K93A 3P8CE 2GYKA 3TGUG 5CCHC 2K9YA 1KILD 1L0LK 5KLVJ 3DTJA 3B5NA 1VQOP 1LTAC 3SWFA 4BPGA 1L4AC 4Z1MH 1FZEA 1YITP 3L70D 4UB8E 1RF1C 1XTGB 1NU1J 1NTKE 3TSIA 2K92A 3WUTA 1VQ8P 2IPPA 3NY7B 1SQXG 2FFDA 1S9KE 1CEIA 1LP1A 3M91A 1UNKA 1H89A 3CPWO 2CG5B 2Y9YA 1BE3D 3GHGB 4C46A 3SWKA 1ZR2A 2FBWC 4A7PA 4XRQA 2Z45A 1SQBE 3W67A 2PNGA 2EFJA 1GXHA 3DS4A 3WU2H 1NKZB 2JBGA 3BCCD 1PGOA 1SQQJ 1W2EA 4N78E 1NTZK 4L74A 2ZAEB 3TF5A 1RQVA 2PAJA 3M0AA 3DS2A 2JDIH 3H1KD 2PGDA 1PGPA 4DZOA 2J59M 2KOOA 2GDXA 1VF5D 2VLPA 2CNRA 3L71E 2B89A 2E74B 1SQPJ 1GW4A 1PP9D 2JR8A 1SS1A 2J58A 4I7ZB 3RK2B 2M0BA 1JTHB 1CSBA 3L37A 2QA4P 1P84H 2M8NA 3CCEP 2KGCA 3SWYA 2WITA 5F2KA 2WVRA 5KLIC 1UIXA 1RNIA 3H1LG 3L35A 3Q1MA 1Q81Q 1DX7A 2POHA 2LXBA 3TGUD 4RKUJ 2ZT9D 5E79H 1GU4A 1H0TA 3Q2YA 3F5HA 2NO8A 3A7OA 2MVUA 2ZYDA 2W83C 2BCCE 1T3UA 3H32A 4COPA 3AE3C 2MR8A 3GMAA 2KNCB 3H1JE 2L4BA 1Y8AA 3C8VA 1SQXD 3D6ZA 3ZDMA 2R5DA 1JY3O 2KZJA 1R5LA 3P05A 4IFMA 2M8PA 1AF8A 2W8ZA 1XTCC 4H2XC 2YMYA 2KG9A 1HUCA 1QGKB 2W6AA 2QJKC 2VLQA 2FYNC 3F89A 5GTIE 1P84D 1KILE 1RQUA 1GDTA 1BDCA 1N2DC 1FDMA 4PV1B 2NPSD 1ZMEC 2K2QA 3EWKA 1FDIA 3CL3D 2CGQA 3L70E 3MUDA 2MF4A 1OXZA 2NPSA 2EIAA 2XKMA 2AXCA 3H1HJ 1EXIA 3T97A 1NGMB 3A0BH 2XNDH 3E1RA 2W90A 2O01N 3JSVC 2XT1A 1LWUB 1M6NA 3D70A 1SFCB 2E74D 3Q20A 2KB7P 3L75J 2R5BA 1EQ7A 3KPEA 1M8OB 3RL0B 2O01H 1NTMK 1BE3E 3V4QA 1LT9B 2KGEA 1BCCG 3TYYA 1T2KC 3L74G 1NWQA 3CC7P 1L0NJ 1R5SA 4N6JA 2WSEH 3BCCE 3EFFK 5F2OA 1FR2A 2IX7C 2K9JB 3H1KE 5KP8B 3V2QA 1L4AB 5AW3B 1OVRA 1LTIC 2FY8A 1JNMA 2IYOA 1RF1B 2CQ8A 4ZKPA 2O01J 1JCDA 1PP9E 5CJ0A 4NPEA 2ZJSE 2H7HA 2KOSA 1HY8A 4IFDK 1KQGB 2AEFA 4HH2A 2PFXA 2B88A 2I8DA 3LRYA 5CZDB 3CCMP 1SVFA 5AVZB 2W6JH 1VQ6P 4EDFA 3WUUA 3IN6A 2XNXA 3KQGA 3TGUE 2JU1A 4DJGA 2GZIA 3SSUA 4Y99C 3MIWA 3WU2E 4LLHA 1FDOA 2C9LY 5APWA 1IFJA 2E5YA 1R8EA 4UB8H 3H0DA 1L0LG 3L73J 3VP9A 2K0DX 2JB0A 4YTPC 1SQXE 1SFCD 3GZMA 1KZUB 3HUSB 3RL0D 3B8EB 2KSEA 2N9BA 1KORA 5KKZB 2YMKA 3FWLA 2P2UA 3V4WA 1BCCD 1ZP0C 2N6ZA 3AEDC 2JP3A 1P84E 3OA7A 3L74D 2M5AB 2DNWA 3BRTB 1X22A 1AYIA 4HJGH 4BRYA 5CCHD 2NZ2A 3M0DC 1JY2N 2Q5UA 3U1AA 1NTKJ 1L4AD 2W6BA 3L72G 1LTSC 1JMMA 2BQ1E 1QX8A 2JYGA 4JPZB 5AVXB 2RH0A 5E79E 2VSQA 2KODA 1EZVI 1NTZG 2KGAA 4NPFX 2N50A 1M7LA 2KWLA 1FJKA 1GD2E 4OGQB 3H1IG 2OYOA 2QNWA 1SQBJ 4EYYQ 3CLQA 1LTJC 3RL0g 2E42A 1KN7A 3DS3A 2QIWA 1YQ3C 3HE5A 1K04A 1ZMBA 3H1LE 2QJKB 1J1DC 3RK2C 2ZVNB 2WPTA 2Y9ZA 3DS1A 1PEQA 2HPCB 2WPSA 3RK3C 2QJPC 3CCLP 1PGQA 1IUQA 5I4TG 2HODB 3L71J 1X8YA 5B5EE 2OQQA 2A06G 2KZIA 3HE4B 5EFWB 2ZXEB 1IFNA 2OYIA 1M56D 3G1IA 3G0VA 1L0LD 3G21A 3N4XA 1YI2P 4WY4B 4U0CA 3L70G 2Z5IA 2XZRA 3CMAP 3CCUP 2M5RA 2WSFJ 1GZLA 4HKZH 2PEQA 2E76B 1VKUA 4ASWA 1EMVA 1QRJA 2D2CC 3V6IA 4PH1A 2AFDA 2Q1KA 4C7NB 1OIPA 1URQA 1UIIA 2H8PD 2L0QA 1SQVK 4HYTB 2N98A 1AFOA 1BE3G 4RJTA 3GKLC 1KLPA 5APQA 2BCCJ 1VQNP 1N7SA 2FYZA 4JYBA 2QVAA 1HGZA 2LXCB 3BCCG 3H1JJ 4PV1C 3KZIE 2YXRB 3GJNA 3L36A 2VLNA 2KS1A 1M90Q 3VRLC 3CI9A 1NTZD 3GZLA 1JY3P 1JJ2O 2B9BA 1LT1A 2VRSA 1YJNP 1G1IA 1S1CX 4L75A 3H1ID 1EZVG 1VQ4P 3BASA 4XFXA 1BCCE 1HVVA 3CXHI 2WTYA 3CWBG 3L74E 1T8ZA 1CI6A 4U3FG 1NTMG 4JF7A 2ZYAA 2QE7H 1LT9C 3AEAC 4D6TG 2HFED 3L70J 2K3RA 1UJZA 3PH0A 3G9RA 4Y99B 1OMIA 3II6A 2FYUK 3I5CA 2A45I 2KGDA 4O9BA 3RG6C 5AW0B 3V2RA 1TU3F 3H25A 2PEMA 2AFEA 3BRVB 4AYCA 2A06D 3N7NA 3UIAA 2RKLA 1X0TA 3A0HH 1KILA 1FOSF 3RGUA 3P8MC 2Q7CA 3VN0A 3LIEA 3HTKB 1VPCA 1T6AA 1NQ4A 2QJYC 3PJSK 1A02J 1JMBA 2E43A 2H89C 5KP7B 1OVVA 1X3OA 4LGDE 1T2KD 3H1KJ 2WPQA 4GOFA 3G29A 2FVFA 1FC2C 1HWTC 3CX5I 2JJLA 1IK9A 4GODA 2MVVA 2MD9A 5DCKA 1PP9J 1HBWA 2GZJA 1L0LE 1LJ2A 3WBHA 4YPCA 4YXDC 3A3YB 1L0IA 2MJZA 2VLOA 2YO3A 3AEFC 2Y0EA 4R0MA 3GF7A 2WPVB 4U7JA 1F80D 1K9MQ 4H2WC 3SFEC 4KHXA 1LTJB 1N73A 1FZBA 1EZVD 2OTKE 4W80A 3TGUJ 1LGHB 2JAZA 1AQ5A 1FS0E 3CWBD 1J1DB 2E75C 3HUSC 3G3ZA 1M1KQ 5BVZA 2K88A 4U3FD 1NTMD 2YIUC 4DG9A 4D6TD 3RK3B 5KKZC 2OYHC 2QJPB 2LPKA 1JY2P 1G2CB 4N3YB 2YXQB 1RE3C 3JC22 1OVUA 2KOPA 4BXLA 3L72E 1YJ9P 5B66E 1G1JA 2KP8A 1SQXJ 2AEJA 3IF4A 2K0XA 1NTZE 1U57A 1GK4A 2RMZA 4TT3H 2JO1A 2K5XA 4ASVA 1K30A 2KR5A 3GF3A 2A45G 3TK1A 1WT6A 2Z44A 4M0IA 3H1IE 2LIUA 2D2CB 5AW8B 4GIFA 1Q7YQ 4COCA 1QEXA 3KYQA 4UB6E 3EJDA 2C0WA 1YBKA 4OGQC 4DT0A 4PXHB 3VP8A 2HG5D 4PJ0H 5KTBA 3Q5PA 4GR2A 1S3JA 5APTA 1L0HA 3MGNA 3FXEA 1AVYA 1IZNB 3GHGA 3GLMA 5KLVK 2UWJE 2FADA 1IO4A 2A06E 2A45H 2QRXA 2PEIA 3A5TA 5B5EH 2L6EA 1NU1K 1NKNA 1E0HA 4GT1A 1DD4A 2JWAA 4H44C 3VOPA 1S4XA 2CPSA 3H1LJ 1KQSO 1PZQA 3CC2P 4WY4C 1OFCX 1U7MA 5APSA 3CMEP 2IDBA 3B5NC 1FZFA 2DGYA 1ZV8A 2E76C 3AE2C 3U59A 3RK2D 2B87B 3D71A 1LTTC 1M74A 3G1GA 2ONTA 3VMZA 3RK3D 1WMKA 1IFMA 1JTHA 4GDOA 3CX5H 3CCSP 1SQVG 3CXHD 2PENA 1SQQK 2FFDC 3U1CA 4JBZA 1EC5A 1QL1A 2MY5A 3P7KA 3KZIH 2BUOA 1KFMA 2KI7B 3H1HD 1ACPA 3V2PA 5APYA 3IFMA 1HTLC 2BASA 4NEOA 1S72P 3CC4P 1FZGA 1N8RQ 1SQPK 3TDKA 2CPBA 2KG6A 2BEQD 2D2CD 3A0HE 1EZVE 1FZCB 2QJYB 5KJ7C 3S9OA 2KLUA 3CWBE 4R4LA 5HV8A 3B4QA 3G26A 1KB9I 4U3FE 4Y28J 1NTME 1VQPP 2W27A 3NTNA 4D6TE 1S5LH 2KNCA 2M3EA 2WSEJ 3CCRP 3OW2O 4U0BA 1M1JB 3CD6P 2HYNA 3AEEC 2JU2A 2LIWA 2C0XA 1BDDA 3MHVA 2FXMA 5HGLA 2PY8A 2L5GB 2WSCH 2FKWB 1USDA 4PV1D 3Q5SA 2YNYA 2ZXXA 5APVA 1PFIA 2KUBA 1JY2O 3CX5D 1IFIA 2FYUG 2AVAA 1D1DA 1RE4A 1BCCJ 5C39A 3NTEA 2CK3H 4EI2A 1FOSE 2K1AA 3L74J 1MUUA 5BU8B 3MP7B 2P9XA 1EDLA 4WBAA 2QM7A 2I1JA 2FQ2A 1ZR4A 5AW5B 4CA3A 1N7LA 1OWAA 2E75B 1Q90D 1LWUA 5AVUB 2JWDA 1SFCA 2YIUB 2IZ1A 2OYHB 2WSCJ 1OW8A 2HLOA 1Z6MA 1X79B 4BWNA 2Y0CA 1LT9A 3R2PA 4AUWA 4DCKA 3PLNA 1SQVD 1GPJA 1VQ9P 1GTWA 1MKMA 2ROQA 1EIAA 3O6QB 2ZVOB 2L91A 5CCHA 3NFQA 1Q82Q 2K9JA 5KAIH 2FHSC 5HVCA 1FE6A 1L4AA 3CCJP 4EIJA 2OTLP 1Q2NA 1EDIA 5F2NA 3NMDA 1RF1A 1JO5A 1EOQA 2RN0A 2WT7B 2K0YA 4M3LA 1ZNVA 2IZ0A 3RK3E 1CW5A 2H88C 3HD7B 4B86A 1L0NK 3CXHE 1L0LJ 1DV5A 3E2DA 3PRJA 4PJ0E 2E1MA 3CE7A 2V7QH 4CPGA 3W68A 3U43A 2R3CA 5B66H 1Y47A 3H1HE 3EFGA 2QEXP 1JUNA 1KV4A 2P10A 2N1TC 1HF9A 2N6YA 1KMIZ 3S1KA 1D7MA 1PPJG 2FYUD 1BGYG 1S9KD 4C7RA 4H44B 1T8KA 3KHUA 2XXMA 2ERHA 1OW6A 1AJYA 1MV8A 2XV6A 4PD4D 4UB6H 5CHXA 3B5NB 4I2LC 2FAEA 4KJMA 2GUSA 2E75D 5CJ4A 2V7QJ 2N9YB 3LW5H 1T3JA 3L72J 1E6JP 2QSIA 3HUSA 1VQLP 3O8ZA 1NTZJ 1W5CE 3MGEA 4PWVB 4WB4A 2R44A 2FFDB 2WSSH 4XFZA 1LP1B 2IBZI 2C9NY 3CX5E 2P67A 3H1IJ 2M5AA 4IL6H 2LF4A 2Z46A 2G3AA 5AW9B 4U0DA 4XROA 1HJ0A 5AVQB 1PEUA 1EDKA 1NHLA 3IR9A 5H2FH 3CCQP 1FU1A 2EHTA 5AVRB 2PEKA 5AW6B 2KIKA 3LW5J 1NU1G 4H13C 1BXIA 1YHQP 3AE5C 4EOTA 1KQFB 1PL5A 2YKOA 2YKPA 4OGQD 1QVGO 1KYOI 3AE8C 3HZQA 2JEEA 5AVYB 1GL2C 1LTGC 3NXSA 1S5LE 1SQVE 3TNUB 1OR5A 1KB9D 1DNYA 2GDWA 2YO2A 1NTKK 1AVOA 2MKVA 2PEOA 5APUA 2N5HA 3AE7C 2HPCA 1SQQG 4XA4A 1PIXA 1KFNA 1DH3A 3VMXA 1PPJD 2LKMA 5TISE 1BGYD 2XZ0D 4H44D 5AVSB 1U7JA 2HODA 1BE3J 3LMOA 3VTPC 4WY4D 1SQBK 3HE4A 1LTBC 3D6YA 3B5ND 1H0TB 2E76D 2O1JA 1RO2A 1SQPG 4WY4A 2FACA 3CXCO 3G4SP 3L4FA 2ZT9B 1FZCC 5HGOA 2EG5A 1RH5B 3BCCJ 2WZ7A 1PEOA 2WMMA 4ZMDA 5DJTB 2Q9IA 3H32B 3AE9C 2MR7A 4C7NA 3R4YA 3E1IA 2OGUA 1PEMA 3H47A 2JGPA 1M1JC 2XDJA 3GW6A 4I6MC 2FYUE 2I1KA 2IFMA 4K35A 2FXPA 3VMAA 1JOCA 1GW3A 3M9QA 3DS0A 2LOLA 2KOQA 5KLVD 2P1JA 4K3AA 3CWBJ 2IBZG 4L76A 4U3FJ 1NTMJ 4IFFA 4PD4E 2Q3EA 4D6TJ 1NOHA 5KJ7D 3C9IA 1OW7A 5KAIE 4R4MA 1NU1D 2PEJA 1E5WA 3FWNA 2PP6A 5KJ7A 2NPSB 1S5LX 4IZ6A 3T97B 3C1LA 2OYIC 1SLQA 2PRRA 3V5BA 3G71P 4H0LC 1YTZI 3DS5A 1K73Q 5BS1A 3EJBA 2IYPA 5CBOA 4BPHA 3MTUE 2GDYA 3B4SA 2XU6A 3TNUA 2N1TB 1A43A 2KXPB 1URQC 4TLFA 1SQQD 1YQ4C 4U0EA 5JPAA 1SP4A 2O1KA 3H1HG 2QM8A 5CCGC 5KAFE 2Q6QA 1RHZB 1RF0C 1Q86Q 2QG4A 4ZNCA 2GA1A 4MN4C 1BAJA 1N7SC 4GR6A 1VQKP 1SQPD 3L75G 1NO4A 1DEEG 1JM0A 3DPHA 1KYOH 3HTKA 1YTZT 3CXHH 1KB9E 1PV3A 3P32A 4WYMA 2IFNA 3HD7C 1NH4A 2GM4A 4IPYA 1ZW0A 1L0NG 3QWOC 3H4EA 2R32A 4KT0J 3KXDA 1PPJE 4IOIH 1A8OA 2KSJA 1BGYE 2M8LA 2X2BA 1JEKA 1Z56A 3M0DA 2P7JA 4IL6E 1OZHA 4PD4I 4WVZA 4BPFA 2LKIA 3JCUH 3B5IA 2IBZD 1DD3A 5H2FE 3CCVP 4H13B 3IAOA 2R3SA 1K8AQ 1J1EC 3EQ2A 4XFJA 2K94A 5AW1B 3M9BA 5EW5E 1NJIQ 2H43A 1Y9BA 3G6EP 3AE6C 1GL2B 1LTJA 2WWWA 3AEBC 5AW2B 1KILC 1ZXGA 4OVNF 5HGMA 2JO0A 1JCCA 1AA0A 2AXTH 5TJHA 1BSNA 1KYOD 2CWOA 4W7YA 5K5GB 2FVEA 4PH0A 5AVTB 5KLVE 2N1TD 1PGJA 1G2CA 1JY3N 3OJAB 1AUMA 4JYCA 2Z4EA 1HH0A 2NRGA 1QVFO 1NVOA 1VQMP 1FJPA 4XFYA 2N1TA 4BRYB 1NU1E 1AQTA 2KYVA 3L73G 3I55P 1KC8Q 4RO0A 1GMJA 1FBMA 3H1LD 4QKOA 5AW7B 2LL8A 3BVHA 3RG2A 2AEMA 2Q3IA 1N86A 4DOJA 3ABVC 1ZLLA 3L75D 5GTHH 2XZ1C 5BS2A 2JKVA 4W7ZA 1IJDB 5BU5A 2KG8A 1YYCA 2FQ0A 1GXGA 1IMQA 1L0ND 1N73C 1SQXK 4IL6X 1SQQE 5HGNA 4MRTC 3HE5B 2FXOA 1VF5C 1NTKG 4HB1A 3ITKA 3LIDA 3E7KA 5TISH 5KP6B 4AQRD 4H13D 2O3JA 4UHPB 4XE5B 1SQPE 1X9VA 2JQ4A 1SQVJ 5CBNA 1M57D 1ZOYC 2YKQA 2OYIB 1SQBG 1GU5A 1GL2D 1ZN5A 5L8RJ 2E5TA 4H0LB 3OAKA 2ZT9C 3MD0A 2GZFA 1IFPA 3A2AA 2WQYC 1GL2A 3PTZA 4QMAA 1ZRTD 2KW2A 1VDFA 2OTJP 1NAFA 2LR2A 2B87A 2EHSA 3PHLA 1OX3A 1K05A 3Q5RA 5AW4B 4HKGA 1URQB 1H88A 3S4RA 1H8AA 3WMM0 2IBZE 3L71G 3PP5A 5KLIB 4PD4H 1M6EX 4H2YC 3L73D 1VHNA 1VL2A 1HGVA 4LC1A 3G28A 3USSA 3VMYA 2LTEA 1N7SB 3GHGC 2OARA 1L2PA 3RBZA 4OWFA 2KOGA 1VQ5P 2KS1B 2M8RA 4U0AA 4GOEA 3QH9A 3MUDC 1FZCA 2KK7A 2AF8A 2NPSC 1IK7A 2BEZF 2M3BA 2FYUJ 3P8CD 1KYOE 2FQ1A 4L73A 3B71A 3I56P 2ITAA 1KTMA 4QNBA 5CMZA 2P58A 1RO0A 3M1MA 4U0FA 2KLVA 2BCCG 1M1JA 3AEGC 1CI6B 3FX0A 1IFDA 1NTKD 5AVVB 2E74C 2GUVA 2WSFH 3H1JG 4WWIA 5KAFH 1VQ7P 1RY3A 2J5UA 1YIJP 4I7ZC 2FYNB 1MFZA 3JCUE 2ZFCA 1J1EB 1MZ9A 2G8YA 2K37A 1BSHA 3L75E 1FAVA 1HQBA 3M9HA 3AECC 1W2BO 3HYBA 1KQLA 1MZ8A 2GZGA 1SQBD 2ZYGA 3EJEA 1DIPA 1KILB 4H0LD 2L9FA 1KB9H 2XV5A 2N5IA 1L0NE 4N78D 4RESB 3A0BE 4I1LA 2V4HA 1QLED 3KDPB 2OYHA 4ZKUA 1URQD 2AXTE 1RE3A 3V2NA 3BATA 2GZEA 3WUVA 2WPRA 1J2JB 1KD1Q 4GKGA 1IMPA 5CCGD 1JB0J 2L22A 2Z5HA 3L71D 1DEBA 1P84I 5KLVG 3RBXA 1IC2A 3O6QA 5CCGA 4OH8B 5GTIH 5EJDA 1N7SD 2HR3A 1RF0A 1GK6A 1NAYA 1A02F 2BHVA 1EDJA 3K5BA 3AE4C 3L72D 1QL2A 1RE4C 4YXWH 5GTHE 4F37A 1ZRTE 3H6PA 3VYIA 3HD7D 2WT7A 1BGYJ 3H1KG 3FGAD 1N73B 4NPDA 2KORA 3HD7A 5DJUB 1LNQA 3AE1C 1VF5B 1FZAA 1CZQA 3Q3DA 2BCCD 2DW3A 1AV1A 1USEA 1PP9G 1LWUC 3GG2A 1SFCC 2SPZA 3M06A 3L73E 1S2EA 3H1JD 3SFDC 7CEIA
chains in the Genus database with same CATH topology
3VRLC 5DCKA 5HGOA 1W2BO 3HYBA 2EG5A 4XFZA 1AUMA 4GR2A 3DS3A 1PEOA 1Q82Q 1Q86Q 2EIAA 1JJ2O 2OTJP 1BAJA 1QVFO 1VQMP 4XFYA 1YJNP 1ZMBA 3G26A 4GR6A 3WBHA 1YJWP 1VQPP 2LF4A 2Z46A 3CCJP 2OTLP 4U0DA 1VQKP 2XT1A 3DPHA 3DS1A 4XROA 3CCRP 3I55P 1PEQA 5F2NA 4U0BA 3OW2O 2QA4P 3H47A 1KC8Q 1VQ4P 2M8NA 1PEUA 1PEMA 2JYLA 4XFXA 1EOQA 3CCQP 3CCEP 1M6NA 3CCLP 3CD6P 3Q20A 2PEIA 2PEKA 5F2KA 1K9MQ 3H0DA 2L6EA 4WYMA 3DTJA 1RNIA 1IUQA 3DS0A 5HGLA 1M6EX 5I4TG 1VQOP 2PY8A 3G28A 4IPYA 5BS2A 1YITP 1YHQP 1Q81Q 1KD1Q 2OARA 3H4EA 3E2DA 2E1MA 1QVGO 1M1KQ 3G1IA 3G0VA 1A8OA 1VQ5P 3G21A 3HZQA 1KQSO 3CC2P 1YI2P 3CC7P 1D1DA 2M8LA 3RG6C 4U0CA 1VQ8P 2PEJA 3CMEP 3CMAP 3CCUP 4U0AA 2PEMA 3NTEA 2QEXP 5F2OA 2DGYA 2PEQA 3B5IA 1QRJA 5HGNA 3CCVP 4PH1A 3I56P 1YJ9P 2BHVA 2P9XA 1M74A 3G1GA 4QNBA 4COPA 2ONTA 3CPWO 1RO0A 2PEOA 3M1MA 4U0FA 1K8AQ 3G71P 2XXMA 4XRQA 3CCSP 2Z45A 2PENA 3DS5A 2XV6A 5BS1A 1K73Q 1NJIQ 3P05A 2M8PA 2EFJA 3G6EP 1K30A 2BQ1E 3DS4A 2Z44A 2JYGA 4M0IA 2BUOA 1A43A 2KODA 1VQ7P 1Q7YQ 5HGMA 1YIJP 2JO0A 1VQ9P 4COCA 1VQNP 1E6JP 3G29A 3LRYA 1S72P 4U0EA 3DS2A 2CWOA 3CCMP 5JPAA 3CC4P 1VQLP 4PH0A 1EIAA 1RO2A 1N8RQ 1VQ6P 3MGEA 3CXCO 3G4SP 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU P;  1K9M Q;  3G6E P;  2QEX P;  1W2B O;  1Q82 Q;  1VQO P;  1Q86 Q;  1JJ2 O;  2OTJ P;  3CCV P;  1QVF O;  1VQM P;  3I56 P;  1YJ9 P;  1YJN P;  1VQ7 P;  1YIT P;  1VQP P;  1YHQ P;  1YJW P;  1Q7Y Q;  1YIJ P;  3CPW O;  3CCJ P;  1Q81 Q;  1KD1 Q;  1VQ9 P;  1VQN P;  1VQK P;  2OTL P;  1S72 P;  3CCR P;  1K8A Q;  1M1K Q;  3I55 P;  3G71 P;  3OW2 O;  3CCM P;  1QVG O;  2QA4 P;  1VQ5 P;  1KC8 Q;  1VQ4 P;  3CC4 P;  1VQL P;  1KQS O;  3CCQ P;  3CCS P;  1YI2 P;  3CC2 P;  3CCE P;  3CC7 P;  1N8R Q;  3CCL P;  1VQ8 P;  1VQ6 P;  3CD6 P;  3CXC O;  1K73 Q;  3G4S P;  1M90 Q;  1NJI Q;  3CME P;  3CMA P; 
#chains in the Genus database with same CATH topology
 2LML A;  3FXD A;  3RL0 C;  1HJB A;  1E79 H;  1WRG A;  1NYH A;  2Y0D A;  4JQ0 D;  3HRN A;  5M1B A;  5APX A;  1YJW P;  5AVW B;  3MZW B;  1EXJ A;  2FVA A;  1MFT A;  2JYL A;  2K93 A;  3P8C E;  2GYK A;  3TGU G;  5CCH C;  2K9Y A;  1KIL D;  1L0L K;  5KLV J;  3DTJ A;  3B5N A;  1VQO P;  1LTA C;  3SWF A;  4BPG A;  1L4A C;  4Z1M H;  1FZE A;  1YIT P;  3L70 D;  4UB8 E;  1RF1 C;  1XTG B;  1NU1 J;  1NTK E;  3TSI A;  2K92 A;  3WUT A;  1VQ8 P;  2IPP A;  3NY7 B;  1SQX G;  2FFD A;  1S9K E;  1CEI A;  1LP1 A;  3M91 A;  1UNK A;  1H89 A;  3CPW O;  2CG5 B;  2Y9Y A;  1BE3 D;  3GHG B;  4C46 A;  3SWK A;  1ZR2 A;  2FBW C;  4A7P A;  4XRQ A;  2Z45 A;  1SQB E;  3W67 A;  2PNG A;  2EFJ A;  1GXH A;  3DS4 A;  3WU2 H;  1NKZ B;  2JBG A;  3BCC D;  1PGO A;  1SQQ J;  1W2E A;  4N78 E;  1NTZ K;  4L74 A;  2ZAE B;  3TF5 A;  1RQV A;  2PAJ A;  3M0A A;  3DS2 A;  2JDI H;  3H1K D;  2PGD A;  1PGP A;  4DZO A;  2J59 M;  2KOO A;  2GDX A;  1VF5 D;  2VLP A;  2CNR A;  3L71 E;  2B89 A;  2E74 B;  1SQP J;  1GW4 A;  1PP9 D;  2JR8 A;  1SS1 A;  2J58 A;  4I7Z B;  3RK2 B;  2M0B A;  1JTH B;  1CSB A;  3L37 A;  2QA4 P;  1P84 H;  2M8N A;  3CCE P;  2KGC A;  3SWY A;  2WIT A;  5F2K A;  2WVR A;  5KLI C;  1UIX A;  1RNI A;  3H1L G;  3L35 A;  3Q1M A;  1Q81 Q;  1DX7 A;  2POH A;  2LXB A;  3TGU D;  4RKU J;  2ZT9 D;  5E79 H;  1GU4 A;  1H0T A;  3Q2Y A;  3F5H A;  2NO8 A;  3A7O A;  2MVU A;  2ZYD A;  2W83 C;  2BCC E;  1T3U A;  3H32 A;  4COP A;  3AE3 C;  2MR8 A;  3GMA A;  2KNC B;  3H1J E;  2L4B A;  1Y8A A;  3C8V A;  1SQX D;  3D6Z A;  3ZDM A;  2R5D A;  1JY3 O;  2KZJ A;  1R5L A;  3P05 A;  4IFM A;  2M8P A;  1AF8 A;  2W8Z A;  1XTC C;  4H2X C;  2YMY A;  2KG9 A;  1HUC A;  1QGK B;  2W6A A;  2QJK C;  2VLQ A;  2FYN C;  3F89 A;  5GTI E;  1P84 D;  1KIL E;  1RQU A;  1GDT A;  1BDC A;  1N2D C;  1FDM A;  4PV1 B;  2NPS D;  1ZME C;  2K2Q A;  3EWK A;  1FDI A;  3CL3 D;  2CGQ A;  3L70 E;  3MUD A;  2MF4 A;  1OXZ A;  2NPS A;  2EIA A;  2XKM A;  2AXC A;  3H1H J;  1EXI A;  3T97 A;  1NGM B;  3A0B H;  2XND H;  3E1R A;  2W90 A;  2O01 N;  3JSV C;  2XT1 A;  1LWU B;  1M6N A;  3D70 A;  1SFC B;  2E74 D;  3Q20 A;  2KB7 P;  3L75 J;  2R5B A;  1EQ7 A;  3KPE A;  1M8O B;  3RL0 B;  2O01 H;  1NTM K;  1BE3 E;  3V4Q A;  1LT9 B;  2KGE A;  1BCC G;  3TYY A;  1T2K C;  3L74 G;  1NWQ A;  3CC7 P;  1L0N J;  1R5S A;  4N6J A;  2WSE H;  3BCC E;  3EFF K;  5F2O A;  1FR2 A;  2IX7 C;  2K9J B;  3H1K E;  5KP8 B;  3V2Q A;  1L4A B;  5AW3 B;  1OVR A;  1LTI C;  2FY8 A;  1JNM A;  2IYO A;  1RF1 B;  2CQ8 A;  4ZKP A;  2O01 J;  1JCD A;  1PP9 E;  5CJ0 A;  4NPE A;  2ZJS E;  2H7H A;  2KOS A;  1HY8 A;  4IFD K;  1KQG B;  2AEF A;  4HH2 A;  2PFX A;  2B88 A;  2I8D A;  3LRY A;  5CZD B;  3CCM P;  1SVF A;  5AVZ B;  2W6J H;  1VQ6 P;  4EDF A;  3WUU A;  3IN6 A;  2XNX A;  3KQG A;  3TGU E;  2JU1 A;  4DJG A;  2GZI A;  3SSU A;  4Y99 C;  3MIW A;  3WU2 E;  4LLH A;  1FDO A;  2C9L Y;  5APW A;  1IFJ A;  2E5Y A;  1R8E A;  4UB8 H;  3H0D A;  1L0L G;  3L73 J;  3VP9 A;  2K0D X;  2JB0 A;  4YTP C;  1SQX E;  1SFC D;  3GZM A;  1KZU B;  3HUS B;  3RL0 D;  3B8E B;  2KSE A;  2N9B A;  1KOR A;  5KKZ B;  2YMK A;  3FWL A;  2P2U A;  3V4W A;  1BCC D;  1ZP0 C;  2N6Z A;  3AED C;  2JP3 A;  1P84 E;  3OA7 A;  3L74 D;  2M5A B;  2DNW A;  3BRT B;  1X22 A;  1AYI A;  4HJG H;  4BRY A;  5CCH D;  2NZ2 A;  3M0D C;  1JY2 N;  2Q5U A;  3U1A A;  1NTK J;  1L4A D;  2W6B A;  3L72 G;  1LTS C;  1JMM A;  2BQ1 E;  1QX8 A;  2JYG A;  4JPZ B;  5AVX B;  2RH0 A;  5E79 E;  2VSQ A;  2KOD A;  1EZV I;  1NTZ G;  2KGA A;  4NPF X;  2N50 A;  1M7L A;  2KWL A;  1FJK A;  1GD2 E;  4OGQ B;  3H1I G;  2OYO A;  2QNW A;  1SQB J;  4EYY Q;  3CLQ A;  1LTJ C;  3RL0 g;  2E42 A;  1KN7 A;  3DS3 A;  2QIW A;  1YQ3 C;  3HE5 A;  1K04 A;  1ZMB A;  3H1L E;  2QJK B;  1J1D C;  3RK2 C;  2ZVN B;  2WPT A;  2Y9Z A;  3DS1 A;  1PEQ A;  2HPC B;  2WPS A;  3RK3 C;  2QJP C;  3CCL P;  1PGQ A;  1IUQ A;  5I4T G;  2HOD B;  3L71 J;  1X8Y A;  5B5E E;  2OQQ A;  2A06 G;  2KZI A;  3HE4 B;  5EFW B;  2ZXE B;  1IFN A;  2OYI A;  1M56 D;  3G1I A;  3G0V A;  1L0L D;  3G21 A;  3N4X A;  1YI2 P;  4WY4 B;  4U0C A;  3L70 G;  2Z5I A;  2XZR A;  3CMA P;  3CCU P;  2M5R A;  2WSF J;  1GZL A;  4HKZ H;  2PEQ A;  2E76 B;  1VKU A;  4ASW A;  1EMV A;  1QRJ A;  2D2C C;  3V6I A;  4PH1 A;  2AFD A;  2Q1K A;  4C7N B;  1OIP A;  1URQ A;  1UII A;  2H8P D;  2L0Q A;  1SQV K;  4HYT B;  2N98 A;  1AFO A;  1BE3 G;  4RJT A;  3GKL C;  1KLP A;  5APQ A;  2BCC J;  1VQN P;  1N7S A;  2FYZ A;  4JYB A;  2QVA A;  1HGZ A;  2LXC B;  3BCC G;  3H1J J;  4PV1 C;  3KZI E;  2YXR B;  3GJN A;  3L36 A;  2VLN A;  2KS1 A;  1M90 Q;  3VRL C;  3CI9 A;  1NTZ D;  3GZL A;  1JY3 P;  1JJ2 O;  2B9B A;  1LT1 A;  2VRS A;  1YJN P;  1G1I A;  1S1C X;  4L75 A;  3H1I D;  1EZV G;  1VQ4 P;  3BAS A;  4XFX A;  1BCC E;  1HVV A;  3CXH I;  2WTY A;  3CWB G;  3L74 E;  1T8Z A;  1CI6 A;  4U3F G;  1NTM G;  4JF7 A;  2ZYA A;  2QE7 H;  1LT9 C;  3AEA C;  4D6T G;  2HFE D;  3L70 J;  2K3R A;  1UJZ A;  3PH0 A;  3G9R A;  4Y99 B;  1OMI A;  3II6 A;  2FYU K;  3I5C A;  2A45 I;  2KGD A;  4O9B A;  3RG6 C;  5AW0 B;  3V2R A;  1TU3 F;  3H25 A;  2PEM A;  2AFE A;  3BRV B;  4AYC A;  2A06 D;  3N7N A;  3UIA A;  2RKL A;  1X0T A;  3A0H H;  1KIL A;  1FOS F;  3RGU A;  3P8M C;  2Q7C A;  3VN0 A;  3LIE A;  3HTK B;  1VPC A;  1T6A A;  1NQ4 A;  2QJY C;  3PJS K;  1A02 J;  1JMB A;  2E43 A;  2H89 C;  5KP7 B;  1OVV A;  1X3O A;  4LGD E;  1T2K D;  3H1K J;  2WPQ A;  4GOF A;  3G29 A;  2FVF A;  1FC2 C;  1HWT C;  3CX5 I;  2JJL A;  1IK9 A;  4GOD A;  2MVV A;  2MD9 A;  5DCK A;  1PP9 J;  1HBW A;  2GZJ A;  1L0L E;  1LJ2 A;  3WBH A;  4YPC A;  4YXD C;  3A3Y B;  1L0I A;  2MJZ A;  2VLO A;  2YO3 A;  3AEF C;  2Y0E A;  4R0M A;  3GF7 A;  2WPV B;  4U7J A;  1F80 D;  1K9M Q;  4H2W C;  3SFE C;  4KHX A;  1LTJ B;  1N73 A;  1FZB A;  1EZV D;  2OTK E;  4W80 A;  3TGU J;  1LGH B;  2JAZ A;  1AQ5 A;  1FS0 E;  3CWB D;  1J1D B;  2E75 C;  3HUS C;  3G3Z A;  1M1K Q;  5BVZ A;  2K88 A;  4U3F D;  1NTM D;  2YIU C;  4DG9 A;  4D6T D;  3RK3 B;  5KKZ C;  2OYH C;  2QJP B;  2LPK A;  1JY2 P;  1G2C B;  4N3Y B;  2YXQ B;  1RE3 C;  3JC2 2;  1OVU A;  2KOP A;  4BXL A;  3L72 E;  1YJ9 P;  5B66 E;  1G1J A;  2KP8 A;  1SQX J;  2AEJ A;  3IF4 A;  2K0X A;  1NTZ E;  1U57 A;  1GK4 A;  2RMZ A;  4TT3 H;  2JO1 A;  2K5X A;  4ASV A;  1K30 A;  2KR5 A;  3GF3 A;  2A45 G;  3TK1 A;  1WT6 A;  2Z44 A;  4M0I A;  3H1I E;  2LIU A;  2D2C B;  5AW8 B;  4GIF A;  1Q7Y Q;  4COC A;  1QEX A;  3KYQ A;  4UB6 E;  3EJD A;  2C0W A;  1YBK A;  4OGQ C;  4DT0 A;  4PXH B;  3VP8 A;  2HG5 D;  4PJ0 H;  5KTB A;  3Q5P A;  4GR2 A;  1S3J A;  5APT A;  1L0H A;  3MGN A;  3FXE A;  1AVY A;  1IZN B;  3GHG A;  3GLM A;  5KLV K;  2UWJ E;  2FAD A;  1IO4 A;  2A06 E;  2A45 H;  2QRX A;  2PEI A;  3A5T A;  5B5E H;  2L6E A;  1NU1 K;  1NKN A;  1E0H A;  4GT1 A;  1DD4 A;  2JWA A;  4H44 C;  3VOP A;  1S4X A;  2CPS A;  3H1L J;  1KQS O;  1PZQ A;  3CC2 P;  4WY4 C;  1OFC X;  1U7M A;  5APS A;  3CME P;  2IDB A;  3B5N C;  1FZF A;  2DGY A;  1ZV8 A;  2E76 C;  3AE2 C;  3U59 A;  3RK2 D;  2B87 B;  3D71 A;  1LTT C;  1M74 A;  3G1G A;  2ONT A;  3VMZ A;  3RK3 D;  1WMK A;  1IFM A;  1JTH A;  4GDO A;  3CX5 H;  3CCS P;  1SQV G;  3CXH D;  2PEN A;  1SQQ K;  2FFD C;  3U1C A;  4JBZ A;  1EC5 A;  1QL1 A;  2MY5 A;  3P7K A;  3KZI H;  2BUO A;  1KFM A;  2KI7 B;  3H1H D;  1ACP A;  3V2P A;  5APY A;  3IFM A;  1HTL C;  2BAS A;  4NEO A;  1S72 P;  3CC4 P;  1FZG A;  1N8R Q;  1SQP K;  3TDK A;  2CPB A;  2KG6 A;  2BEQ D;  2D2C D;  3A0H E;  1EZV E;  1FZC B;  2QJY B;  5KJ7 C;  3S9O A;  2KLU A;  3CWB E;  4R4L A;  5HV8 A;  3B4Q A;  3G26 A;  1KB9 I;  4U3F E;  4Y28 J;  1NTM E;  1VQP P;  2W27 A;  3NTN A;  4D6T E;  1S5L H;  2KNC A;  2M3E A;  2WSE J;  3CCR P;  3OW2 O;  4U0B A;  1M1J B;  3CD6 P;  2HYN A;  3AEE C;  2JU2 A;  2LIW A;  2C0X A;  1BDD A;  3MHV A;  2FXM A;  5HGL A;  2PY8 A;  2L5G B;  2WSC H;  2FKW B;  1USD A;  4PV1 D;  3Q5S A;  2YNY A;  2ZXX A;  5APV A;  1PFI A;  2KUB A;  1JY2 O;  3CX5 D;  1IFI A;  2FYU G;  2AVA A;  1D1D A;  1RE4 A;  1BCC J;  5C39 A;  3NTE A;  2CK3 H;  4EI2 A;  1FOS E;  2K1A A;  3L74 J;  1MUU A;  5BU8 B;  3MP7 B;  2P9X A;  1EDL A;  4WBA A;  2QM7 A;  2I1J A;  2FQ2 A;  1ZR4 A;  5AW5 B;  4CA3 A;  1N7L A;  1OWA A;  2E75 B;  1Q90 D;  1LWU A;  5AVU B;  2JWD A;  1SFC A;  2YIU B;  2IZ1 A;  2OYH B;  2WSC J;  1OW8 A;  2HLO A;  1Z6M A;  1X79 B;  4BWN A;  2Y0C A;  1LT9 A;  3R2P A;  4AUW A;  4DCK A;  3PLN A;  1SQV D;  1GPJ A;  1VQ9 P;  1GTW A;  1MKM A;  2ROQ A;  1EIA A;  3O6Q B;  2ZVO B;  2L91 A;  5CCH A;  3NFQ A;  1Q82 Q;  2K9J A;  5KAI H;  2FHS C;  5HVC A;  1FE6 A;  1L4A A;  3CCJ P;  4EIJ A;  2OTL P;  1Q2N A;  1EDI A;  5F2N A;  3NMD A;  1RF1 A;  1JO5 A;  1EOQ A;  2RN0 A;  2WT7 B;  2K0Y A;  4M3L A;  1ZNV A;  2IZ0 A;  3RK3 E;  1CW5 A;  2H88 C;  3HD7 B;  4B86 A;  1L0N K;  3CXH E;  1L0L J;  1DV5 A;  3E2D A;  3PRJ A;  4PJ0 E;  2E1M A;  3CE7 A;  2V7Q H;  4CPG A;  3W68 A;  3U43 A;  2R3C A;  5B66 H;  1Y47 A;  3H1H E;  3EFG A;  2QEX P;  1JUN A;  1KV4 A;  2P10 A;  2N1T C;  1HF9 A;  2N6Y A;  1KMI Z;  3S1K A;  1D7M A;  1PPJ G;  2FYU D;  1BGY G;  1S9K D;  4C7R A;  4H44 B;  1T8K A;  3KHU A;  2XXM A;  2ERH A;  1OW6 A;  1AJY A;  1MV8 A;  2XV6 A;  4PD4 D;  4UB6 H;  5CHX A;  3B5N B;  4I2L C;  2FAE A;  4KJM A;  2GUS A;  2E75 D;  5CJ4 A;  2V7Q J;  2N9Y B;  3LW5 H;  1T3J A;  3L72 J;  1E6J P;  2QSI A;  3HUS A;  1VQL P;  3O8Z A;  1NTZ J;  1W5C E;  3MGE A;  4PWV B;  4WB4 A;  2R44 A;  2FFD B;  2WSS H;  4XFZ A;  1LP1 B;  2IBZ I;  2C9N Y;  3CX5 E;  2P67 A;  3H1I J;  2M5A A;  4IL6 H;  2LF4 A;  2Z46 A;  2G3A A;  5AW9 B;  4U0D A;  4XRO A;  1HJ0 A;  5AVQ B;  1PEU A;  1EDK A;  1NHL A;  3IR9 A;  5H2F H;  3CCQ P;  1FU1 A;  2EHT A;  5AVR B;  2PEK A;  5AW6 B;  2KIK A;  3LW5 J;  1NU1 G;  4H13 C;  1BXI A;  1YHQ P;  3AE5 C;  4EOT A;  1KQF B;  1PL5 A;  2YKO A;  2YKP A;  4OGQ D;  1QVG O;  1KYO I;  3AE8 C;  3HZQ A;  2JEE A;  5AVY B;  1GL2 C;  1LTG C;  3NXS A;  1S5L E;  1SQV E;  3TNU B;  1OR5 A;  1KB9 D;  1DNY A;  2GDW A;  2YO2 A;  1NTK K;  1AVO A;  2MKV A;  2PEO A;  5APU A;  2N5H A;  3AE7 C;  2HPC A;  1SQQ G;  4XA4 A;  1PIX A;  1KFN A;  1DH3 A;  3VMX A;  1PPJ D;  2LKM A;  5TIS E;  1BGY D;  2XZ0 D;  4H44 D;  5AVS B;  1U7J A;  2HOD A;  1BE3 J;  3LMO A;  3VTP C;  4WY4 D;  1SQB K;  3HE4 A;  1LTB C;  3D6Y A;  3B5N D;  1H0T B;  2E76 D;  2O1J A;  1RO2 A;  1SQP G;  4WY4 A;  2FAC A;  3CXC O;  3G4S P;  3L4F A;  2ZT9 B;  1FZC C;  5HGO A;  2EG5 A;  1RH5 B;  3BCC J;  2WZ7 A;  1PEO A;  2WMM A;  4ZMD A;  5DJT B;  2Q9I A;  3H32 B;  3AE9 C;  2MR7 A;  4C7N A;  3R4Y A;  3E1I A;  2OGU A;  1PEM A;  3H47 A;  2JGP A;  1M1J C;  2XDJ A;  3GW6 A;  4I6M C;  2FYU E;  2I1K A;  2IFM A;  4K35 A;  2FXP A;  3VMA A;  1JOC A;  1GW3 A;  3M9Q A;  3DS0 A;  2LOL A;  2KOQ A;  5KLV D;  2P1J A;  4K3A A;  3CWB J;  2IBZ G;  4L76 A;  4U3F J;  1NTM J;  4IFF A;  4PD4 E;  2Q3E A;  4D6T J;  1NOH A;  5KJ7 D;  3C9I A;  1OW7 A;  5KAI E;  4R4M A;  1NU1 D;  2PEJ A;  1E5W A;  3FWN A;  2PP6 A;  5KJ7 A;  2NPS B;  1S5L X;  4IZ6 A;  3T97 B;  3C1L A;  2OYI C;  1SLQ A;  2PRR A;  3V5B A;  3G71 P;  4H0L C;  1YTZ I;  3DS5 A;  1K73 Q;  5BS1 A;  3EJB A;  2IYP A;  5CBO A;  4BPH A;  3MTU E;  2GDY A;  3B4S A;  2XU6 A;  3TNU A;  2N1T B;  1A43 A;  2KXP B;  1URQ C;  4TLF A;  1SQQ D;  1YQ4 C;  4U0E A;  5JPA A;  1SP4 A;  2O1K A;  3H1H G;  2QM8 A;  5CCG C;  5KAF E;  2Q6Q A;  1RHZ B;  1RF0 C;  1Q86 Q;  2QG4 A;  4ZNC A;  2GA1 A;  4MN4 C;  1BAJ A;  1N7S C;  4GR6 A;  1VQK P;  1SQP D;  3L75 G;  1NO4 A;  1DEE G;  1JM0 A;  3DPH A;  1KYO H;  3HTK A;  1YTZ T;  3CXH H;  1KB9 E;  1PV3 A;  3P32 A;  4WYM A;  2IFN A;  3HD7 C;  1NH4 A;  2GM4 A;  4IPY A;  1ZW0 A;  1L0N G;  3QWO C;  3H4E A;  2R32 A;  4KT0 J;  3KXD A;  1PPJ E;  4IOI H;  1A8O A;  2KSJ A;  1BGY E;  2M8L A;  2X2B A;  1JEK A;  1Z56 A;  3M0D A;  2P7J A;  4IL6 E;  1OZH A;  4PD4 I;  4WVZ A;  4BPF A;  2LKI A;  3JCU H;  3B5I A;  2IBZ D;  1DD3 A;  5H2F E;  3CCV P;  4H13 B;  3IAO A;  2R3S A;  1K8A Q;  1J1E C;  3EQ2 A;  4XFJ A;  2K94 A;  5AW1 B;  3M9B A;  5EW5 E;  1NJI Q;  2H43 A;  1Y9B A;  3G6E P;  3AE6 C;  1GL2 B;  1LTJ A;  2WWW A;  3AEB C;  5AW2 B;  1KIL C;  1ZXG A;  4OVN F;  5HGM A;  2JO0 A;  1JCC A;  1AA0 A;  2AXT H;  5TJH A;  1BSN A;  1KYO D;  2CWO A;  4W7Y A;  5K5G B;  2FVE A;  4PH0 A;  5AVT B;  5KLV E;  2N1T D;  1PGJ A;  1G2C A;  1JY3 N;  3OJA B;  1AUM A;  4JYC A;  2Z4E A;  1HH0 A;  2NRG A;  1QVF O;  1NVO A;  1VQM P;  1FJP A;  4XFY A;  2N1T A;  4BRY B;  1NU1 E;  1AQT A;  2KYV A;  3L73 G;  3I55 P;  1KC8 Q;  4RO0 A;  1GMJ A;  1FBM A;  3H1L D;  4QKO A;  5AW7 B;  2LL8 A;  3BVH A;  3RG2 A;  2AEM A;  2Q3I A;  1N86 A;  4DOJ A;  3ABV C;  1ZLL A;  3L75 D;  5GTH H;  2XZ1 C;  5BS2 A;  2JKV A;  4W7Z A;  1IJD B;  5BU5 A;  2KG8 A;  1YYC A;  2FQ0 A;  1GXG A;  1IMQ A;  1L0N D;  1N73 C;  1SQX K;  4IL6 X;  1SQQ E;  5HGN A;  4MRT C;  3HE5 B;  2FXO A;  1VF5 C;  1NTK G;  4HB1 A;  3ITK A;  3LID A;  3E7K A;  5TIS H;  5KP6 B;  4AQR D;  4H13 D;  2O3J A;  4UHP B;  4XE5 B;  1SQP E;  1X9V A;  2JQ4 A;  1SQV J;  5CBN A;  1M57 D;  1ZOY C;  2YKQ A;  2OYI B;  1SQB G;  1GU5 A;  1GL2 D;  1ZN5 A;  5L8R J;  2E5T A;  4H0L B;  3OAK A;  2ZT9 C;  3MD0 A;  2GZF A;  1IFP A;  3A2A A;  2WQY C;  1GL2 A;  3PTZ A;  4QMA A;  1ZRT D;  2KW2 A;  1VDF A;  2OTJ P;  1NAF A;  2LR2 A;  2B87 A;  2EHS A;  3PHL A;  1OX3 A;  1K05 A;  3Q5R A;  5AW4 B;  4HKG A;  1URQ B;  1H88 A;  3S4R A;  1H8A A;  3WMM 0;  2IBZ E;  3L71 G;  3PP5 A;  5KLI B;  4PD4 H;  1M6E X;  4H2Y C;  3L73 D;  1VHN A;  1VL2 A;  1HGV A;  4LC1 A;  3G28 A;  3USS A;  3VMY A;  2LTE A;  1N7S B;  3GHG C;  2OAR A;  1L2P A;  3RBZ A;  4OWF A;  2KOG A;  1VQ5 P;  2KS1 B;  2M8R A;  4U0A A;  4GOE A;  3QH9 A;  3MUD C;  1FZC A;  2KK7 A;  2AF8 A;  2NPS C;  1IK7 A;  2BEZ F;  2M3B A;  2FYU J;  3P8C D;  1KYO E;  2FQ1 A;  4L73 A;  3B71 A;  3I56 P;  2ITA A;  1KTM A;  4QNB A;  5CMZ A;  2P58 A;  1RO0 A;  3M1M A;  4U0F A;  2KLV A;  2BCC G;  1M1J A;  3AEG C;  1CI6 B;  3FX0 A;  1IFD A;  1NTK D;  5AVV B;  2E74 C;  2GUV A;  2WSF H;  3H1J G;  4WWI A;  5KAF H;  1VQ7 P;  1RY3 A;  2J5U A;  1YIJ P;  4I7Z C;  2FYN B;  1MFZ A;  3JCU E;  2ZFC A;  1J1E B;  1MZ9 A;  2G8Y A;  2K37 A;  1BSH A;  3L75 E;  1FAV A;  1HQB A;  3M9H A;  3AEC C;  1W2B O;  3HYB A;  1KQL A;  1MZ8 A;  2GZG A;  1SQB D;  2ZYG A;  3EJE A;  1DIP A;  1KIL B;  4H0L D;  2L9F A;  1KB9 H;  2XV5 A;  2N5I A;  1L0N E;  4N78 D;  4RES B;  3A0B E;  4I1L A;  2V4H A;  1QLE D;  3KDP B;  2OYH A;  4ZKU A;  1URQ D;  2AXT E;  1RE3 A;  3V2N A;  3BAT A;  2GZE A;  3WUV A;  2WPR A;  1J2J B;  1KD1 Q;  4GKG A;  1IMP A;  5CCG D;  1JB0 J;  2L22 A;  2Z5H A;  3L71 D;  1DEB A;  1P84 I;  5KLV G;  3RBX A;  1IC2 A;  3O6Q A;  5CCG A;  4OH8 B;  5GTI H;  5EJD A;  1N7S D;  2HR3 A;  1RF0 A;  1GK6 A;  1NAY A;  1A02 F;  2BHV A;  1EDJ A;  3K5B A;  3AE4 C;  3L72 D;  1QL2 A;  1RE4 C;  4YXW H;  5GTH E;  4F37 A;  1ZRT E;  3H6P A;  3VYI A;  3HD7 D;  2WT7 A;  1BGY J;  3H1K G;  3FGA D;  1N73 B;  4NPD A;  2KOR A;  3HD7 A;  5DJU B;  1LNQ A;  3AE1 C;  1VF5 B;  1FZA A;  1CZQ A;  3Q3D A;  2BCC D;  2DW3 A;  1AV1 A;  1USE A;  1PP9 G;  1LWU C;  3GG2 A;  1SFC C;  2SPZ A;  3M06 A;  3L73 E;  1S2E A;  3H1J D;  3SFD C;  7CEI A; 
#chains in the Genus database with same CATH homology
 3VRL C;  5DCK A;  5HGO A;  1W2B O;  3HYB A;  2EG5 A;  4XFZ A;  1AUM A;  4GR2 A;  3DS3 A;  1PEO A;  1Q82 Q;  1Q86 Q;  2EIA A;  1JJ2 O;  2OTJ P;  1BAJ A;  1QVF O;  1VQM P;  4XFY A;  1YJN P;  1ZMB A;  3G26 A;  4GR6 A;  3WBH A;  1YJW P;  1VQP P;  2LF4 A;  2Z46 A;  3CCJ P;  2OTL P;  4U0D A;  1VQK P;  2XT1 A;  3DPH A;  3DS1 A;  4XRO A;  3CCR P;  3I55 P;  1PEQ A;  5F2N A;  4U0B A;  3OW2 O;  2QA4 P;  3H47 A;  1KC8 Q;  1VQ4 P;  2M8N A;  1PEU A;  1PEM A;  2JYL A;  4XFX A;  1EOQ A;  3CCQ P;  3CCE P;  1M6N A;  3CCL P;  3CD6 P;  3Q20 A;  2PEI A;  2PEK A;  5F2K A;  1K9M Q;  3H0D A;  2L6E A;  4WYM A;  3DTJ A;  1RNI A;  1IUQ A;  3DS0 A;  5HGL A;  1M6E X;  5I4T G;  1VQO P;  2PY8 A;  3G28 A;  4IPY A;  5BS2 A;  1YIT P;  1YHQ P;  1Q81 Q;  1KD1 Q;  2OAR A;  3H4E A;  3E2D A;  2E1M A;  1QVG O;  1M1K Q;  3G1I A;  3G0V A;  1A8O A;  1VQ5 P;  3G21 A;  3HZQ A;  1KQS O;  3CC2 P;  1YI2 P;  3CC7 P;  1D1D A;  2M8L A;  3RG6 C;  4U0C A;  1VQ8 P;  2PEJ A;  3CME P;  3CMA P;  3CCU P;  4U0A A;  2PEM A;  3NTE A;  2QEX P;  5F2O A;  2DGY A;  2PEQ A;  3B5I A;  1QRJ A;  5HGN A;  3CCV P;  4PH1 A;  3I56 P;  1YJ9 P;  2BHV A;  2P9X A;  1M74 A;  3G1G A;  4QNB A;  4COP A;  2ONT A;  3CPW O;  1RO0 A;  2PEO A;  3M1M A;  4U0F A;  1K8A Q;  3G71 P;  2XXM A;  4XRQ A;  3CCS P;  2Z45 A;  2PEN A;  3DS5 A;  2XV6 A;  5BS1 A;  1K73 Q;  1NJI Q;  3P05 A;  2M8P A;  2EFJ A;  3G6E P;  1K30 A;  2BQ1 E;  3DS4 A;  2Z44 A;  2JYG A;  4M0I A;  2BUO A;  1A43 A;  2KOD A;  1VQ7 P;  1Q7Y Q;  5HGM A;  1YIJ P;  2JO0 A;  1VQ9 P;  4COC A;  1VQN P;  1E6J P;  3G29 A;  3LRY A;  1S72 P;  4U0E A;  3DS2 A;  2CWO A;  3CCM P;  5JPA A;  3CC4 P;  1VQL P;  4PH0 A;  1EIA A;  1RO2 A;  1N8R Q;  1VQ6 P;  3MGE A;  3CXC O;  3G4S P;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...