3CC7P

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cc7P03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cc7P01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cc7P02
3G6EP 1VQLP 3CXCO 1KD1Q 1VQ5P 3CCRP 2QEXP 1VQ6P 3CCQP 3CCUP 1YJWP 1VQNP 1N8RQ 1YHQP 3OW2O 1VQPP 1VQ4P 1Q86Q 3CPWO 1VQ9P 3CD6P 2OTLP 1VQKP 3CCMP 1Q82Q 1KQSO 1K73Q 3CMAP 3CC7P 1NJIQ 2OTJP 3CCSP 1K8AQ 1VQMP 1S72P 1W2BO 1YIJP 1M90Q 3CCEP 1K9MQ 3I56P 3CC2P 1JJ2O 1VQ7P 3G4SP 1Q7YQ 1QVGO 1KC8Q 3CCLP 1M1KQ 1Q81Q 3G71P 1VQ8P 3CMEP 3CCJP 2QA4P 3I55P 3CC4P 1VQOP 1YITP 1QVFO 3CCVP 1YI2P 1YJNP 1YJ9P
chains in the Genus database with same CATH superfamily
5CJ0A 5L8RJ 1LTBC 4M3LA 3MGEA 4EOTA 1JMMA 1OZHA 3H1LJ 1QRJA 2FXOA 3A0HE 3Q5PA 2XZRA 1IUQA 3G21A 3Q2YA 4WYMA 5AVVB 1ZW0A 4NEOA 1EMVA 3M1MA 2KGCA 1YITP 5AW1B 1NTZD 1QEXA 3OA7A 1Y9BA 1EXJA 3O6QA 1LWUA 1GW4A 1ZP0C 1IFJA 3BATA 1A02J 3DS2A 4CPGA 1IJDB 3MZWB 1VQ7P 4H44C 1JY2N 4PH1A 2FAEA 4OVNF 2NPSC 3VRLC 1FZGA 2FADA 4PV1C 1NTME 2O1JA 2OYHC 2E5YA 3HTKA 2K94A 1KFNA 1T8KA 4EIJA 2GUVA 2HFED 5KTBA 2FXPA 4QKOA 1N73C 1FZBA 2FFDC 1W2BO 2QJYC 2JR8A 1FE6A 1HUCA 1HGVA 3QH9A 3CCVP 2YMKA 1BDCA 2M0BA 2JAZA 1SQBK 1N8RQ 2OTKE 4AUWA 3OW2O 2OYIC 5CCGD 3H1LG 3F5HA 2GZEA 1OIPA 5M1BA 2FQ1A 1BE3E 2KLUA 4KJMA 4YXWH 1Z6MA 2VLQA 3A7OA 3U1AA 1AJYA 1GL2C 3RK2D 4YTPC 2K88A 1EDLA 3G1IA 1NAFA 1DEBA 3MTUE 1LTJB 2BASA 1SLQA 2VLPA 2IBZG 1SQQD 2OQQA 3H32B 5BS2A 1L0NK 4H0LD 1DD3A 2IPPA 4GDOA 3G71P 1VQ8P 1M56D 1LTIC 1VQLP 1RO0A 3S1KA 1EZVD 3CCUP 1A8OA 1FR2A 1KILA 1JY3N 3L74J 1EZVI 3CCEP 2K0YA 2YKPA 2FACA 1S5LH 5KAFH 3H1KE 2JU2A 3MP7B 4H0LC 3IN6A 5H2FH 3V2PA 1YI2P 1KB9H 2BCCJ 2E76B 1VPCA 2KSEA 3M91A 2Z46A 5EJDA 2CGQA 2OYIA 3TGUG 3OJAB 1M1JC 3G28A 2XKMA 1NHLA 1X8YA 3HUSC 3RGUA 1HQBA 4N3YB 1EXIA 2FY8A 4HH2A 5GTIE 4Y99B 3HE5B 2NZ2A 3TSIA 3AE5C 1VF5D 5KAIE 1P84I 5KLVK 1GPJA 3LMOA 1DEEG 4ASVA 2FKWB 3B8EB 2MVUA 3L74E 5BS1A 3OAKA 2D2CC 2IYPA 2QJPB 4I2LC 2Z44A 2M5RA 1NKZB 4HJGH 5AW8B 1S1CX 2GZJA 5CZDB 1GU4A 3L74D 1T3JA 1M8OB 1JY3O 2LMLA 2YKOA 3B71A 1R8EA 1OX3A 2JB0A 2RKLA 3Q5SA 4JPZB 2BHVA 1Y47A 2ZFCA 4NPEA 3PJSK 2FVAA 2KOSA 4PXHB 1KN7A 3EFFK 3NMDA 4UB6H 1NKNA 5CHXA 1W2EA 2C0XA 2MD9A 1YHQP 4ZNCA 1N7SB 4L73A 2W6JH 4U7JA 1DD4A 2M3BA 5HGLA 1URQA 2G8YA 1OFCX 1GXGA 3RK3B 5K5GB 3AE9C 1LTGC 3EJBA 3H32A 4COCA 3PH0A 1IK9A 3KYQA 3M0AA 3V4WA 3H1JD 1IFIA 2B87A 2KGEA 1YJ9P 4Y99C 3E2DA 1XTGB 1PP9D 5F2NA 2M8RA 4H2XC 2M8PA 2IX7C 2FYNC 1PEMA 1OVUA 3LRYA 3HUSA 2K0XA 2Q5UA 1KILB 2A06E 1E0HA 2MKVA 3A0BH 2VRSA 1AQ5A 1RQUA 2E43A 4XFXA 1URQD 1L4AB 2KR5A 4BWNA 1R5SA 4K3AA 3LIDA 5APUA 1AVOA 1U7MA 4OWFA 3H1HJ 2PEKA 2CPSA 2AFDA 4I6MC 3NY7B 3GW6A 1AV1A 5KP8B 1VL2A 1CI6B 4PWVB 2GYKA 2YIUC 2PNGA 2E75C 1BE3G 1YJWP 5HV8A 3D70A 1NWQA 2DGYA 1NJIQ 3M9HA 3V6IA 3GHGA 5KAFE 2M3EA 1S5LE 2JEEA 4XA4A 1GU5A 5HGOA 4U3FJ 3AE7C 2W83C 4N6JA 1ZNVA 1TU3F 1M1JB 3H1LD 1KB9E 1SQQJ 3VTPC 3VP8A 2MF4A 4A7PA 2LKIA 1YBKA 2IZ0A 1KC8Q 1BDDA 3ZDMA 1GXHA 2GUSA 3CCJP 1KILE 3C1LA 2PEMA 3ITKA 3BVHA 5AW5B 4YPCA 2KS1A 1IFDA 2LIUA 2HG5D 2KWLA 1NO4A 2IBZD 3U1CA 1NAYA 1FOSE 4GKGA 4GOEA 4W7YA 5H2FE 4U3FD 4UB8H 2PEQA 1KD1Q 5KKZC 3CCQP 2I8DA 1LT1A 2P58A 2EIAA 1GMJA 3CCMP 2W90A 2EG5A 2KNCA 3U59A 2ZYAA 1BAJA 1BSNA 3I56P 1VQOP 1L0LK 2V4HA 2YMYA 4IL6E 4HKGA 2WPQA 3RL0g 3AEAC 2KB7P 4DT0A 2P2UA 2JO1A 3TDKA 3TYYA 2M5AA 1NVOA 3P32A 3H1JE 2QNWA 1M1KQ 1RF0A 2GA1A 1ZOYC 1NTZJ 5APTA 2BEZF 1DNYA 1ZLLA 3JCUE 1JM0A 5KLIC 1SQBD 3V2QA 1AYIA 1M6EX 1PGJA 3CWBD 3IFMA 3CMEP 3M9BA 2KGAA 1N73B 4U0BA 2GDXA 1VQ5P 3FWLA 3RK3E 1HJBA 3H1KJ 1T6AA 3O6QB 2W8ZA 1LT9C 4O9BA 4MRTC 1IFPA 4M0IA 3L72G 1H8AA 2M8NA 4HYTB 2NPSA 3CCLP 1YTZI 2FYNB 3N7NA 1J1EC 1SQPG 1KMIZ 2KLVA 2JO0A 5GTIH 1K73Q 3EFGA 3L75D 1D1DA 2W6BA 1LWUC 1NTZE 2Y0CA 1T2KC 2QVAA 4OGQB 5CCGC 5EW5E 3H1JG 1L0LD 2NPSD 4EYYQ 4JQ0D 1A43A 3EJEA 1FDIA 1RE3C 2X2BA 1NTMJ 1KILD 4PD4E 3USSA 3D71A 3CX5D 1VKUA 2QJKC 3KZIE 1L4AD 1SP4A 3RL0D 2IZ1A 1GK4A 1L4AC 3DS5A 2FQ2A 1VQNP 2JU1A 3DS0A 1J1DC 3VMXA 2OTLP 4PH0A 2PY8A 3PTZA 1GDTA 2ROQA 4D6TJ 1SQPJ 1M7LA 1P84D 3L75G 3PRJA 4JF7A 2O3JA 3MHVA 3G0VA 2DW3A 2ZT9D 3WU2H 4YXDC 1S3JA 1VF5C 2CNRA 4AYCA 1L2PA 4L76A 1SS1A 1X0TA 1EZVE 2QM8A 3AEBC 3JSVC 5DCKA 5APWA 4PD4I 2PENA 3M06A 5KKZB 5AW2B 2WPTA 1JCCA 1SQXJ 3B5ND 1BCCD 1EOQA 5B5EH 4L74A 1A02F 3CPWO 2N9BA 5APXA 1JY3P 2LTEA 2R5BA 1PEUA 1YIJP 5CCHA 1BGYJ 2ZYGA 1NTKD 3U43A 5TISH 3GHGC 2E1MA 1N7SA 1D7MA 3WU2E 1FJKA 1KYOH 1MZ9A 1KZUB 3L72E 1OWAA 2WSEJ 1MFZA 1AFOA 1E6JP 2B89A 3LW5H 2LPKA 1FZEA 1UJZA 1L0NG 2ITAA 3HZQA 3H1HE 2AEMA 4RJTA 1ZV8A 1NOHA 2CPBA 3V2NA 2XU6A 1USEA 3L70G 2A45G 1IFNA 2E5TA 2HPCB 1VQMP 1AA0A 5DJUB 1WMKA 3L71D 2EHTA 1T2KD 2WSFJ 2MR7A 2RMZA 1H88A 3P8CE 2LXBA 4XFYA 1X79B 3RK2C 1S5LX 3Q1MA 2KOOA 3A0BE 2CG5B 1HVVA 3V4QA 3CC2P 2KG8A 3CC4P 1LNQA 2XZ0D 2JYGA 5B66E 1HY8A 5AVTB 3GZLA 1L0NJ 1S9KD 2N98A 3IR9A 1NTKE 4N78D 4D6TE 3CWBG 3BCCE 1LTAC 4EDFA 2KK7A 3B5NA 2J59M 5F2OA 1NU1J 1K05A 1LWUB 2A45H 2WITA 3VMZA 2ZT9B 2LL8A 1L0LJ 3GZMA 2P10A 2K2QA 4U0DA 2E75D 2KODA 1OR5A 3AECC 1KQSO 4I7ZB 3MIWA 5BVZA 1M74A 2Q3IA 1M90Q 2GDWA 3P7KA 1DH3A 1QVGO 3QWOC 2FYUK 1CI6A 4GR6A 2RN0A 1UNKA 1T3UA 2L9FA 2WWWA 1KQGB 3RBZA 4ZMDA 1Q90D 1J2JB 3GMAA 1F80D 2E76C 5KAIH 1L0LG 3L37A 3L36A 1NU1G 2KG9A 1MV8A 3SFDC 3DS4A 3L73E 1L0NE 4IZ6A 2ONTA 3CCRP 3LIEA 4U0AA 1USDA 1IZNB 1IFMA 1HBWA 4WVZA 1KB9I 3JC22 2FFDA 2BCCE 1MUUA 4IFFA 3RL0B 4GT1A 2N1TA 4RESB 1JJ2O 5AVRB 4K35A 1SQBJ 2WSCJ 1OXZA 3SWKA 2VLOA 1NTZK 1T8ZA 1J1EB 1LTJC 3AE6C 4WBAA 2M5AB 2R32A 1R5LA 2OTJP 1AQTA 1RQVA 3HD7B 2P7JA 1AVYA 2LIWA 5DJTB 2ZXXA 2KOGA 2E42A 4BPHA 1JY2P 3SFEC 1P84H 2J58A 1H0TB 3L71J 2XNXA 3L71E 1GTWA 3ABVC 1SQXK 1NTMK 4R0MA 1MKMA 1FOSF 4QMAA 1EDJA 4W7ZA 2L22A 1JY2O 2KORA 3CE7A 1PGOA 1JMBA 1N73A 3H1LE 1AF8A 2WT7A 3A2AA 2KYVA 2N5IA 3B5NB 3PHLA 3CXCO 2PAJA 2Y0EA 2FVFA 4JYCA 1KQLA 3IAOA 1Q82Q 2VSQA 1K8AQ 4MN4C 2MJZA 3L72D 4WY4D 2PEJA 3G29A 5AW4B 4CA3A 4EI2A 3VN0A 3R2PA 1GW3A 4B86A 1ZRTD 1FZFA 1VDFA 4GIFA 3EJDA 3G6EP 3EWKA 2P1JA 1BGYD 4UB6E 2LF4A 1IMPA 1NU1K 2WSCH 5APVA 2J5UA 3CC7P 2O01H 2GZFA 3CXHI 3G26A 2K9JA 2BQ1E 3HE4A 1PL5A 2E74D 5AW9B 3WMM0 1RE3A 1JB0J 1GL2A 4DJGA 3L74G 5AVQB 1AUMA 4WB4A 5BU5A 7CEIA 1LGHB 2KZIA 2FFDB 3FXDA 4C46A 1KV4A 1OW7A 1Z56A 3GF7A 5KJ7C 3TF5A 3RBXA 3MD0A 4PV1B 2B88A 4R4MA 5B5EE 4H13C 2QEXP 1SQPE 4H44B 1Q86Q 1URQB 1YTZT 4H44D 4KHXA 3M0DA 3RG2A 4GODA 5BU8B 3TGUJ 2HR3A 3HD7A 1GK6A 1KYOD 1L0HA 2L6EA 4JBZA 1PGQA 2XV5A 2AFEA 1PZQA 1GD2E 4GOFA 1FC2C 1L0IA 1W5CE 3FWNA 4XFJA 2OYOA 3P05A 2AEFA 1HGZA 2Q6QA 1H0TA 1NYHA 1LP1B 2R3CA 4XFZA 4I7ZC 1EDIA 2WPVB 2Z45A 5KJ7D 3BCCJ 2N1TD 1H89A 3NXSA 1Q81Q 1QGKB 1BGYE 1HTLC 1IMQA 2KP8A 2KI7B 2YKQA 2E75B 5KLVE 1QX8A 5AVZB 4BPGA 1N7SC 1JO5A 1HH0A 2JWAA 4UHPB 1K9MQ 4Z1MH 1OMIA 4TT3H 3NTNA 2JDIH 3AEGC 1MFTA 4I1LA 1SQBG 1SQQK 4LC1A 1BXIA 2GZIA 4PJ0E 4DZOA 4Y28J 2YXRB 2WSFH 2FYUD 2KG6A 3CCSP 2KIKA 3B5NC 5KLVD 3VOPA 1NU1D 2A45I 4OH8B 3RG6C 1KLPA 4PD4D 2V7QJ 5KP7B 1YYCA 2I1JA 2RH0A 1M1JA 3H47A 1VQ6P 1L0LE 2IFMA 2JJLA 2YO2A 4DOJA 1N7LA 3H1ID 2GZGA 3KHUA 4TLFA 1G1JA 1RHZB 2FYZA 1PPJG 3TGUD 1SQQE 2BUOA 2E74B 2XT1A 2Z5HA 4XRQA 3SWYA 1K04A 5AVWB 1DV5A 2R3SA 1S2EA 1OVRA 3NFQA 5AVUB 1SQXE 4U0EA 1PEOA 4DCKA 1Q2NA 5E79E 5APSA 1FAVA 2I1KA 5KLVG 2IFNA 3P8MC 3MUDA 3RL0C 3BCCG 4NPDA 2BCCD 2H89C 1YQ3C 2K0DX 2YIUB 3D6YA 1NQ4A 3RK2B 2V7QH 4BPFA 3CMAP 1LP1A 1OW6A 3AE8C 1GZLA 3TGUE 4R4LA 1PEQA 2K37A 5KP6B 2L5GB 1YJNP 3BRVB 5EFWB 1PPJD 1ZRTE 2OARA 4WY4B 1LJ2A 5I4TG 2H43A 1N86A 2WQYC 1G2CB 3CI9A 2PGDA 4ZKPA 5HVCA 4IFMA 2AXTE 1DX7A 1SVFA 1NTKK 1J1DB 1PP9E 2H8PD 2H7HA 1NU1E 2AEJA 1CW5A 1BGYG 2AVAA 1CZQA 4JYBA 2ZYDA 2L0QA 3BCCD 4U0CA 1VQ9P 4UB8E 4H2WC 1FU1A 3L70J 2E76D 1NTMG 2MVVA 2SPZA 3H1HG 1SFCC 1JTHA 3O8ZA 2JKVA 1FZCC 3GKLC 2A06G 2YNYA 1KB9D 1RF1A 1SQVD 3D6ZA 3AE2C 3II6A 2O01N 4OGQD 1JEKA 1IC2A 3HD7C 2LXCB 2NPSB 3N4XA 4C7NA 2ZVOB 2Q1KA 1M6NA 2QE7H 2HODB 3M9QA 2FQ0A 3BRTB 1K30A 3CXHH 4N78E 4D6TD 2ERHA 4BRYA 2ZAEB 1KORA 2FYUE 4PD4H 3Q3DA 2QJPC 3LW5J 3V5BA 5HGMA 2R5DA 1RE4A 2Q9IA 5KJ7A 5CCGA 1QLED 5B66H 1FBMA 1PGPA 3VP9A 1SQBE 3H1HD 3L4FA 1SQVJ 1RH5B 2K92A 2ZJSE 1QVFO 1OVVA 2BEQD 4F37A 4IPYA 1EZVG 3KZIH 3L70D 3EQ2A 1PPJE 2YO3A 3L35A 3HD7D 3HUSB 4H13B 3L71G 3WUVA 2C9LY 1L4AA 3SWFA 3WUUA 1PP9J 2OYHB 1YQ4C 3G1GA 5KLIB 2P9XA 3B5IA 3H1JJ 1NTKJ 3CX5I 1M57D 2IBZI 2Y9YA 3G9RA 5AW0B 1VQ4P 2UWJE 3L72J 4D6TG 2Y9ZA 4WY4A 5CCHD 2XV6A 2R44A 3VMAA 3TNUB 1G2CA 2KUBA 1S4XA 2D2CB 4IL6H 2D2CD 4H2YC 1BCCE 1E5WA 2WVRA 3E7KA 3H6PA 4LLHA 2LOLA 1SQXD 3GF3A 3C9IA 3JCUH 2K3RA 2QRXA 2JBGA 4NPFX 3CLQA 2ZVNB 3H1KG 2QIWA 2N6ZA 1OW8A 4PJ0H 2QSIA 3KPEA 3E1IA 1KFMA 3NTEA 2C9NY 2WSSH 3H0DA 2QG4A 1S9KE 1HWTC 3E1RA 1X3OA 1G1IA 2POHA 2XXMA 1NH4A 1RF0C 3AEDC 4IFDK 3CX5E 2N50A 2IBZE 3Q5RA 3AE3C 3B4QA 3T97A 3I55P 1FZCB 2HODA 1RY3A 1SFCB 2K1AA 1SQQG 1FZAA 3P8CD 2KS1B 2OGUA 4ASWA 1ZMBA 3HTKB 2PRRA 1RO2A 3AE4C 3KDPB 5AVXB 4RO0A 3FGAD 3L73J 1E79H 3A0HH 2L91A 4L75A 3CXHE 2NRGA 3MGNA 3AEFC 3KXDA 2BCCG 1JUNA 1RE4C 3HE4B 2XNDH 1VHNA 1RF1C 3W67A 2FXMA 4WY4C 5AVSB 2HPCA 2JP3A 2KNCB 2JYLA 5CJ4A 2ZXEB 4IL6X 3PP5A 2W27A 2OYHA 1X9VA 2ZT9C 2AF8A 1RNIA 4HB1A 4GR2A 2OYIB 5GTHE 4LGDE 1JNMA 3AE1C 2L4BA 2PFXA 3VMYA 3DS3A 2JWDA 1Q7YQ 2Z4EA 2QJYB 5AW3B 3RK3D 2GM4A 2LR2A 1JOCA 3B4SA 3F89A 3HE5A 2GDYA 5JPAA 3CX5H 2N1TC 3IF4A 5CBOA 1PIXA 1BE3D 1P84E 3C8VA 3CWBJ 5C39A 1L0ND 1LTSC 3H25A 2XDJA 3G4SP 4COPA 2WMMA 2VLNA 2KXPB 3GG2A 1XTCC 1DIPA 2Q3EA 1KQFB 2IDBA 2XZ1C 2PEOA 2EFJA 3H1IG 2Q7CA 3DPHA 4PV1D 2HYNA 1ZN5A 4KT0J 1FDOA 2LKMA 1SQPD 5HGNA 4U0FA 2KOQA 3T97B 2QM7A 1FZCA 1QL2A 1SFCA 3GJNA 1EQ7A 4U3FE 1UIXA 4IOIH 3CL3D 3G3ZA 5F2KA 2K5XA 1KYOI 2K93A 3RK3C 3AEEC 1Y8AA 1PV3A 4C7RA 2DNWA 4RKUJ 2FHSC 3L70E 1URQC 2FYUG 1CSBA 2B87B 2C0WA 2CK3H 1EDKA 3HRNA 4U3FG 1WT6A 5APYA 1ZMEC 3K5BA 4QNBA 3KQGA 2NO8A 2N5HA 3FXEA 2B9BA 4H13D 3FX0A 2N1TB 3W68A 2PEIA 2KOPA 1PFIA 4XROA 1N2DC 4BXLA 1BE3J 1LTTC 2QA4P 1ZR4A 5CMZA 1SQPK 2KZJA 3L75J 3M0DC 3L75E 1FJPA 2N9YB 3S9OA 3CWBE 3A3YB 3CD6P 3L73G 5APQA 3CXHD 2E74C 3TK1A 2HLOA 4XE5B 1BCCJ 2H88C 1LT9B 2M8LA 1SQXG 3UIAA 1KYOE 3V2RA 3PLNA 1KTMA 3I5CA 1SQVK 1PP9G 5TISE 1SQVE 3HYBA 3H1KD 3VYIA 3GHGB 2MR8A 1HF9A 5GTHH 5CBNA 1X22A 3A5TA 2O01J 2KSJA 2WT7B 2JGPA 2WSEH 1SQVG 1QL1A 2WPRA 4ZKUA 2FVEA 1BCCG 1CEIA 1IO4A 1ACPA 2PP6A 4WWIA 1IK7A 3H4EA 2IYOA 3GLMA 4C7NB 3L73D 2JQ4A 2K9YA 2QJKB 5TJHA 1FDMA 1SFCD 2EHSA 1NTKG 2CQ8A 3H1IJ 2MY5A 4DG9A 1EIAA 1VQKP 1VF5B 3WBHA 5E79H 1HJ0A 1JTHB 2K9JB 1UIIA 1FS0E 1NTMD 3BASA 1GL2D 2G3AA 1RF1B 1ZR2A 1GL2B 2A06D 3Q20A 1KILC 4AQRD 5KLVJ 2FYUJ 2YXQB 1JCDA 2O1KA 3SSUA 1WRGA 2CWOA 1VQPP 3DS1A 3WUTA 1S72P 2AXTH 3DTJA 5AVYB 4H0LB 3S4RA 4W80A 1NTZG 1MZ8A 2N6YA 1ZXGA 4HKZH 1U7JA 1EC5A 1U57A 1BSHA 2WZ7A 2Z5IA 4BRYB 1LTJA 2W6AA 1N7SD 5CCHC 5AW7B 2KGDA 2AXCA 3TNUA 1NGMB 2WPSA 3MUDC 2WTYA 5AW6B 2P67A 2KW2A 3H1IE 2FBWC 1LT9A 2Y0DA 4OGQC 3R4YA
chains in the Genus database with same CATH topology
5F2OA 2QEXP 2E1MA 3H47A 1VQ6P 3MGEA 3G1IA 1YJWP 1VQ4P 4U0CA 2DGYA 1Q86Q 5F2KA 1QRJA 4U0DA 1VQ9P 2KODA 1KQSO 1NJIQ 3H4EA 1IUQA 1M74A 2XV6A 3G21A 1M90Q 4WYMA 2JYLA 5BS2A 2BHVA 5HGOA 1QVGO 2L6EA 1M1KQ 1E6JP 4GR6A 3M1MA 3G71P 1VQ8P 1YITP 1RNIA 2BUOA 2XT1A 4GR2A 4XRQA 1VQLP 3CXCO 1RO0A 3DS5A 3P05A 3CCUP 1VQNP 3DS0A 3HZQA 1YHQP 4QNBA 1A8OA 1EIAA 2OTLP 4PH0A 1VQKP 1M6EX 2PY8A 4XFZA 1Q82Q 5HGLA 1K8AQ 2PEIA 4U0EA 1VQMP 1PEOA 2Z45A 3DS2A 3CCEP 2PEJA 4XROA 3WBHA 3DS3A 3G29A 4COCA 1M6NA 1Q7YQ 1KC8Q 1VQ7P 4PH1A 1Q81Q 3CMEP 3DS4A 3CCJP 2QA4P 3NTEA 3G0VA 4U0BA 1YI2P 2PEMA 3Q20A 3VRLC 1YJ9P 2ONTA 1K30A 3G6EP 5JPAA 3E2DA 4XFYA 3CCRP 1VQ5P 5F2NA 4U0AA 3H0DA 2LF4A 2CWOA 2Z46A 1VQPP 5HGMA 2M8PA 3CD6P 1PEMA 3DS1A 3LRYA 2XXMA 3CC7P 3G28A 3CMAP 4M0IA 1S72P 1W2BO 3DTJA 2M8NA 4XFXA 3G26A 5DCKA 1K9MQ 3CC2P 1JJ2O 3G4SP 2PENA 3CCLP 4COPA 2BQ1E 2M8LA 3I55P 3CC4P 1PEQA 1QVFO 2PEQA 3CCVP 1YJNP 2JYGA 1KD1Q 3CCQP 1EOQA 2PEKA 1AUMA 1N8RQ 4IPYA 3OW2O 2OARA 2PEOA 3HYBA 3CPWO 1ZMBA 2EIAA 2EFJA 2JO0A 3CCMP 2EG5A 1K73Q 1RO2A 2OTJP 3CCSP 1D1DA 3DPHA 5I4TG 1PEUA 1YIJP 5BS1A 1BAJA 3I56P 3RG6C 5HGNA 3G1GA 4U0FA 2Z44A 1VQOP 1A43A 2P9XA 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  1VQL P;  3CXC O;  1KD1 Q;  1VQ5 P;  3CCR P;  2QEX P;  1VQ6 P;  3CCQ P;  3CCU P;  1YJW P;  1VQN P;  1N8R Q;  1YHQ P;  3OW2 O;  1VQP P;  1VQ4 P;  1Q86 Q;  3CPW O;  1VQ9 P;  3CD6 P;  2OTL P;  1VQK P;  3CCM P;  1Q82 Q;  1KQS O;  1K73 Q;  3CMA P;  3CC7 P;  1NJI Q;  2OTJ P;  3CCS P;  1K8A Q;  1VQM P;  1S72 P;  1W2B O;  1YIJ P;  1M90 Q;  3CCE P;  1K9M Q;  3I56 P;  3CC2 P;  1JJ2 O;  1VQ7 P;  3G4S P;  1Q7Y Q;  1QVG O;  1KC8 Q;  3CCL P;  1M1K Q;  1Q81 Q;  3G71 P;  1VQ8 P;  3CME P;  3CCJ P;  2QA4 P;  3I55 P;  3CC4 P;  1VQO P;  1YIT P;  1QVF O;  3CCV P;  1YI2 P;  1YJN P;  1YJ9 P; 
#chains in the Genus database with same CATH topology
 5CJ0 A;  5L8R J;  1LTB C;  4M3L A;  3MGE A;  4EOT A;  1JMM A;  1OZH A;  3H1L J;  1QRJ A;  2FXO A;  3A0H E;  3Q5P A;  2XZR A;  1IUQ A;  3G21 A;  3Q2Y A;  4WYM A;  5AVV B;  1ZW0 A;  4NEO A;  1EMV A;  3M1M A;  2KGC A;  1YIT P;  5AW1 B;  1NTZ D;  1QEX A;  3OA7 A;  1Y9B A;  1EXJ A;  3O6Q A;  1LWU A;  1GW4 A;  1ZP0 C;  1IFJ A;  3BAT A;  1A02 J;  3DS2 A;  4CPG A;  1IJD B;  3MZW B;  1VQ7 P;  4H44 C;  1JY2 N;  4PH1 A;  2FAE A;  4OVN F;  2NPS C;  3VRL C;  1FZG A;  2FAD A;  4PV1 C;  1NTM E;  2O1J A;  2OYH C;  2E5Y A;  3HTK A;  2K94 A;  1KFN A;  1T8K A;  4EIJ A;  2GUV A;  2HFE D;  5KTB A;  2FXP A;  4QKO A;  1N73 C;  1FZB A;  2FFD C;  1W2B O;  2QJY C;  2JR8 A;  1FE6 A;  1HUC A;  1HGV A;  3QH9 A;  3CCV P;  2YMK A;  1BDC A;  2M0B A;  2JAZ A;  1SQB K;  1N8R Q;  2OTK E;  4AUW A;  3OW2 O;  2OYI C;  5CCG D;  3H1L G;  3F5H A;  2GZE A;  1OIP A;  5M1B A;  2FQ1 A;  1BE3 E;  2KLU A;  4KJM A;  4YXW H;  1Z6M A;  2VLQ A;  3A7O A;  3U1A A;  1AJY A;  1GL2 C;  3RK2 D;  4YTP C;  2K88 A;  1EDL A;  3G1I A;  1NAF A;  1DEB A;  3MTU E;  1LTJ B;  2BAS A;  1SLQ A;  2VLP A;  2IBZ G;  1SQQ D;  2OQQ A;  3H32 B;  5BS2 A;  1L0N K;  4H0L D;  1DD3 A;  2IPP A;  4GDO A;  3G71 P;  1VQ8 P;  1M56 D;  1LTI C;  1VQL P;  1RO0 A;  3S1K A;  1EZV D;  3CCU P;  1A8O A;  1FR2 A;  1KIL A;  1JY3 N;  3L74 J;  1EZV I;  3CCE P;  2K0Y A;  2YKP A;  2FAC A;  1S5L H;  5KAF H;  3H1K E;  2JU2 A;  3MP7 B;  4H0L C;  3IN6 A;  5H2F H;  3V2P A;  1YI2 P;  1KB9 H;  2BCC J;  2E76 B;  1VPC A;  2KSE A;  3M91 A;  2Z46 A;  5EJD A;  2CGQ A;  2OYI A;  3TGU G;  3OJA B;  1M1J C;  3G28 A;  2XKM A;  1NHL A;  1X8Y A;  3HUS C;  3RGU A;  1HQB A;  4N3Y B;  1EXI A;  2FY8 A;  4HH2 A;  5GTI E;  4Y99 B;  3HE5 B;  2NZ2 A;  3TSI A;  3AE5 C;  1VF5 D;  5KAI E;  1P84 I;  5KLV K;  1GPJ A;  3LMO A;  1DEE G;  4ASV A;  2FKW B;  3B8E B;  2MVU A;  3L74 E;  5BS1 A;  3OAK A;  2D2C C;  2IYP A;  2QJP B;  4I2L C;  2Z44 A;  2M5R A;  1NKZ B;  4HJG H;  5AW8 B;  1S1C X;  2GZJ A;  5CZD B;  1GU4 A;  3L74 D;  1T3J A;  1M8O B;  1JY3 O;  2LML A;  2YKO A;  3B71 A;  1R8E A;  1OX3 A;  2JB0 A;  2RKL A;  3Q5S A;  4JPZ B;  2BHV A;  1Y47 A;  2ZFC A;  4NPE A;  3PJS K;  2FVA A;  2KOS A;  4PXH B;  1KN7 A;  3EFF K;  3NMD A;  4UB6 H;  1NKN A;  5CHX A;  1W2E A;  2C0X A;  2MD9 A;  1YHQ P;  4ZNC A;  1N7S B;  4L73 A;  2W6J H;  4U7J A;  1DD4 A;  2M3B A;  5HGL A;  1URQ A;  2G8Y A;  1OFC X;  1GXG A;  3RK3 B;  5K5G B;  3AE9 C;  1LTG C;  3EJB A;  3H32 A;  4COC A;  3PH0 A;  1IK9 A;  3KYQ A;  3M0A A;  3V4W A;  3H1J D;  1IFI A;  2B87 A;  2KGE A;  1YJ9 P;  4Y99 C;  3E2D A;  1XTG B;  1PP9 D;  5F2N A;  2M8R A;  4H2X C;  2M8P A;  2IX7 C;  2FYN C;  1PEM A;  1OVU A;  3LRY A;  3HUS A;  2K0X A;  2Q5U A;  1KIL B;  2A06 E;  1E0H A;  2MKV A;  3A0B H;  2VRS A;  1AQ5 A;  1RQU A;  2E43 A;  4XFX A;  1URQ D;  1L4A B;  2KR5 A;  4BWN A;  1R5S A;  4K3A A;  3LID A;  5APU A;  1AVO A;  1U7M A;  4OWF A;  3H1H J;  2PEK A;  2CPS A;  2AFD A;  4I6M C;  3NY7 B;  3GW6 A;  1AV1 A;  5KP8 B;  1VL2 A;  1CI6 B;  4PWV B;  2GYK A;  2YIU C;  2PNG A;  2E75 C;  1BE3 G;  1YJW P;  5HV8 A;  3D70 A;  1NWQ A;  2DGY A;  1NJI Q;  3M9H A;  3V6I A;  3GHG A;  5KAF E;  2M3E A;  1S5L E;  2JEE A;  4XA4 A;  1GU5 A;  5HGO A;  4U3F J;  3AE7 C;  2W83 C;  4N6J A;  1ZNV A;  1TU3 F;  1M1J B;  3H1L D;  1KB9 E;  1SQQ J;  3VTP C;  3VP8 A;  2MF4 A;  4A7P A;  2LKI A;  1YBK A;  2IZ0 A;  1KC8 Q;  1BDD A;  3ZDM A;  1GXH A;  2GUS A;  3CCJ P;  1KIL E;  3C1L A;  2PEM A;  3ITK A;  3BVH A;  5AW5 B;  4YPC A;  2KS1 A;  1IFD A;  2LIU A;  2HG5 D;  2KWL A;  1NO4 A;  2IBZ D;  3U1C A;  1NAY A;  1FOS E;  4GKG A;  4GOE A;  4W7Y A;  5H2F E;  4U3F D;  4UB8 H;  2PEQ A;  1KD1 Q;  5KKZ C;  3CCQ P;  2I8D A;  1LT1 A;  2P58 A;  2EIA A;  1GMJ A;  3CCM P;  2W90 A;  2EG5 A;  2KNC A;  3U59 A;  2ZYA A;  1BAJ A;  1BSN A;  3I56 P;  1VQO P;  1L0L K;  2V4H A;  2YMY A;  4IL6 E;  4HKG A;  2WPQ A;  3RL0 g;  3AEA C;  2KB7 P;  4DT0 A;  2P2U A;  2JO1 A;  3TDK A;  3TYY A;  2M5A A;  1NVO A;  3P32 A;  3H1J E;  2QNW A;  1M1K Q;  1RF0 A;  2GA1 A;  1ZOY C;  1NTZ J;  5APT A;  2BEZ F;  1DNY A;  1ZLL A;  3JCU E;  1JM0 A;  5KLI C;  1SQB D;  3V2Q A;  1AYI A;  1M6E X;  1PGJ A;  3CWB D;  3IFM A;  3CME P;  3M9B A;  2KGA A;  1N73 B;  4U0B A;  2GDX A;  1VQ5 P;  3FWL A;  3RK3 E;  1HJB A;  3H1K J;  1T6A A;  3O6Q B;  2W8Z A;  1LT9 C;  4O9B A;  4MRT C;  1IFP A;  4M0I A;  3L72 G;  1H8A A;  2M8N A;  4HYT B;  2NPS A;  3CCL P;  1YTZ I;  2FYN B;  3N7N A;  1J1E C;  1SQP G;  1KMI Z;  2KLV A;  2JO0 A;  5GTI H;  1K73 Q;  3EFG A;  3L75 D;  1D1D A;  2W6B A;  1LWU C;  1NTZ E;  2Y0C A;  1T2K C;  2QVA A;  4OGQ B;  5CCG C;  5EW5 E;  3H1J G;  1L0L D;  2NPS D;  4EYY Q;  4JQ0 D;  1A43 A;  3EJE A;  1FDI A;  1RE3 C;  2X2B A;  1NTM J;  1KIL D;  4PD4 E;  3USS A;  3D71 A;  3CX5 D;  1VKU A;  2QJK C;  3KZI E;  1L4A D;  1SP4 A;  3RL0 D;  2IZ1 A;  1GK4 A;  1L4A C;  3DS5 A;  2FQ2 A;  1VQN P;  2JU1 A;  3DS0 A;  1J1D C;  3VMX A;  2OTL P;  4PH0 A;  2PY8 A;  3PTZ A;  1GDT A;  2ROQ A;  4D6T J;  1SQP J;  1M7L A;  1P84 D;  3L75 G;  3PRJ A;  4JF7 A;  2O3J A;  3MHV A;  3G0V A;  2DW3 A;  2ZT9 D;  3WU2 H;  4YXD C;  1S3J A;  1VF5 C;  2CNR A;  4AYC A;  1L2P A;  4L76 A;  1SS1 A;  1X0T A;  1EZV E;  2QM8 A;  3AEB C;  3JSV C;  5DCK A;  5APW A;  4PD4 I;  2PEN A;  3M06 A;  5KKZ B;  5AW2 B;  2WPT A;  1JCC A;  1SQX J;  3B5N D;  1BCC D;  1EOQ A;  5B5E H;  4L74 A;  1A02 F;  3CPW O;  2N9B A;  5APX A;  1JY3 P;  2LTE A;  2R5B A;  1PEU A;  1YIJ P;  5CCH A;  1BGY J;  2ZYG A;  1NTK D;  3U43 A;  5TIS H;  3GHG C;  2E1M A;  1N7S A;  1D7M A;  3WU2 E;  1FJK A;  1KYO H;  1MZ9 A;  1KZU B;  3L72 E;  1OWA A;  2WSE J;  1MFZ A;  1AFO A;  1E6J P;  2B89 A;  3LW5 H;  2LPK A;  1FZE A;  1UJZ A;  1L0N G;  2ITA A;  3HZQ A;  3H1H E;  2AEM A;  4RJT A;  1ZV8 A;  1NOH A;  2CPB A;  3V2N A;  2XU6 A;  1USE A;  3L70 G;  2A45 G;  1IFN A;  2E5T A;  2HPC B;  1VQM P;  1AA0 A;  5DJU B;  1WMK A;  3L71 D;  2EHT A;  1T2K D;  2WSF J;  2MR7 A;  2RMZ A;  1H88 A;  3P8C E;  2LXB A;  4XFY A;  1X79 B;  3RK2 C;  1S5L X;  3Q1M A;  2KOO A;  3A0B E;  2CG5 B;  1HVV A;  3V4Q A;  3CC2 P;  2KG8 A;  3CC4 P;  1LNQ A;  2XZ0 D;  2JYG A;  5B66 E;  1HY8 A;  5AVT B;  3GZL A;  1L0N J;  1S9K D;  2N98 A;  3IR9 A;  1NTK E;  4N78 D;  4D6T E;  3CWB G;  3BCC E;  1LTA C;  4EDF A;  2KK7 A;  3B5N A;  2J59 M;  5F2O A;  1NU1 J;  1K05 A;  1LWU B;  2A45 H;  2WIT A;  3VMZ A;  2ZT9 B;  2LL8 A;  1L0L J;  3GZM A;  2P10 A;  2K2Q A;  4U0D A;  2E75 D;  2KOD A;  1OR5 A;  3AEC C;  1KQS O;  4I7Z B;  3MIW A;  5BVZ A;  1M74 A;  2Q3I A;  1M90 Q;  2GDW A;  3P7K A;  1DH3 A;  1QVG O;  3QWO C;  2FYU K;  1CI6 A;  4GR6 A;  2RN0 A;  1UNK A;  1T3U A;  2L9F A;  2WWW A;  1KQG B;  3RBZ A;  4ZMD A;  1Q90 D;  1J2J B;  3GMA A;  1F80 D;  2E76 C;  5KAI H;  1L0L G;  3L37 A;  3L36 A;  1NU1 G;  2KG9 A;  1MV8 A;  3SFD C;  3DS4 A;  3L73 E;  1L0N E;  4IZ6 A;  2ONT A;  3CCR P;  3LIE A;  4U0A A;  1USD A;  1IZN B;  1IFM A;  1HBW A;  4WVZ A;  1KB9 I;  3JC2 2;  2FFD A;  2BCC E;  1MUU A;  4IFF A;  3RL0 B;  4GT1 A;  2N1T A;  4RES B;  1JJ2 O;  5AVR B;  4K35 A;  1SQB J;  2WSC J;  1OXZ A;  3SWK A;  2VLO A;  1NTZ K;  1T8Z A;  1J1E B;  1LTJ C;  3AE6 C;  4WBA A;  2M5A B;  2R32 A;  1R5L A;  2OTJ P;  1AQT A;  1RQV A;  3HD7 B;  2P7J A;  1AVY A;  2LIW A;  5DJT B;  2ZXX A;  2KOG A;  2E42 A;  4BPH A;  1JY2 P;  3SFE C;  1P84 H;  2J58 A;  1H0T B;  3L71 J;  2XNX A;  3L71 E;  1GTW A;  3ABV C;  1SQX K;  1NTM K;  4R0M A;  1MKM A;  1FOS F;  4QMA A;  1EDJ A;  4W7Z A;  2L22 A;  1JY2 O;  2KOR A;  3CE7 A;  1PGO A;  1JMB A;  1N73 A;  3H1L E;  1AF8 A;  2WT7 A;  3A2A A;  2KYV A;  2N5I A;  3B5N B;  3PHL A;  3CXC O;  2PAJ A;  2Y0E A;  2FVF A;  4JYC A;  1KQL A;  3IAO A;  1Q82 Q;  2VSQ A;  1K8A Q;  4MN4 C;  2MJZ A;  3L72 D;  4WY4 D;  2PEJ A;  3G29 A;  5AW4 B;  4CA3 A;  4EI2 A;  3VN0 A;  3R2P A;  1GW3 A;  4B86 A;  1ZRT D;  1FZF A;  1VDF A;  4GIF A;  3EJD A;  3G6E P;  3EWK A;  2P1J A;  1BGY D;  4UB6 E;  2LF4 A;  1IMP A;  1NU1 K;  2WSC H;  5APV A;  2J5U A;  3CC7 P;  2O01 H;  2GZF A;  3CXH I;  3G26 A;  2K9J A;  2BQ1 E;  3HE4 A;  1PL5 A;  2E74 D;  5AW9 B;  3WMM 0;  1RE3 A;  1JB0 J;  1GL2 A;  4DJG A;  3L74 G;  5AVQ B;  1AUM A;  4WB4 A;  5BU5 A;  7CEI A;  1LGH B;  2KZI A;  2FFD B;  3FXD A;  4C46 A;  1KV4 A;  1OW7 A;  1Z56 A;  3GF7 A;  5KJ7 C;  3TF5 A;  3RBX A;  3MD0 A;  4PV1 B;  2B88 A;  4R4M A;  5B5E E;  4H13 C;  2QEX P;  1SQP E;  4H44 B;  1Q86 Q;  1URQ B;  1YTZ T;  4H44 D;  4KHX A;  3M0D A;  3RG2 A;  4GOD A;  5BU8 B;  3TGU J;  2HR3 A;  3HD7 A;  1GK6 A;  1KYO D;  1L0H A;  2L6E A;  4JBZ A;  1PGQ A;  2XV5 A;  2AFE A;  1PZQ A;  1GD2 E;  4GOF A;  1FC2 C;  1L0I A;  1W5C E;  3FWN A;  4XFJ A;  2OYO A;  3P05 A;  2AEF A;  1HGZ A;  2Q6Q A;  1H0T A;  1NYH A;  1LP1 B;  2R3C A;  4XFZ A;  4I7Z C;  1EDI A;  2WPV B;  2Z45 A;  5KJ7 D;  3BCC J;  2N1T D;  1H89 A;  3NXS A;  1Q81 Q;  1QGK B;  1BGY E;  1HTL C;  1IMQ A;  2KP8 A;  2KI7 B;  2YKQ A;  2E75 B;  5KLV E;  1QX8 A;  5AVZ B;  4BPG A;  1N7S C;  1JO5 A;  1HH0 A;  2JWA A;  4UHP B;  1K9M Q;  4Z1M H;  1OMI A;  4TT3 H;  3NTN A;  2JDI H;  3AEG C;  1MFT A;  4I1L A;  1SQB G;  1SQQ K;  4LC1 A;  1BXI A;  2GZI A;  4PJ0 E;  4DZO A;  4Y28 J;  2YXR B;  2WSF H;  2FYU D;  2KG6 A;  3CCS P;  2KIK A;  3B5N C;  5KLV D;  3VOP A;  1NU1 D;  2A45 I;  4OH8 B;  3RG6 C;  1KLP A;  4PD4 D;  2V7Q J;  5KP7 B;  1YYC A;  2I1J A;  2RH0 A;  1M1J A;  3H47 A;  1VQ6 P;  1L0L E;  2IFM A;  2JJL A;  2YO2 A;  4DOJ A;  1N7L A;  3H1I D;  2GZG A;  3KHU A;  4TLF A;  1G1J A;  1RHZ B;  2FYZ A;  1PPJ G;  3TGU D;  1SQQ E;  2BUO A;  2E74 B;  2XT1 A;  2Z5H A;  4XRQ A;  3SWY A;  1K04 A;  5AVW B;  1DV5 A;  2R3S A;  1S2E A;  1OVR A;  3NFQ A;  5AVU B;  1SQX E;  4U0E A;  1PEO A;  4DCK A;  1Q2N A;  5E79 E;  5APS A;  1FAV A;  2I1K A;  5KLV G;  2IFN A;  3P8M C;  3MUD A;  3RL0 C;  3BCC G;  4NPD A;  2BCC D;  2H89 C;  1YQ3 C;  2K0D X;  2YIU B;  3D6Y A;  1NQ4 A;  3RK2 B;  2V7Q H;  4BPF A;  3CMA P;  1LP1 A;  1OW6 A;  3AE8 C;  1GZL A;  3TGU E;  4R4L A;  1PEQ A;  2K37 A;  5KP6 B;  2L5G B;  1YJN P;  3BRV B;  5EFW B;  1PPJ D;  1ZRT E;  2OAR A;  4WY4 B;  1LJ2 A;  5I4T G;  2H43 A;  1N86 A;  2WQY C;  1G2C B;  3CI9 A;  2PGD A;  4ZKP A;  5HVC A;  4IFM A;  2AXT E;  1DX7 A;  1SVF A;  1NTK K;  1J1D B;  1PP9 E;  2H8P D;  2H7H A;  1NU1 E;  2AEJ A;  1CW5 A;  1BGY G;  2AVA A;  1CZQ A;  4JYB A;  2ZYD A;  2L0Q A;  3BCC D;  4U0C A;  1VQ9 P;  4UB8 E;  4H2W C;  1FU1 A;  3L70 J;  2E76 D;  1NTM G;  2MVV A;  2SPZ A;  3H1H G;  1SFC C;  1JTH A;  3O8Z A;  2JKV A;  1FZC C;  3GKL C;  2A06 G;  2YNY A;  1KB9 D;  1RF1 A;  1SQV D;  3D6Z A;  3AE2 C;  3II6 A;  2O01 N;  4OGQ D;  1JEK A;  1IC2 A;  3HD7 C;  2LXC B;  2NPS B;  3N4X A;  4C7N A;  2ZVO B;  2Q1K A;  1M6N A;  2QE7 H;  2HOD B;  3M9Q A;  2FQ0 A;  3BRT B;  1K30 A;  3CXH H;  4N78 E;  4D6T D;  2ERH A;  4BRY A;  2ZAE B;  1KOR A;  2FYU E;  4PD4 H;  3Q3D A;  2QJP C;  3LW5 J;  3V5B A;  5HGM A;  2R5D A;  1RE4 A;  2Q9I A;  5KJ7 A;  5CCG A;  1QLE D;  5B66 H;  1FBM A;  1PGP A;  3VP9 A;  1SQB E;  3H1H D;  3L4F A;  1SQV J;  1RH5 B;  2K92 A;  2ZJS E;  1QVF O;  1OVV A;  2BEQ D;  4F37 A;  4IPY A;  1EZV G;  3KZI H;  3L70 D;  3EQ2 A;  1PPJ E;  2YO3 A;  3L35 A;  3HD7 D;  3HUS B;  4H13 B;  3L71 G;  3WUV A;  2C9L Y;  1L4A A;  3SWF A;  3WUU A;  1PP9 J;  2OYH B;  1YQ4 C;  3G1G A;  5KLI B;  2P9X A;  3B5I A;  3H1J J;  1NTK J;  3CX5 I;  1M57 D;  2IBZ I;  2Y9Y A;  3G9R A;  5AW0 B;  1VQ4 P;  2UWJ E;  3L72 J;  4D6T G;  2Y9Z A;  4WY4 A;  5CCH D;  2XV6 A;  2R44 A;  3VMA A;  3TNU B;  1G2C A;  2KUB A;  1S4X A;  2D2C B;  4IL6 H;  2D2C D;  4H2Y C;  1BCC E;  1E5W A;  2WVR A;  3E7K A;  3H6P A;  4LLH A;  2LOL A;  1SQX D;  3GF3 A;  3C9I A;  3JCU H;  2K3R A;  2QRX A;  2JBG A;  4NPF X;  3CLQ A;  2ZVN B;  3H1K G;  2QIW A;  2N6Z A;  1OW8 A;  4PJ0 H;  2QSI A;  3KPE A;  3E1I A;  1KFM A;  3NTE A;  2C9N Y;  2WSS H;  3H0D A;  2QG4 A;  1S9K E;  1HWT C;  3E1R A;  1X3O A;  1G1I A;  2POH A;  2XXM A;  1NH4 A;  1RF0 C;  3AED C;  4IFD K;  3CX5 E;  2N50 A;  2IBZ E;  3Q5R A;  3AE3 C;  3B4Q A;  3T97 A;  3I55 P;  1FZC B;  2HOD A;  1RY3 A;  1SFC B;  2K1A A;  1SQQ G;  1FZA A;  3P8C D;  2KS1 B;  2OGU A;  4ASW A;  1ZMB A;  3HTK B;  2PRR A;  1RO2 A;  3AE4 C;  3KDP B;  5AVX B;  4RO0 A;  3FGA D;  3L73 J;  1E79 H;  3A0H H;  2L91 A;  4L75 A;  3CXH E;  2NRG A;  3MGN A;  3AEF C;  3KXD A;  2BCC G;  1JUN A;  1RE4 C;  3HE4 B;  2XND H;  1VHN A;  1RF1 C;  3W67 A;  2FXM A;  4WY4 C;  5AVS B;  2HPC A;  2JP3 A;  2KNC B;  2JYL A;  5CJ4 A;  2ZXE B;  4IL6 X;  3PP5 A;  2W27 A;  2OYH A;  1X9V A;  2ZT9 C;  2AF8 A;  1RNI A;  4HB1 A;  4GR2 A;  2OYI B;  5GTH E;  4LGD E;  1JNM A;  3AE1 C;  2L4B A;  2PFX A;  3VMY A;  3DS3 A;  2JWD A;  1Q7Y Q;  2Z4E A;  2QJY B;  5AW3 B;  3RK3 D;  2GM4 A;  2LR2 A;  1JOC A;  3B4S A;  3F89 A;  3HE5 A;  2GDY A;  5JPA A;  3CX5 H;  2N1T C;  3IF4 A;  5CBO A;  1PIX A;  1BE3 D;  1P84 E;  3C8V A;  3CWB J;  5C39 A;  1L0N D;  1LTS C;  3H25 A;  2XDJ A;  3G4S P;  4COP A;  2WMM A;  2VLN A;  2KXP B;  3GG2 A;  1XTC C;  1DIP A;  2Q3E A;  1KQF B;  2IDB A;  2XZ1 C;  2PEO A;  2EFJ A;  3H1I G;  2Q7C A;  3DPH A;  4PV1 D;  2HYN A;  1ZN5 A;  4KT0 J;  1FDO A;  2LKM A;  1SQP D;  5HGN A;  4U0F A;  2KOQ A;  3T97 B;  2QM7 A;  1FZC A;  1QL2 A;  1SFC A;  3GJN A;  1EQ7 A;  4U3F E;  1UIX A;  4IOI H;  3CL3 D;  3G3Z A;  5F2K A;  2K5X A;  1KYO I;  2K93 A;  3RK3 C;  3AEE C;  1Y8A A;  1PV3 A;  4C7R A;  2DNW A;  4RKU J;  2FHS C;  3L70 E;  1URQ C;  2FYU G;  1CSB A;  2B87 B;  2C0W A;  2CK3 H;  1EDK A;  3HRN A;  4U3F G;  1WT6 A;  5APY A;  1ZME C;  3K5B A;  4QNB A;  3KQG A;  2NO8 A;  2N5H A;  3FXE A;  2B9B A;  4H13 D;  3FX0 A;  2N1T B;  3W68 A;  2PEI A;  2KOP A;  1PFI A;  4XRO A;  1N2D C;  4BXL A;  1BE3 J;  1LTT C;  2QA4 P;  1ZR4 A;  5CMZ A;  1SQP K;  2KZJ A;  3L75 J;  3M0D C;  3L75 E;  1FJP A;  2N9Y B;  3S9O A;  3CWB E;  3A3Y B;  3CD6 P;  3L73 G;  5APQ A;  3CXH D;  2E74 C;  3TK1 A;  2HLO A;  4XE5 B;  1BCC J;  2H88 C;  1LT9 B;  2M8L A;  1SQX G;  3UIA A;  1KYO E;  3V2R A;  3PLN A;  1KTM A;  3I5C A;  1SQV K;  1PP9 G;  5TIS E;  1SQV E;  3HYB A;  3H1K D;  3VYI A;  3GHG B;  2MR8 A;  1HF9 A;  5GTH H;  5CBN A;  1X22 A;  3A5T A;  2O01 J;  2KSJ A;  2WT7 B;  2JGP A;  2WSE H;  1SQV G;  1QL1 A;  2WPR A;  4ZKU A;  2FVE A;  1BCC G;  1CEI A;  1IO4 A;  1ACP A;  2PP6 A;  4WWI A;  1IK7 A;  3H4E A;  2IYO A;  3GLM A;  4C7N B;  3L73 D;  2JQ4 A;  2K9Y A;  2QJK B;  5TJH A;  1FDM A;  1SFC D;  2EHS A;  1NTK G;  2CQ8 A;  3H1I J;  2MY5 A;  4DG9 A;  1EIA A;  1VQK P;  1VF5 B;  3WBH A;  5E79 H;  1HJ0 A;  1JTH B;  2K9J B;  1UII A;  1FS0 E;  1NTM D;  3BAS A;  1GL2 D;  2G3A A;  1RF1 B;  1ZR2 A;  1GL2 B;  2A06 D;  3Q20 A;  1KIL C;  4AQR D;  5KLV J;  2FYU J;  2YXQ B;  1JCD A;  2O1K A;  3SSU A;  1WRG A;  2CWO A;  1VQP P;  3DS1 A;  3WUT A;  1S72 P;  2AXT H;  3DTJ A;  5AVY B;  4H0L B;  3S4R A;  4W80 A;  1NTZ G;  1MZ8 A;  2N6Y A;  1ZXG A;  4HKZ H;  1U7J A;  1EC5 A;  1U57 A;  1BSH A;  2WZ7 A;  2Z5I A;  4BRY B;  1LTJ A;  2W6A A;  1N7S D;  5CCH C;  5AW7 B;  2KGD A;  2AXC A;  3TNU A;  1NGM B;  2WPS A;  3MUD C;  2WTY A;  5AW6 B;  2P67 A;  2KW2 A;  3H1I E;  2FBW C;  1LT9 A;  2Y0D A;  4OGQ C;  3R4Y A; 
#chains in the Genus database with same CATH homology
 5F2O A;  2QEX P;  2E1M A;  3H47 A;  1VQ6 P;  3MGE A;  3G1I A;  1YJW P;  1VQ4 P;  4U0C A;  2DGY A;  1Q86 Q;  5F2K A;  1QRJ A;  4U0D A;  1VQ9 P;  2KOD A;  1KQS O;  1NJI Q;  3H4E A;  1IUQ A;  1M74 A;  2XV6 A;  3G21 A;  1M90 Q;  4WYM A;  2JYL A;  5BS2 A;  2BHV A;  5HGO A;  1QVG O;  2L6E A;  1M1K Q;  1E6J P;  4GR6 A;  3M1M A;  3G71 P;  1VQ8 P;  1YIT P;  1RNI A;  2BUO A;  2XT1 A;  4GR2 A;  4XRQ A;  1VQL P;  3CXC O;  1RO0 A;  3DS5 A;  3P05 A;  3CCU P;  1VQN P;  3DS0 A;  3HZQ A;  1YHQ P;  4QNB A;  1A8O A;  1EIA A;  2OTL P;  4PH0 A;  1VQK P;  1M6E X;  2PY8 A;  4XFZ A;  1Q82 Q;  5HGL A;  1K8A Q;  2PEI A;  4U0E A;  1VQM P;  1PEO A;  2Z45 A;  3DS2 A;  3CCE P;  2PEJ A;  4XRO A;  3WBH A;  3DS3 A;  3G29 A;  4COC A;  1M6N A;  1Q7Y Q;  1KC8 Q;  1VQ7 P;  4PH1 A;  1Q81 Q;  3CME P;  3DS4 A;  3CCJ P;  2QA4 P;  3NTE A;  3G0V A;  4U0B A;  1YI2 P;  2PEM A;  3Q20 A;  3VRL C;  1YJ9 P;  2ONT A;  1K30 A;  3G6E P;  5JPA A;  3E2D A;  4XFY A;  3CCR P;  1VQ5 P;  5F2N A;  4U0A A;  3H0D A;  2LF4 A;  2CWO A;  2Z46 A;  1VQP P;  5HGM A;  2M8P A;  3CD6 P;  1PEM A;  3DS1 A;  3LRY A;  2XXM A;  3CC7 P;  3G28 A;  3CMA P;  4M0I A;  1S72 P;  1W2B O;  3DTJ A;  2M8N A;  4XFX A;  3G26 A;  5DCK A;  1K9M Q;  3CC2 P;  1JJ2 O;  3G4S P;  2PEN A;  3CCL P;  4COP A;  2BQ1 E;  2M8L A;  3I55 P;  3CC4 P;  1PEQ A;  1QVF O;  2PEQ A;  3CCV P;  1YJN P;  2JYG A;  1KD1 Q;  3CCQ P;  1EOQ A;  2PEK A;  1AUM A;  1N8R Q;  4IPY A;  3OW2 O;  2OAR A;  2PEO A;  3HYB A;  3CPW O;  1ZMB A;  2EIA A;  2EFJ A;  2JO0 A;  3CCM P;  2EG5 A;  1K73 Q;  1RO2 A;  2OTJ P;  3CCS P;  1D1D A;  3DPH A;  5I4T G;  1PEU A;  1YIJ P;  5BS1 A;  1BAJ A;  3I56 P;  3RG6 C;  5HGN A;  3G1G A;  4U0F A;  2Z44 A;  1VQO P;  1A43 A;  2P9X A;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...