3CC7P

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc7P02
1N8RQ 1KC8Q 1YJWP 2OTLP 3G71P 3CCQP 1VQMP 1YJNP 3CCEP 3CC7P 1YJ9P 1W2BO 1VQNP 3CPWO 1M1KQ 1VQ9P 1Q82Q 1Q86Q 2QEXP 3CC4P 3CD6P 1YITP 1QVGO 1K73Q 3CCRP 1VQLP 1YI2P 1VQOP 1Q81Q 1VQPP 1NJIQ 3CMAP 2QA4P 1K9MQ 3I56P 1JJ2O 1KD1Q 1YHQP 1KQSO 1S72P 3I55P 1VQ4P 3CCUP 1VQKP 1VQ5P 1K8AQ 3CCMP 1M90Q 1YIJP 1VQ7P 3CCJP 1QVFO 3CCVP 3CC2P 3G6EP 3CMEP 1VQ6P 2OTJP 3CCSP 3CCLP 1VQ8P 3CXCO 1Q7YQ 3OW2O 3G4SP
chains in the Genus database with same CATH superfamily
1SQXE 4U3FE 3V4QA 2QSIA 1J1DB 3QWOC 1OW8A 5GTHH 3E1RA 4U7JA 1BGYG 1IFNA 1GU5A 2MVVA 3I56P 1SQXJ 2OYHC 3PH0A 4NPFX 5AVWB 3CWBJ 1VQ7P 2FY8A 1NTZK 2SPZA 4C46A 4I2LC 4IFFA 3G29A 2ONTA 3NFQA 5BS1A 2WZ7A 5K5GB 1H89A 1SQBK 1NWQA 3H1JD 2GZJA 2JWDA 1SQQJ 1KB9H 1IK9A 3R4YA 2MVUA 5AVRB 3GF7A 1VQKP 2LL8A 1AJYA 3TSIA 3BVHA 3IR9A 2KOGA 1R5LA 1AQ5A 3L74D 3L71J 1EMVA 2N1TA 2GDYA 5L8RJ 1SS1A 1JB0J 4H13D 1NVOA 1L4AD 2VLOA 3L71E 2WSFH 3L72J 1W5CE 1ZW0A 3M9QA 1N73B 5AW9B 2FADA 2MD9A 3CCSP 1GL2B 3IAOA 1DNYA 1SFCB 2ZYGA 4JF7A 3A0HH 2O01J 2YMKA 1USEA 3L72E 2KNCA 1KQLA 2L9FA 3HYBA 2KOSA 5KLVJ 3R2PA 2WVRA 2DW3A 2G3AA 3PHLA 1UJZA 5AW7B 2ZXXA 3EQ2A 1NTKD 1A8OA 4N78E 5AW2B 4LGDE 1EC5A 3CXCO 2IZ1A 2VSQA 2N1TB 3G71P 1EDLA 3RG2A 1D7MA 4CA3A 2LMLA 2JEEA 1L0NK 2ERHA 3LIEA 4NPDA 1G1JA 2A06E 1OVRA 4U0EA 3V4WA 2WSEH 3TGUJ 3U1CA 2H43A 3CCJP 2YO2A 3H1LE 4HKGA 2KORA 2KGEA 2JAZA 1ZV8A 2Q7CA 1QL2A 1S9KD 3CWBE 1VQNP 1JY2N 1PZQA 1CI6B 1OR5A 1NJIQ 5APTA 1LWUB 3AE6C 1NTME 1GU4A 5DCKA 4LC1A 2W8ZA 1EXJA 3CCLP 2PEQA 1UIXA 4PD4E 2XT1A 2Y9YA 2E42A 3W67A 1UIIA 5E79H 3CWBG 5F2NA 2YKPA 3HD7B 3CWBD 1S1CX 3A7OA 1Y9BA 5EFWB 3GW6A 5CCHC 3EWKA 1M6NA 2RH0A 1PEMA 5BU5A 1N7SB 3RL0C 3OJAB 2PENA 2XNDH 1L0LD 2LIUA 1HJBA 3Q1MA 3MGNA 4XFJA 3SFEC 5KLIC 4K3AA 1DH3A 1L0NJ 1M1JC 1P84I 4GKGA 1M1JA 3KXDA 4XA4A 5CCGD 3GMAA 1FZBA 1BDDA 1S3JA 3BCCJ 3M9BA 1MZ9A 2L4BA 3EJDA 3L37A 1VQMP 5AVZB 3FWLA 4EYYQ 1VQ9P 3BATA 3CXHH 1FZAA 1X79B 1IJDB 3CXHD 1JJ2O 1T3JA 4PV1C 1KD1Q 2AXCA 3CCUP 2AF8A 3L4FA 2XXMA 4GIFA 1NTKG 2B89A 2E76C 1G1IA 5F2OA 3RBZA 3B5IA 3GG2A 2C0WA 1JY3O 1N2DC 1SQVK 3H32B 3B4QA 5KP8B 3CI9A 2PEMA 2M8NA 1K9MQ 1S5LE 1SFCD 2KSJA 3Q5RA 2QJPB 4U0BA 1R5SA 5APYA 5AVQB 4RJTA 2N5HA 5CMZA 3HUSC 1FZFA 3HUSA 2JBGA 4F37A 3SWFA 1Q81Q 4H2XC 4KJMA 1PIXA 2EIAA 1BCCE 2KOOA 2LPKA 2V7QH 3V2PA 4DOJA 1BGYE 2MR7A 2FYNC 3AE1C 2MY5A 2JYLA 4BRYA 5AW6B 3BRTB 1ZR4A 4ASVA 3GHGB 1LJ2A 2ZJSE 5APWA 3A2AA 4WY4C 2BHVA 3HE4A 1SQQD 1RE3C 2AFDA 2IZ0A 3RL0g 1RE3A 3CC7P 1M74A 1Q82Q 1BGYD 2KK7A 1XTGB 1DEEG 1EDIA 1GPJA 1L4AA 3CXHE 4W80A 1DX7A 2QJPC 1PPJE 1YJ9P 3GJNA 1GZLA 4D6TE 4HYTB 2KS1A 4DJGA 2R3SA 1EIAA 1FC2C 3P32A 2Q6QA 3T97B 1FDOA 2J59M 2BEZF 2OGUA 3NMDA 4COPA 3Q5SA 5AVUB 2N1TC 2XDJA 1PPJG 2J58A 1ACPA 3GZMA 2NO8A 4D6TD 2WQYC 1FAVA 1S4XA 3B71A 3USSA 5E79E 1M8OB 1WMKA 2W83C 1Z6MA 2KR5A 1JNMA 2P7JA 1HF9A 1J1EB 2JGPA 2FFDB 4I7ZB 3U1AA 2NPSA 2FACA 1HTLC 1ZR2A 3GZLA 2B87B 2NPSC 2YKOA 1AYIA 1FZCA 1M90Q 5KLVG 2HFED 1JY2P 1VHNA 2ZXEB 1Q7YQ 1EZVG 2K93A 3TK1A 1BSNA 1BAJA 2Q5UA 1JM0A 1ZN5A 2KOQA 2Z45A 1N7SD 1ZXGA 1NTKJ 1FZEA 2PEOA 3L75D 2GZGA 5EJDA 1CZQA 4EIJA 1LTTC 3FXEA 2OTKE 1RF1A 1SQPK 1VQ6P 1PP9E 3AE9C 3DS1A 1EZVE 3H1KG 1KMIZ 2P58A 1N73A 2E5YA 1N73C 1MUUA 1SQVJ 1GXGA 3TNUB 3L73D 1P84D 2VRSA 5KJ7D 2XZ0D 1SQBD 2E75C 3KQGA 2CGQA 3FX0A 3A0HE 3IFMA 2N9BA 1LTBC 1KN7A 1JEKA 4WY4B 1SQPG 3SFDC 4YPCA 5BVZA 3GF3A 2LKIA 1L0HA 3HTKB 5B66H 1RY3A 3AEGC 4U0AA 3WUUA 2LKMA 2WSFJ 2KP8A 1ZNVA 4BPHA 1SQPD 3G9RA 3HZQA 3OA7A 1R8EA 1YI2P 2KYVA 3C9IA 2Z5HA 4H13B 1QX8A 4HKZH 1SQBG 1UNKA 1FZCC 2B87A 2FFDC 3NXSA 2HPCA 2Z46A 1LWUC 3V2QA 4O9BA 4U0CA 2IYOA 2QJKB 2E74B 3WUTA 5APVA 3FWNA 2AXTH 2HPCB 4IFDK 3WU2E 1L4AB 2IBZD 3DPHA 2IFNA 5KTBA 4TLFA 3B5NB 3G6EP 1OW7A 5HGMA 2CWOA 2VLPA 3O6QB 1KC8Q 2WWWA 1AVOA 4PD4H 4AYCA 3CD6P 2K0YA 2LXCB 3CX5H 1N7SC 2XNXA 3M9HA 1M57D 3T97A 3IN6A 2EHSA 4N3YB 3LIDA 4PD4I 2FVAA 1YIJP 2JYGA 2FYUE 3HD7D 3HE5B 4I7ZC 3B5ND 3RK3E 2K0XA 2I1KA 5AW5B 3B8EB 3D6ZA 3DTJA 1KFNA 4JYCA 1U57A 1JY2O 1BCCD 4Y99C 2GZFA 1CSBA 1EOQA 1PEOA 5CCHA 2A45G 3KPEA 3L72G 3V5BA 2P9XA 2AEMA 4D6TG 4PJ0E 3AEDC 2YIUC 2POHA 4PWVB 1Q90D 2K9JA 1OVUA 1YYCA 1PPJD 3K5BA 4C7NB 1T2KD 3RK2C 2R32A 1ZP0C 1RE4A 3GHGC 4QKOA 5KJ7C 5C39A 3H1LJ 1QEXA 1GL2D 2OYOA 3L70J 1FJKA 2QRXA 2OTLP 1SQBJ 2ITAA 1JY3N 5KP7B 1LTGC 1KTMA 2Q9IA 2IX7C 3G26A 3H1IE 1H0TB 2O01H 2AEFA 1J1EC 1AQTA 1L0IA 1IZNB 2WPTA 2BCCD 2O1JA 2E75D 1RO2A 4WYMA 1YJWP 1BGYJ 3NTEA 2JKVA 4I6MC 1IFIA 2LTEA 1X22A 2PRRA 3U43A 2FXOA 1P84E 1L0NE 2W6BA 3P8CE 1IO4A 3RK2D 5KLIB 4H13C 1T8ZA 1QL1A 2FFDA 1KB9E 2NPSD 1IUQA 1OZHA 3AEEC 3BCCE 4GT1A 5KJ7A 3KDPB 1LTJA 1XTCC 3CC4P 2FYUJ 1KV4A 3Q3DA 2E76B 2M0BA 2QA4P 3H1KJ 4RESB 2V4HA 3DS0A 3I55P 1AF8A 1NKNA 5GTHE 4YXWH 1KB9I 1LGHB 2E74C 1FZGA 2ZVOB 3HD7C 2NPSB 3CCQP 1NO4A 1PGOA 3PJSK 4D6TJ 3D71A 1K05A 3E1IA 3II6A 2E75B 1VQOP 1ZMEC 2R3CA 4GOEA 1GXHA 5HVCA 3IF4A 1E6JP 1E5WA 2C9LY 1BE3J 3G21A 4UB6H 2JJLA 5KAFE 1Z56A 2HODB 5HV8A 2R5DA 1E0HA 1E79H 2RN0A 3DS3A 3L70E 2WTYA 2A06G 4IFMA 2LIWA 2Q3IA 3JCUE 2OYHA 5CCGC 2K9JB 1DV5A 3MUDA 2CPSA 1SQPE 4JQ0D 2NZ2A 1IMPA 3CLQA 4GODA 1JCDA 1RO0A 2PFXA 2RKLA 4WBAA 3A5TA 1NHLA 2E43A 4KT0J 3BCCG 5AVXB 2YXRB 3BASA 2PEJA 1LWUA 4XRQA 1A02F 2QM7A 3H1HD 1ZMBA 1PGJA 2P1JA 2M3EA 1SQVD 1Y8AA 1PEUA 4JBZA 4QNBA 4TT3H 1LT9C 1LTAC 1KFMA 2FVFA 2N98A 2PGDA 1AA0A 1QRJA 2XU6A 2WMMA 3CCMP 1IMQA 4UB8H 5GTIE 5CJ4A 1SP4A 3CX5D 4M0IA 3MUDC 3A0BH 4PD4D 2AVAA 1VL2A 4ZKUA 4EOTA 4BPFA 1KZUB 2KXPB 3L35A 3PP5A 1SFCC 1KILC 1EZVD 1LTJC 5KLVD 5TISH 1GDTA 2O01N 1NKZB 3P8CD 1EDKA 3G0VA 4ZKPA 3B5NA 1URQC 3DS4A 1NTMD 2Z4EA 2KI7B 1NOHA 4XFZA 3O6QA 3VRLC 2K88A 4AQRD 1PV3A 4U3FJ 1SQQK 1CW5A 1P84H 2EG5A 2VLNA 1S9KE 2OTJP 1IFJA 2LOLA 1FS0E 4XFYA 3L36A 1EQ7A 1DD4A 1Q86Q 1YITP 1RE4C 1DD3A 3RK3C 2KODA 1OWAA 4LLHA 1HJ0A 4R0MA 2K9YA 2KGCA 4C7NA 3V6IA 2KG6A 2FYUK 2XV5A 1VDFA 2KLVA 2DNWA 4IPYA 5H2FH 1NTMK 2GDWA 1KYOD 1PL5A 2OARA 2FHSC 1FU1A 2W27A 4JYBA 1NAFA 2V7QJ 3ITKA 5CHXA 1D1DA 1PGQA 2GUSA 2WSEJ 4H0LC 2A45H 2XZRA 3GKLC 4K35A 2O3JA 1KILE 4PJ0H 2KS1B 2WT7A 5AW0B 1RF1C 2VLQA 1BXIA 1M1JB 2QEXP 3FGAD 3AEBC 1JY3P 4WWIA 2FBWC 2K5XA 4L74A 2W90A 3VP8A 1HY8A 1CI6A 3JSVC 2KNCB 3H1HE 1OW6A 5DJUB 5AW8B 1EDJA 4WY4A 4IOIH 3C1LA 1NU1G 1SQQG 2N9YB 1LT9A 4MRTC 1HVVA 3VYIA 1USDA 3H1HJ 4N6JA 4IL6E 3S1KA 1KB9D 1MZ8A 1SQVE 3KZIH 4UB6E 1RQUA 3CE7A 3Q2YA 1NU1D 3B4SA 1RH5B 1ZRTE 3CCVP 3L75E 5DJTB 3S4RA 5CBNA 3CX5I 2QJYB 2ZYDA 1YJNP 4GDOA 4PV1D 2PEKA 2AXTE 1X0TA 1LTJB 3MHVA 3CMEP 3HUSB 2Z44A 4OH8B 1URQA 3M0DC 1IFMA 1SQBE 1S2EA 1URQD 1AV1A 5APQA 1HQBA 1K04A 2JO0A 2C0XA 1KQFB 2KWLA 3VN0A 1MV8A 2H8PD 1G2CA 1IFDA 2Y9ZA 1YTZT 3G4SP 2JO1A 3PRJA 2W6JH 3VMYA 2L91A 1PP9D 3AE8C 1QGKB 3WBHA 5AW4B 2H89C 5B66E 1JO5A 2KG9A 1VF5C 1LP1B 1RHZB 2MKVA 3MZWB 2JDIH 5AVTB 4PH0A 1YHQP 1GW3A 5CCHD 1S72P 2FQ0A 2P2UA 5KLVE 1KYOE 2ZFCA 2FYUG 3OW2O 2R44A 2H7HA 3BRVB 1SVFA 2OYIA 2W6AA 2WSCH 1NTMG 4WVZA 2B9BA 1L2PA 3L73E 2QM8A 4XFXA 3H1KE 4W7YA 1L0LG 4OVNF 1GW4A 5B5EH 2YXQB 2LR2A 4IL6X 1RQVA 5AW3B 3EJEA 4NEOA 3H6PA 4GOFA 3L75J 2C9NY 2PAJA 5KAIE 5AVVB 3L74J 4I1LA 1PFIA 3NY7B 3AECC 2KZIA 5BS2A 3EJBA 4OGQC 4A7PA 4COCA 1KILD 3MP7B 2K94A 4U0FA 2QVAA 1A43A 2M8RA 2Y0DA 1GD2E 1FBMA 3C8VA 3SSUA 4HB1A 1FE6A 2IPPA 1SQXD 1A02J 4L73A 2DGYA 1SQVG 3H47A 3H1IJ 5APSA 1J1DC 3MGEA 3HE5A 3H1LG 4DG9A 1DEBA 4Y99B 1VQ5P 3CX5E 1FJPA 2QJYC 1HGVA 5KKZB 2WT7B 1QVFO 1IK7A 2PEIA 4BRYB 2UWJE 4ZMDA 5CCGA 4PH1A 1N7SA 2L6EA 3DS5A 1IFPA 1OMIA 3G3ZA 2IBZE 3S9OA 3V2RA 2L0QA 2K1AA 3RK3B 4Y28J 1M56D 3WU2H 7CEIA 1FDMA 3M0DA 3U59A 5AVYB 4NPEA 3AE5C 2IDBA 1N8RQ 1OIPA 3G1IA 1NU1K 2K3RA 2YMYA 5B5EE 2I8DA 5JPAA 1JMBA 3VMAA 3PLNA 2KSEA 2N5IA 1RF1B 3H4EA 1OX3A 3W68A 1X9VA 2GM4A 3G28A 4CPGA 2CQ8A 2KZJA 4DCKA 4YTPC 2J5UA 1M7LA 1ZRTD 1LTIC 2Q3EA 2JQ4A 1NQ4A 1T3UA 3LRYA 1WRGA 2ZVNB 1VQ4P 2L5GB 2HODA 5CJ0A 3L74G 3L74E 2PY8A 2N50A 3LW5H 1DIPA 2JB0A 2ZAEB 3H1JG 1L0LJ 1U7MA 3TGUD 3WMM0 2YKQA 2I1JA 4R4LA 2MF4A 1NAYA 2Y0CA 1L0ND 2ZT9B 3H1HG 1GL2C 3CC2P 1AUMA 3F5HA 2K92A 4OWFA 3BCCD 1BCCJ 4MN4C 1FZCB 1NH4A 3HRNA 1HGZA 2FXPA 3D6YA 2BCCG 2BCCE 1NGMB 2K37A 3TF5A 3GHGA 1SQPJ 2QNWA 2E74D 1T6AA 2JR8A 3H1ID 1MFTA 2BCCJ 3AEFC 1GK4A 1K30A 2A06D 2N1TD 3AE4C 3P8MC 2K0DX 1LNQA 5CZDB 2WPQA 4BWNA 1F80D 1T8KA 2E5TA 1NTZD 3QH9A 1JOCA 3G1GA 3JC22 2WITA 5AVSB 1S5LH 1OFCX 3HD7A 1L4AC 2MJZA 3L70D 3Q5PA 1EZVI 4W7ZA 4IL6H 2B88A 2QJKC 1NTKE 5APUA 2M5AA 3HTKA 3H32A 4ASWA 2M8LA 1PP9J 1L0LK 5HGLA 2BEQD 2GZEA 4UHPB 1N86A 1YBKA 1VKUA 5KAIH 1YQ3C 3E7KA 1SLQA 3V2NA 2KUBA 1W2EA 1KILA 2ZT9C 2QG4A 1FOSF 3RL0B 2WPSA 2OQQA 2OYIB 3N7NA 4GR2A 4U3FG 1OXZA 4YXDC 2ZYAA 2HG5D 1OVVA 2RMZA 1M6EX 1Y47A 1HBWA 3RK2B 2GYKA 3PTZA 1KYOI 1JTHB 2D2CC 2AEJA 2EFJA 2WPVB 3O8ZA 3VMZA 3L71G 4DZOA 5H2FE 1KYOH 4KHXA 4B86A 3SWKA 1VQPP 1KQSO 1N7LA 3AEAC 3DS2A 1BDCA 3LMOA 3RL0D 5APXA 2CPBA 2IBZG 5CBOA 2JU1A 1U7JA 4XROA 1HUCA 1URQB 1GL2A 1PGPA 3UIAA 4EDFA 2QIWA 2FXMA 4WY4D 3ZDMA 1Q2NA 1VQ8P 3AE2C 2KB7P 3VMXA 2CNRA 4PV1B 1G2CB 3RGUA 4M3LA 1YTZI 2ROQA 2IFMA 3TDKA 2M5AB 2O1KA 3H1IG 3RBXA 2HLOA 4H0LD 1X8YA 2GZIA 2WPRA 1NYHA 2FQ1A 3P7KA 2X2BA 1X3OA 3H0DA 3SWYA 4XE5B 2CG5B 2P67A 1JUNA 2KOPA 3N4XA 3L72D 5KLVK 1ZOYC 2PP6A 3HE4B 1NTZJ 3CPWO 2JWAA 3A3YB 2KG8A 1BCCG 3CCRP 5EW5E 4UB8E 1FOSE 1GMJA 1NTKK 2AFEA 3AE3C 1NTZE 3KZIE 1L0NG 4IZ6A 1MKMA 3L73G 3TGUG 2H88C 2IYPA 3H1JJ 1HWTC 3VOPA 2LF4A 3H25A 3H1KD 1K73Q 1VQLP 1BE3G 2FYZA 2YNYA 3VP9A 1SQXK 1SFCA 3TGUE 1NTMJ 1JMMA 2XZ1C 3H1JE 2D2CB 1EXIA 3E2DA 2N6YA 4H44C 1VPCA 2PNGA 2E76D 3AE7C 1ZLLA 4RKUJ 2CK3H 3M1MA 3B5NC 4GR6A 3M06A 2OYIC 4H2WC 1VF5D 1BE3D 1YQ4C 3RG6C 2M5RA 3JCUH 1KLPA 2WSSH 3OAKA 1HH0A 4RO0A 3P05A 1LTSC 2Y0EA 1IC2A 3GLMA 2GDXA 2D2CD 3D70A 1WT6A 1LT1A 4H2YC 2IBZI 4Z1MH 1RF0C 1W2BO 1M1KQ 5HGOA 2EHTA 3VTPC 3EFFK 1T2KC 3Q20A 5TJHA 2M3BA 3MTUE 2FVEA 3TYYA 5F2KA 4JPZB 2MR8A 2JP3A 4H44B 2QE7H 3LW5J 4U0DA 1FR2A 5KP6B 2BUOA 2FKWB 3CMAP 2XKMA 2G8YA 1QLED 2YO3A 1KQGB 2BASA 3ABVC 3H1LD 5TISE 4C7RA 4BPGA 2JU2A 1BE3E 1FDIA 3MIWA 1H8AA 1MFZA 1SQXG 3L73J 3F89A 1NU1E 1JCCA 4PXHB 2L22A 3NTNA 2KGAA 5I4TG 2KLUA 4OGQB 3TNUA 3M91A 1AVYA 1NU1J 2KGDA 2A45I 1VF5B 3KYQA 4L76A 3A0BE 3KHUA 2ZT9D 5HGNA 3L75G 2KIKA 1KILB 1L0LE 5GTIH 1TU3F 4HH2A 3L71D 2FYNB 2KW2A 4WB4A 2GA1A 2N6ZA 2HR3A 3EFGA 1H0TA 2LXBA 2YIUB 5AW1B 2Q1KA 1SQQE 2BQ1E 2FAEA 2OYHB 1GK6A 1JTHA 4U3FD 1CEIA 1BSHA 1PEQA 3M0AA 3MD0A 2FYUD 1H88A 2P10A 1J2JB 3FXDA 1RNIA 4R4MA 4AUWA 4HJGH 4QMAA 4DT0A 1QVGO 2K2QA 1PP9G 1S5LX 2M8PA 2R5BA 4OGQD 5BU8B 4H0LB 1AFOA 2FQ2A 1RF0A 4H44D 3L70G 3CXHI 3CCEP 2HYNA 2Z5IA 2XV6A 1NTZG 3RK3D 5KAFH 3CL3D 5KKZC 2E1MA 4L75A 4EI2A 3I5CA 4N78D 1GTWA 5M1BA 1KORA 1LP1A 3WUVA 1K8AQ 4ZNCA 1LT9B 2NRGA 4BXLA 2GUVA 2WSCJ
chains in the Genus database with same CATH topology
1N8RQ 2Z46A 2OTLP 3G71P 1VQMP 3M1MA 1BAJA 3CC7P 3G1IA 4GR6A 5HGNA 1M74A 3G0VA 1K30A 4U0CA 1VQ9P 1Q82Q 3G26A 3DS4A 4XROA 5JPAA 2Z45A 3DS3A 3RG6C 3G1GA 4XFZA 2PEOA 3VRLC 3I56P 3DPHA 3H4EA 4XFXA 4U0EA 1JJ2O 1KD1Q 3CCUP 3P05A 1VQ7P 3CCJP 3G28A 2EG5A 3CCVP 3G6EP 1VQ6P 2OTJP 2XXMA 5HGMA 1VQ8P 1RO2A 2CWOA 4WYMA 1KC8Q 3DS1A 1YJWP 3NTEA 3G29A 2ONTA 1YJNP 4XFYA 1YJ9P 2BQ1E 1RO0A 5F2OA 5BS1A 1W2BO 1M1KQ 1VQNP 3B5IA 5HGOA 2M8LA 1Q86Q 3CD6P 1YITP 2KODA 3Q20A 3LRYA 2PEMA 2M8NA 1NJIQ 1PEQA 1EIAA 5BS2A 5HGLA 1K9MQ 2PEKA 4U0BA 1IUQA 1VQ4P 1VQKP 5DCKA 5F2KA 4COCA 1YIJP 4IPYA 3H0DA 2PEJA 2PY8A 2JYGA 3CMEP 3CCLP 2PEQA 4XRQA 4U0FA 2Z44A 1RNIA 1A43A 1ZMBA 2OARA 4COPA 2XT1A 1PEUA 3CPWO 4QNBA 4U0DA 3CC4P 3DTJA 5F2NA 2DGYA 2BUOA 3CCRP 1QVGO 3H47A 4GR2A 1Q81Q 3MGEA 1D1DA 2JO0A 3CMAP 2M8PA 2QA4P 1QRJA 1EOQA 3DS0A 3I55P 1M6NA 1VQ5P 2EIAA 3CCMP 1PEOA 1PEMA 1M6EX 1QVFO 3CC2P 1AUMA 2PEIA 3CCSP 2PENA 4U0AA 3G4SP 2P9XA 4M0IA 4PH1A 3CCQP 3CCEP 2EFJA 3WBHA 2L6EA 2JYLA 3HZQA 3DS5A 2LF4A 3HYBA 2XV6A 2QEXP 1K73Q 1VQLP 1YI2P 2E1MA 1VQOP 1VQPP 1E6JP 4PH0A 1YHQP 1KQSO 1S72P 3G21A 5I4TG 1K8AQ 1M90Q 3E2DA 3DS2A 2BHVA 1A8OA 3CXCO 1Q7YQ 3OW2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R Q;  1KC8 Q;  1YJW P;  2OTL P;  3G71 P;  3CCQ P;  1VQM P;  1YJN P;  3CCE P;  3CC7 P;  1YJ9 P;  1W2B O;  1VQN P;  3CPW O;  1M1K Q;  1VQ9 P;  1Q82 Q;  1Q86 Q;  2QEX P;  3CC4 P;  3CD6 P;  1YIT P;  1QVG O;  1K73 Q;  3CCR P;  1VQL P;  1YI2 P;  1VQO P;  1Q81 Q;  1VQP P;  1NJI Q;  3CMA P;  2QA4 P;  1K9M Q;  3I56 P;  1JJ2 O;  1KD1 Q;  1YHQ P;  1KQS O;  1S72 P;  3I55 P;  1VQ4 P;  3CCU P;  1VQK P;  1VQ5 P;  1K8A Q;  3CCM P;  1M90 Q;  1YIJ P;  1VQ7 P;  3CCJ P;  1QVF O;  3CCV P;  3CC2 P;  3G6E P;  3CME P;  1VQ6 P;  2OTJ P;  3CCS P;  3CCL P;  1VQ8 P;  3CXC O;  1Q7Y Q;  3OW2 O;  3G4S P; 
#chains in the Genus database with same CATH topology
 1SQX E;  4U3F E;  3V4Q A;  2QSI A;  1J1D B;  3QWO C;  1OW8 A;  5GTH H;  3E1R A;  4U7J A;  1BGY G;  1IFN A;  1GU5 A;  2MVV A;  3I56 P;  1SQX J;  2OYH C;  3PH0 A;  4NPF X;  5AVW B;  3CWB J;  1VQ7 P;  2FY8 A;  1NTZ K;  2SPZ A;  4C46 A;  4I2L C;  4IFF A;  3G29 A;  2ONT A;  3NFQ A;  5BS1 A;  2WZ7 A;  5K5G B;  1H89 A;  1SQB K;  1NWQ A;  3H1J D;  2GZJ A;  2JWD A;  1SQQ J;  1KB9 H;  1IK9 A;  3R4Y A;  2MVU A;  5AVR B;  3GF7 A;  1VQK P;  2LL8 A;  1AJY A;  3TSI A;  3BVH A;  3IR9 A;  2KOG A;  1R5L A;  1AQ5 A;  3L74 D;  3L71 J;  1EMV A;  2N1T A;  2GDY A;  5L8R J;  1SS1 A;  1JB0 J;  4H13 D;  1NVO A;  1L4A D;  2VLO A;  3L71 E;  2WSF H;  3L72 J;  1W5C E;  1ZW0 A;  3M9Q A;  1N73 B;  5AW9 B;  2FAD A;  2MD9 A;  3CCS P;  1GL2 B;  3IAO A;  1DNY A;  1SFC B;  2ZYG A;  4JF7 A;  3A0H H;  2O01 J;  2YMK A;  1USE A;  3L72 E;  2KNC A;  1KQL A;  2L9F A;  3HYB A;  2KOS A;  5KLV J;  3R2P A;  2WVR A;  2DW3 A;  2G3A A;  3PHL A;  1UJZ A;  5AW7 B;  2ZXX A;  3EQ2 A;  1NTK D;  1A8O A;  4N78 E;  5AW2 B;  4LGD E;  1EC5 A;  3CXC O;  2IZ1 A;  2VSQ A;  2N1T B;  3G71 P;  1EDL A;  3RG2 A;  1D7M A;  4CA3 A;  2LML A;  2JEE A;  1L0N K;  2ERH A;  3LIE A;  4NPD A;  1G1J A;  2A06 E;  1OVR A;  4U0E A;  3V4W A;  2WSE H;  3TGU J;  3U1C A;  2H43 A;  3CCJ P;  2YO2 A;  3H1L E;  4HKG A;  2KOR A;  2KGE A;  2JAZ A;  1ZV8 A;  2Q7C A;  1QL2 A;  1S9K D;  3CWB E;  1VQN P;  1JY2 N;  1PZQ A;  1CI6 B;  1OR5 A;  1NJI Q;  5APT A;  1LWU B;  3AE6 C;  1NTM E;  1GU4 A;  5DCK A;  4LC1 A;  2W8Z A;  1EXJ A;  3CCL P;  2PEQ A;  1UIX A;  4PD4 E;  2XT1 A;  2Y9Y A;  2E42 A;  3W67 A;  1UII A;  5E79 H;  3CWB G;  5F2N A;  2YKP A;  3HD7 B;  3CWB D;  1S1C X;  3A7O A;  1Y9B A;  5EFW B;  3GW6 A;  5CCH C;  3EWK A;  1M6N A;  2RH0 A;  1PEM A;  5BU5 A;  1N7S B;  3RL0 C;  3OJA B;  2PEN A;  2XND H;  1L0L D;  2LIU A;  1HJB A;  3Q1M A;  3MGN A;  4XFJ A;  3SFE C;  5KLI C;  4K3A A;  1DH3 A;  1L0N J;  1M1J C;  1P84 I;  4GKG A;  1M1J A;  3KXD A;  4XA4 A;  5CCG D;  3GMA A;  1FZB A;  1BDD A;  1S3J A;  3BCC J;  3M9B A;  1MZ9 A;  2L4B A;  3EJD A;  3L37 A;  1VQM P;  5AVZ B;  3FWL A;  4EYY Q;  1VQ9 P;  3BAT A;  3CXH H;  1FZA A;  1X79 B;  1IJD B;  3CXH D;  1JJ2 O;  1T3J A;  4PV1 C;  1KD1 Q;  2AXC A;  3CCU P;  2AF8 A;  3L4F A;  2XXM A;  4GIF A;  1NTK G;  2B89 A;  2E76 C;  1G1I A;  5F2O A;  3RBZ A;  3B5I A;  3GG2 A;  2C0W A;  1JY3 O;  1N2D C;  1SQV K;  3H32 B;  3B4Q A;  5KP8 B;  3CI9 A;  2PEM A;  2M8N A;  1K9M Q;  1S5L E;  1SFC D;  2KSJ A;  3Q5R A;  2QJP B;  4U0B A;  1R5S A;  5APY A;  5AVQ B;  4RJT A;  2N5H A;  5CMZ A;  3HUS C;  1FZF A;  3HUS A;  2JBG A;  4F37 A;  3SWF A;  1Q81 Q;  4H2X C;  4KJM A;  1PIX A;  2EIA A;  1BCC E;  2KOO A;  2LPK A;  2V7Q H;  3V2P A;  4DOJ A;  1BGY E;  2MR7 A;  2FYN C;  3AE1 C;  2MY5 A;  2JYL A;  4BRY A;  5AW6 B;  3BRT B;  1ZR4 A;  4ASV A;  3GHG B;  1LJ2 A;  2ZJS E;  5APW A;  3A2A A;  4WY4 C;  2BHV A;  3HE4 A;  1SQQ D;  1RE3 C;  2AFD A;  2IZ0 A;  3RL0 g;  1RE3 A;  3CC7 P;  1M74 A;  1Q82 Q;  1BGY D;  2KK7 A;  1XTG B;  1DEE G;  1EDI A;  1GPJ A;  1L4A A;  3CXH E;  4W80 A;  1DX7 A;  2QJP C;  1PPJ E;  1YJ9 P;  3GJN A;  1GZL A;  4D6T E;  4HYT B;  2KS1 A;  4DJG A;  2R3S A;  1EIA A;  1FC2 C;  3P32 A;  2Q6Q A;  3T97 B;  1FDO A;  2J59 M;  2BEZ F;  2OGU A;  3NMD A;  4COP A;  3Q5S A;  5AVU B;  2N1T C;  2XDJ A;  1PPJ G;  2J58 A;  1ACP A;  3GZM A;  2NO8 A;  4D6T D;  2WQY C;  1FAV A;  1S4X A;  3B71 A;  3USS A;  5E79 E;  1M8O B;  1WMK A;  2W83 C;  1Z6M A;  2KR5 A;  1JNM A;  2P7J A;  1HF9 A;  1J1E B;  2JGP A;  2FFD B;  4I7Z B;  3U1A A;  2NPS A;  2FAC A;  1HTL C;  1ZR2 A;  3GZL A;  2B87 B;  2NPS C;  2YKO A;  1AYI A;  1FZC A;  1M90 Q;  5KLV G;  2HFE D;  1JY2 P;  1VHN A;  2ZXE B;  1Q7Y Q;  1EZV G;  2K93 A;  3TK1 A;  1BSN A;  1BAJ A;  2Q5U A;  1JM0 A;  1ZN5 A;  2KOQ A;  2Z45 A;  1N7S D;  1ZXG A;  1NTK J;  1FZE A;  2PEO A;  3L75 D;  2GZG A;  5EJD A;  1CZQ A;  4EIJ A;  1LTT C;  3FXE A;  2OTK E;  1RF1 A;  1SQP K;  1VQ6 P;  1PP9 E;  3AE9 C;  3DS1 A;  1EZV E;  3H1K G;  1KMI Z;  2P58 A;  1N73 A;  2E5Y A;  1N73 C;  1MUU A;  1SQV J;  1GXG A;  3TNU B;  3L73 D;  1P84 D;  2VRS A;  5KJ7 D;  2XZ0 D;  1SQB D;  2E75 C;  3KQG A;  2CGQ A;  3FX0 A;  3A0H E;  3IFM A;  2N9B A;  1LTB C;  1KN7 A;  1JEK A;  4WY4 B;  1SQP G;  3SFD C;  4YPC A;  5BVZ A;  3GF3 A;  2LKI A;  1L0H A;  3HTK B;  5B66 H;  1RY3 A;  3AEG C;  4U0A A;  3WUU A;  2LKM A;  2WSF J;  2KP8 A;  1ZNV A;  4BPH A;  1SQP D;  3G9R A;  3HZQ A;  3OA7 A;  1R8E A;  1YI2 P;  2KYV A;  3C9I A;  2Z5H A;  4H13 B;  1QX8 A;  4HKZ H;  1SQB G;  1UNK A;  1FZC C;  2B87 A;  2FFD C;  3NXS A;  2HPC A;  2Z46 A;  1LWU C;  3V2Q A;  4O9B A;  4U0C A;  2IYO A;  2QJK B;  2E74 B;  3WUT A;  5APV A;  3FWN A;  2AXT H;  2HPC B;  4IFD K;  3WU2 E;  1L4A B;  2IBZ D;  3DPH A;  2IFN A;  5KTB A;  4TLF A;  3B5N B;  3G6E P;  1OW7 A;  5HGM A;  2CWO A;  2VLP A;  3O6Q B;  1KC8 Q;  2WWW A;  1AVO A;  4PD4 H;  4AYC A;  3CD6 P;  2K0Y A;  2LXC B;  3CX5 H;  1N7S C;  2XNX A;  3M9H A;  1M57 D;  3T97 A;  3IN6 A;  2EHS A;  4N3Y B;  3LID A;  4PD4 I;  2FVA A;  1YIJ P;  2JYG A;  2FYU E;  3HD7 D;  3HE5 B;  4I7Z C;  3B5N D;  3RK3 E;  2K0X A;  2I1K A;  5AW5 B;  3B8E B;  3D6Z A;  3DTJ A;  1KFN A;  4JYC A;  1U57 A;  1JY2 O;  1BCC D;  4Y99 C;  2GZF A;  1CSB A;  1EOQ A;  1PEO A;  5CCH A;  2A45 G;  3KPE A;  3L72 G;  3V5B A;  2P9X A;  2AEM A;  4D6T G;  4PJ0 E;  3AED C;  2YIU C;  2POH A;  4PWV B;  1Q90 D;  2K9J A;  1OVU A;  1YYC A;  1PPJ D;  3K5B A;  4C7N B;  1T2K D;  3RK2 C;  2R32 A;  1ZP0 C;  1RE4 A;  3GHG C;  4QKO A;  5KJ7 C;  5C39 A;  3H1L J;  1QEX A;  1GL2 D;  2OYO A;  3L70 J;  1FJK A;  2QRX A;  2OTL P;  1SQB J;  2ITA A;  1JY3 N;  5KP7 B;  1LTG C;  1KTM A;  2Q9I A;  2IX7 C;  3G26 A;  3H1I E;  1H0T B;  2O01 H;  2AEF A;  1J1E C;  1AQT A;  1L0I A;  1IZN B;  2WPT A;  2BCC D;  2O1J A;  2E75 D;  1RO2 A;  4WYM A;  1YJW P;  1BGY J;  3NTE A;  2JKV A;  4I6M C;  1IFI A;  2LTE A;  1X22 A;  2PRR A;  3U43 A;  2FXO A;  1P84 E;  1L0N E;  2W6B A;  3P8C E;  1IO4 A;  3RK2 D;  5KLI B;  4H13 C;  1T8Z A;  1QL1 A;  2FFD A;  1KB9 E;  2NPS D;  1IUQ A;  1OZH A;  3AEE C;  3BCC E;  4GT1 A;  5KJ7 A;  3KDP B;  1LTJ A;  1XTC C;  3CC4 P;  2FYU J;  1KV4 A;  3Q3D A;  2E76 B;  2M0B A;  2QA4 P;  3H1K J;  4RES B;  2V4H A;  3DS0 A;  3I55 P;  1AF8 A;  1NKN A;  5GTH E;  4YXW H;  1KB9 I;  1LGH B;  2E74 C;  1FZG A;  2ZVO B;  3HD7 C;  2NPS B;  3CCQ P;  1NO4 A;  1PGO A;  3PJS K;  4D6T J;  3D71 A;  1K05 A;  3E1I A;  3II6 A;  2E75 B;  1VQO P;  1ZME C;  2R3C A;  4GOE A;  1GXH A;  5HVC A;  3IF4 A;  1E6J P;  1E5W A;  2C9L Y;  1BE3 J;  3G21 A;  4UB6 H;  2JJL A;  5KAF E;  1Z56 A;  2HOD B;  5HV8 A;  2R5D A;  1E0H A;  1E79 H;  2RN0 A;  3DS3 A;  3L70 E;  2WTY A;  2A06 G;  4IFM A;  2LIW A;  2Q3I A;  3JCU E;  2OYH A;  5CCG C;  2K9J B;  1DV5 A;  3MUD A;  2CPS A;  1SQP E;  4JQ0 D;  2NZ2 A;  1IMP A;  3CLQ A;  4GOD A;  1JCD A;  1RO0 A;  2PFX A;  2RKL A;  4WBA A;  3A5T A;  1NHL A;  2E43 A;  4KT0 J;  3BCC G;  5AVX B;  2YXR B;  3BAS A;  2PEJ A;  1LWU A;  4XRQ A;  1A02 F;  2QM7 A;  3H1H D;  1ZMB A;  1PGJ A;  2P1J A;  2M3E A;  1SQV D;  1Y8A A;  1PEU A;  4JBZ A;  4QNB A;  4TT3 H;  1LT9 C;  1LTA C;  1KFM A;  2FVF A;  2N98 A;  2PGD A;  1AA0 A;  1QRJ A;  2XU6 A;  2WMM A;  3CCM P;  1IMQ A;  4UB8 H;  5GTI E;  5CJ4 A;  1SP4 A;  3CX5 D;  4M0I A;  3MUD C;  3A0B H;  4PD4 D;  2AVA A;  1VL2 A;  4ZKU A;  4EOT A;  4BPF A;  1KZU B;  2KXP B;  3L35 A;  3PP5 A;  1SFC C;  1KIL C;  1EZV D;  1LTJ C;  5KLV D;  5TIS H;  1GDT A;  2O01 N;  1NKZ B;  3P8C D;  1EDK A;  3G0V A;  4ZKP A;  3B5N A;  1URQ C;  3DS4 A;  1NTM D;  2Z4E A;  2KI7 B;  1NOH A;  4XFZ A;  3O6Q A;  3VRL C;  2K88 A;  4AQR D;  1PV3 A;  4U3F J;  1SQQ K;  1CW5 A;  1P84 H;  2EG5 A;  2VLN A;  1S9K E;  2OTJ P;  1IFJ A;  2LOL A;  1FS0 E;  4XFY A;  3L36 A;  1EQ7 A;  1DD4 A;  1Q86 Q;  1YIT P;  1RE4 C;  1DD3 A;  3RK3 C;  2KOD A;  1OWA A;  4LLH A;  1HJ0 A;  4R0M A;  2K9Y A;  2KGC A;  4C7N A;  3V6I A;  2KG6 A;  2FYU K;  2XV5 A;  1VDF A;  2KLV A;  2DNW A;  4IPY A;  5H2F H;  1NTM K;  2GDW A;  1KYO D;  1PL5 A;  2OAR A;  2FHS C;  1FU1 A;  2W27 A;  4JYB A;  1NAF A;  2V7Q J;  3ITK A;  5CHX A;  1D1D A;  1PGQ A;  2GUS A;  2WSE J;  4H0L C;  2A45 H;  2XZR A;  3GKL C;  4K35 A;  2O3J A;  1KIL E;  4PJ0 H;  2KS1 B;  2WT7 A;  5AW0 B;  1RF1 C;  2VLQ A;  1BXI A;  1M1J B;  2QEX P;  3FGA D;  3AEB C;  1JY3 P;  4WWI A;  2FBW C;  2K5X A;  4L74 A;  2W90 A;  3VP8 A;  1HY8 A;  1CI6 A;  3JSV C;  2KNC B;  3H1H E;  1OW6 A;  5DJU B;  5AW8 B;  1EDJ A;  4WY4 A;  4IOI H;  3C1L A;  1NU1 G;  1SQQ G;  2N9Y B;  1LT9 A;  4MRT C;  1HVV A;  3VYI A;  1USD A;  3H1H J;  4N6J A;  4IL6 E;  3S1K A;  1KB9 D;  1MZ8 A;  1SQV E;  3KZI H;  4UB6 E;  1RQU A;  3CE7 A;  3Q2Y A;  1NU1 D;  3B4S A;  1RH5 B;  1ZRT E;  3CCV P;  3L75 E;  5DJT B;  3S4R A;  5CBN A;  3CX5 I;  2QJY B;  2ZYD A;  1YJN P;  4GDO A;  4PV1 D;  2PEK A;  2AXT E;  1X0T A;  1LTJ B;  3MHV A;  3CME P;  3HUS B;  2Z44 A;  4OH8 B;  1URQ A;  3M0D C;  1IFM A;  1SQB E;  1S2E A;  1URQ D;  1AV1 A;  5APQ A;  1HQB A;  1K04 A;  2JO0 A;  2C0X A;  1KQF B;  2KWL A;  3VN0 A;  1MV8 A;  2H8P D;  1G2C A;  1IFD A;  2Y9Z A;  1YTZ T;  3G4S P;  2JO1 A;  3PRJ A;  2W6J H;  3VMY A;  2L91 A;  1PP9 D;  3AE8 C;  1QGK B;  3WBH A;  5AW4 B;  2H89 C;  5B66 E;  1JO5 A;  2KG9 A;  1VF5 C;  1LP1 B;  1RHZ B;  2MKV A;  3MZW B;  2JDI H;  5AVT B;  4PH0 A;  1YHQ P;  1GW3 A;  5CCH D;  1S72 P;  2FQ0 A;  2P2U A;  5KLV E;  1KYO E;  2ZFC A;  2FYU G;  3OW2 O;  2R44 A;  2H7H A;  3BRV B;  1SVF A;  2OYI A;  2W6A A;  2WSC H;  1NTM G;  4WVZ A;  2B9B A;  1L2P A;  3L73 E;  2QM8 A;  4XFX A;  3H1K E;  4W7Y A;  1L0L G;  4OVN F;  1GW4 A;  5B5E H;  2YXQ B;  2LR2 A;  4IL6 X;  1RQV A;  5AW3 B;  3EJE A;  4NEO A;  3H6P A;  4GOF A;  3L75 J;  2C9N Y;  2PAJ A;  5KAI E;  5AVV B;  3L74 J;  4I1L A;  1PFI A;  3NY7 B;  3AEC C;  2KZI A;  5BS2 A;  3EJB A;  4OGQ C;  4A7P A;  4COC A;  1KIL D;  3MP7 B;  2K94 A;  4U0F A;  2QVA A;  1A43 A;  2M8R A;  2Y0D A;  1GD2 E;  1FBM A;  3C8V A;  3SSU A;  4HB1 A;  1FE6 A;  2IPP A;  1SQX D;  1A02 J;  4L73 A;  2DGY A;  1SQV G;  3H47 A;  3H1I J;  5APS A;  1J1D C;  3MGE A;  3HE5 A;  3H1L G;  4DG9 A;  1DEB A;  4Y99 B;  1VQ5 P;  3CX5 E;  1FJP A;  2QJY C;  1HGV A;  5KKZ B;  2WT7 B;  1QVF O;  1IK7 A;  2PEI A;  4BRY B;  2UWJ E;  4ZMD A;  5CCG A;  4PH1 A;  1N7S A;  2L6E A;  3DS5 A;  1IFP A;  1OMI A;  3G3Z A;  2IBZ E;  3S9O A;  3V2R A;  2L0Q A;  2K1A A;  3RK3 B;  4Y28 J;  1M56 D;  3WU2 H;  7CEI A;  1FDM A;  3M0D A;  3U59 A;  5AVY B;  4NPE A;  3AE5 C;  2IDB A;  1N8R Q;  1OIP A;  3G1I A;  1NU1 K;  2K3R A;  2YMY A;  5B5E E;  2I8D A;  5JPA A;  1JMB A;  3VMA A;  3PLN A;  2KSE A;  2N5I A;  1RF1 B;  3H4E A;  1OX3 A;  3W68 A;  1X9V A;  2GM4 A;  3G28 A;  4CPG A;  2CQ8 A;  2KZJ A;  4DCK A;  4YTP C;  2J5U A;  1M7L A;  1ZRT D;  1LTI C;  2Q3E A;  2JQ4 A;  1NQ4 A;  1T3U A;  3LRY A;  1WRG A;  2ZVN B;  1VQ4 P;  2L5G B;  2HOD A;  5CJ0 A;  3L74 G;  3L74 E;  2PY8 A;  2N50 A;  3LW5 H;  1DIP A;  2JB0 A;  2ZAE B;  3H1J G;  1L0L J;  1U7M A;  3TGU D;  3WMM 0;  2YKQ A;  2I1J A;  4R4L A;  2MF4 A;  1NAY A;  2Y0C A;  1L0N D;  2ZT9 B;  3H1H G;  1GL2 C;  3CC2 P;  1AUM A;  3F5H A;  2K92 A;  4OWF A;  3BCC D;  1BCC J;  4MN4 C;  1FZC B;  1NH4 A;  3HRN A;  1HGZ A;  2FXP A;  3D6Y A;  2BCC G;  2BCC E;  1NGM B;  2K37 A;  3TF5 A;  3GHG A;  1SQP J;  2QNW A;  2E74 D;  1T6A A;  2JR8 A;  3H1I D;  1MFT A;  2BCC J;  3AEF C;  1GK4 A;  1K30 A;  2A06 D;  2N1T D;  3AE4 C;  3P8M C;  2K0D X;  1LNQ A;  5CZD B;  2WPQ A;  4BWN A;  1F80 D;  1T8K A;  2E5T A;  1NTZ D;  3QH9 A;  1JOC A;  3G1G A;  3JC2 2;  2WIT A;  5AVS B;  1S5L H;  1OFC X;  3HD7 A;  1L4A C;  2MJZ A;  3L70 D;  3Q5P A;  1EZV I;  4W7Z A;  4IL6 H;  2B88 A;  2QJK C;  1NTK E;  5APU A;  2M5A A;  3HTK A;  3H32 A;  4ASW A;  2M8L A;  1PP9 J;  1L0L K;  5HGL A;  2BEQ D;  2GZE A;  4UHP B;  1N86 A;  1YBK A;  1VKU A;  5KAI H;  1YQ3 C;  3E7K A;  1SLQ A;  3V2N A;  2KUB A;  1W2E A;  1KIL A;  2ZT9 C;  2QG4 A;  1FOS F;  3RL0 B;  2WPS A;  2OQQ A;  2OYI B;  3N7N A;  4GR2 A;  4U3F G;  1OXZ A;  4YXD C;  2ZYA A;  2HG5 D;  1OVV A;  2RMZ A;  1M6E X;  1Y47 A;  1HBW A;  3RK2 B;  2GYK A;  3PTZ A;  1KYO I;  1JTH B;  2D2C C;  2AEJ A;  2EFJ A;  2WPV B;  3O8Z A;  3VMZ A;  3L71 G;  4DZO A;  5H2F E;  1KYO H;  4KHX A;  4B86 A;  3SWK A;  1VQP P;  1KQS O;  1N7L A;  3AEA C;  3DS2 A;  1BDC A;  3LMO A;  3RL0 D;  5APX A;  2CPB A;  2IBZ G;  5CBO A;  2JU1 A;  1U7J A;  4XRO A;  1HUC A;  1URQ B;  1GL2 A;  1PGP A;  3UIA A;  4EDF A;  2QIW A;  2FXM A;  4WY4 D;  3ZDM A;  1Q2N A;  1VQ8 P;  3AE2 C;  2KB7 P;  3VMX A;  2CNR A;  4PV1 B;  1G2C B;  3RGU A;  4M3L A;  1YTZ I;  2ROQ A;  2IFM A;  3TDK A;  2M5A B;  2O1K A;  3H1I G;  3RBX A;  2HLO A;  4H0L D;  1X8Y A;  2GZI A;  2WPR A;  1NYH A;  2FQ1 A;  3P7K A;  2X2B A;  1X3O A;  3H0D A;  3SWY A;  4XE5 B;  2CG5 B;  2P67 A;  1JUN A;  2KOP A;  3N4X A;  3L72 D;  5KLV K;  1ZOY C;  2PP6 A;  3HE4 B;  1NTZ J;  3CPW O;  2JWA A;  3A3Y B;  2KG8 A;  1BCC G;  3CCR P;  5EW5 E;  4UB8 E;  1FOS E;  1GMJ A;  1NTK K;  2AFE A;  3AE3 C;  1NTZ E;  3KZI E;  1L0N G;  4IZ6 A;  1MKM A;  3L73 G;  3TGU G;  2H88 C;  2IYP A;  3H1J J;  1HWT C;  3VOP A;  2LF4 A;  3H25 A;  3H1K D;  1K73 Q;  1VQL P;  1BE3 G;  2FYZ A;  2YNY A;  3VP9 A;  1SQX K;  1SFC A;  3TGU E;  1NTM J;  1JMM A;  2XZ1 C;  3H1J E;  2D2C B;  1EXI A;  3E2D A;  2N6Y A;  4H44 C;  1VPC A;  2PNG A;  2E76 D;  3AE7 C;  1ZLL A;  4RKU J;  2CK3 H;  3M1M A;  3B5N C;  4GR6 A;  3M06 A;  2OYI C;  4H2W C;  1VF5 D;  1BE3 D;  1YQ4 C;  3RG6 C;  2M5R A;  3JCU H;  1KLP A;  2WSS H;  3OAK A;  1HH0 A;  4RO0 A;  3P05 A;  1LTS C;  2Y0E A;  1IC2 A;  3GLM A;  2GDX A;  2D2C D;  3D70 A;  1WT6 A;  1LT1 A;  4H2Y C;  2IBZ I;  4Z1M H;  1RF0 C;  1W2B O;  1M1K Q;  5HGO A;  2EHT A;  3VTP C;  3EFF K;  1T2K C;  3Q20 A;  5TJH A;  2M3B A;  3MTU E;  2FVE A;  3TYY A;  5F2K A;  4JPZ B;  2MR8 A;  2JP3 A;  4H44 B;  2QE7 H;  3LW5 J;  4U0D A;  1FR2 A;  5KP6 B;  2BUO A;  2FKW B;  3CMA P;  2XKM A;  2G8Y A;  1QLE D;  2YO3 A;  1KQG B;  2BAS A;  3ABV C;  3H1L D;  5TIS E;  4C7R A;  4BPG A;  2JU2 A;  1BE3 E;  1FDI A;  3MIW A;  1H8A A;  1MFZ A;  1SQX G;  3L73 J;  3F89 A;  1NU1 E;  1JCC A;  4PXH B;  2L22 A;  3NTN A;  2KGA A;  5I4T G;  2KLU A;  4OGQ B;  3TNU A;  3M91 A;  1AVY A;  1NU1 J;  2KGD A;  2A45 I;  1VF5 B;  3KYQ A;  4L76 A;  3A0B E;  3KHU A;  2ZT9 D;  5HGN A;  3L75 G;  2KIK A;  1KIL B;  1L0L E;  5GTI H;  1TU3 F;  4HH2 A;  3L71 D;  2FYN B;  2KW2 A;  4WB4 A;  2GA1 A;  2N6Z A;  2HR3 A;  3EFG A;  1H0T A;  2LXB A;  2YIU B;  5AW1 B;  2Q1K A;  1SQQ E;  2BQ1 E;  2FAE A;  2OYH B;  1GK6 A;  1JTH A;  4U3F D;  1CEI A;  1BSH A;  1PEQ A;  3M0A A;  3MD0 A;  2FYU D;  1H88 A;  2P10 A;  1J2J B;  3FXD A;  1RNI A;  4R4M A;  4AUW A;  4HJG H;  4QMA A;  4DT0 A;  1QVG O;  2K2Q A;  1PP9 G;  1S5L X;  2M8P A;  2R5B A;  4OGQ D;  5BU8 B;  4H0L B;  1AFO A;  2FQ2 A;  1RF0 A;  4H44 D;  3L70 G;  3CXH I;  3CCE P;  2HYN A;  2Z5I A;  2XV6 A;  1NTZ G;  3RK3 D;  5KAF H;  3CL3 D;  5KKZ C;  2E1M A;  4L75 A;  4EI2 A;  3I5C A;  4N78 D;  1GTW A;  5M1B A;  1KOR A;  1LP1 A;  3WUV A;  1K8A Q;  4ZNC A;  1LT9 B;  2NRG A;  4BXL A;  2GUV A;  2WSC J; 
#chains in the Genus database with same CATH homology
 1N8R Q;  2Z46 A;  2OTL P;  3G71 P;  1VQM P;  3M1M A;  1BAJ A;  3CC7 P;  3G1I A;  4GR6 A;  5HGN A;  1M74 A;  3G0V A;  1K30 A;  4U0C A;  1VQ9 P;  1Q82 Q;  3G26 A;  3DS4 A;  4XRO A;  5JPA A;  2Z45 A;  3DS3 A;  3RG6 C;  3G1G A;  4XFZ A;  2PEO A;  3VRL C;  3I56 P;  3DPH A;  3H4E A;  4XFX A;  4U0E A;  1JJ2 O;  1KD1 Q;  3CCU P;  3P05 A;  1VQ7 P;  3CCJ P;  3G28 A;  2EG5 A;  3CCV P;  3G6E P;  1VQ6 P;  2OTJ P;  2XXM A;  5HGM A;  1VQ8 P;  1RO2 A;  2CWO A;  4WYM A;  1KC8 Q;  3DS1 A;  1YJW P;  3NTE A;  3G29 A;  2ONT A;  1YJN P;  4XFY A;  1YJ9 P;  2BQ1 E;  1RO0 A;  5F2O A;  5BS1 A;  1W2B O;  1M1K Q;  1VQN P;  3B5I A;  5HGO A;  2M8L A;  1Q86 Q;  3CD6 P;  1YIT P;  2KOD A;  3Q20 A;  3LRY A;  2PEM A;  2M8N A;  1NJI Q;  1PEQ A;  1EIA A;  5BS2 A;  5HGL A;  1K9M Q;  2PEK A;  4U0B A;  1IUQ A;  1VQ4 P;  1VQK P;  5DCK A;  5F2K A;  4COC A;  1YIJ P;  4IPY A;  3H0D A;  2PEJ A;  2PY8 A;  2JYG A;  3CME P;  3CCL P;  2PEQ A;  4XRQ A;  4U0F A;  2Z44 A;  1RNI A;  1A43 A;  1ZMB A;  2OAR A;  4COP A;  2XT1 A;  1PEU A;  3CPW O;  4QNB A;  4U0D A;  3CC4 P;  3DTJ A;  5F2N A;  2DGY A;  2BUO A;  3CCR P;  1QVG O;  3H47 A;  4GR2 A;  1Q81 Q;  3MGE A;  1D1D A;  2JO0 A;  3CMA P;  2M8P A;  2QA4 P;  1QRJ A;  1EOQ A;  3DS0 A;  3I55 P;  1M6N A;  1VQ5 P;  2EIA A;  3CCM P;  1PEO A;  1PEM A;  1M6E X;  1QVF O;  3CC2 P;  1AUM A;  2PEI A;  3CCS P;  2PEN A;  4U0A A;  3G4S P;  2P9X A;  4M0I A;  4PH1 A;  3CCQ P;  3CCE P;  2EFJ A;  3WBH A;  2L6E A;  2JYL A;  3HZQ A;  3DS5 A;  2LF4 A;  3HYB A;  2XV6 A;  2QEX P;  1K73 Q;  1VQL P;  1YI2 P;  2E1M A;  1VQO P;  1VQP P;  1E6J P;  4PH0 A;  1YHQ P;  1KQS O;  1S72 P;  3G21 A;  5I4T G;  1K8A Q;  1M90 Q;  3E2D A;  3DS2 A;  2BHV A;  1A8O A;  3CXC O;  1Q7Y Q;  3OW2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...