2X2BA

Crystal structure of malonyl-acp (acyl carrier protein) from bacillus subtilis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL CARRIER PROTEIN
publication title A Novel Role of Malonyl-Acp in Lipid Homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2x2bA00
2N5HA 1T8KA 2KGDA 3NY7B 2X2BA 2KGEA 1F80D 2AFEA 2JQ4A 2EHTA 2K0XA 3EJDA 3EJEA 2FHSC 4BPGA 2N6ZA 3GZLA 2K2QA 2EHSA 2N5IA 3RG2A 2N50A 3CE7A 2GDXA 2LL8A 2AFDA 2L9FA 1NQ4A 2KG8A 1KLPA 2XZ1C 1L0IA 4IZ6A 2KOPA 2N98A 2KGCA 1OR5A 2GDWA 2LTEA 4PXHB 4NEOA 1HQBA 2FQ2A 4MRTC 5HVCA 3EJBA 2L0QA 2MD9A 2K94A 5KP6B 2JGPA 2ROQA 2KOSA 2FAEA 2CGQA 2KG6A 2XZ0D 2KG9A 1VKUA 2FVEA 5CZDB 2KOOA 2M5RA 2CNRA 4H2XC 2AF8A 2FADA 2FQ0A 2L22A 4DG9A 2CQ8A 3LMOA 2FVAA 2PNGA 2LKIA 2MY5A 4R0MA 2GDYA 2MVUA 2KR5A 2KORA 4BPFA 2MR8A 1X3OA 4PWVB 1DV5A 1AF8A 4H2WC 2QNWA 2K0YA 2KOQA 2MF4A 4CA3A 3GZMA 2FQ1A 5HV8A 2LOLA 2AVAA 4BPHA 2CG5B 2LPKA 1L0HA 2VSQA 2K92A 2KW2A 2MVVA 2LMLA 2L4BA 2FVFA 2LIWA 2FACA 2MR7A 2LIUA 1DNYA 5KP7B 1HY8A 1ACPA 2JU2A 2K93A 5EJDA 4H2YC 2N6YA 2KWLA 4HKGA 2KGAA 5KP8B 2DNWA 2JU1A
chains in the Genus database with same CATH superfamily
2VLQA 3NY7B 2X2BA 1ZMBA 3HYBA 5BS1A 2AFEA 3CCEP 4M0IA 4UHPB 3CCRP 3RG2A 1E6JP 4PH0A 1NQ4A 1VQ7P 1VQ5P 1S72P 4NEOA 5HVCA 1KD1Q 2L6EA 1KC8Q 2ROQA 2GZJA 1YJWP 3CCMP 2KG6A 1VKUA 5BS2A 5F2NA 2JYGA 3CPWO 1E0HA 1AYIA 2PEKA 2AF8A 2FQ0A 2M8PA 3G0VA 1Q82Q 3H47A 1VQKP 2PEOA 3DS5A 4R0MA 1D1DA 1Z6MA 2LF4A 2Z45A 1X3OA 5HGOA 1K30A 3G21A 3OW2O 3GKLC 1UJZA 4IPYA 5HV8A 2XXMA 4BPHA 2LPKA 1UNKA 2VSQA 2QA4P 2ONTA 2KW2A 2LMLA 4GR6A 2PEJA 2MR7A 2K93A 4H2YC 4WYMA 1YHQP 3CC4P 2KWLA 1M1KQ 3CD6P 3MGEA 4HKGA 2KGAA 2JU1A 2PEMA 1T8KA 3G71P 3E2DA 1VQ6P 2JBGA 3CCVP 1F80D 7CEIA 1K9MQ 1VQOP 2JQ4A 4BPGA 2K0XA 3HZQA 2N6ZA 2N5IA 3CC2P 1RO0A 2XZ1C 1L0IA 4IZ6A 2N98A 2KGCA 1YJNP 3DPHA 1OR5A 4U0DA 1HQBA 1BXIA 4MRTC 2XT1A 3CCLP 3I55P 1YITP 2L0QA 1QRJA 3DS2A 4PH1A 2BHVA 2K94A 1RO2A 1A8OA 2JGPA 5HGMA 2FAEA 2KODA 2CGQA 2KG9A 2FVEA 1EOQA 4COPA 5CZDB 2M5RA 2VLPA 2L22A 4QNBA 1N8RQ 1CEIA 2CQ8A 2FVAA 2K5XA 2GDYA 2KORA 4BPFA 2EIAA 3G4SP 2CWOA 1AF8A 4H2WC 2QNWA 2K0YA 1Q81Q 2XV6A 2CG5B 3M1MA 2PY8A 2P9XA 2MVVA 2FACA 2LIUA 1DNYA 3B5IA 1HY8A 2JU2A 5EJDA 2VLNA 4U0AA 2GYKA 2N6YA 4U0FA 5KP8B 3H0DA 2DNWA 4QKOA 1GXHA 1ZNVA 2JB0A 2KGEA 2EFJA 4U0BA 2EHTA 1M6NA 2EG5A 3GZLA 3G6EP 2N50A 2GDXA 2LL8A 3B4QA 2AFDA 2L9FA 2KG8A 1YJ9P 2GZIA 2KOPA 1QVGO 2GDWA 2BUOA 4XROA 4PXHB 3DS4A 2FQ2A 3DS3A 2QEXP 3EJBA 1JJ2O 3CCUP 1M6EX 1VQ4P 2MD9A 2OTLP 5EW5E 5F2KA 2KOSA 3Q20A 1VQ8P 1QVFO 2XZ0D 2CNRA 4H2XC 3I56P 3LMOA 2PENA 2PNGA 2LKIA 2DGYA 2MY5A 3DTJA 3CCSP 2MR8A 3CXCO 4XRQA 1IMQA 3U43A 2MF4A 4CA3A 3GJNA 2M8NA 1Q86Q 1VQMP 2LOLA 2AVAA 4U0CA 2K92A 1M90Q 2K0DX 2L4BA 3NTEA 1AUMA 3CCQP 3DS1A 2GZFA 2ERHA 2PEQA 1IUQA 1KQSO 3G28A 3G26A 5DCKA 2GZEA 1GXGA 2N5HA 2KGDA 2GZGA 4GR2A 5JPAA 1IMPA 1K73Q 1VQNP 2OARA 1M74A 5F2OA 3EJEA 3EJDA 2FHSC 3P05A 3CMEP 2K2QA 1EIAA 2EHSA 3CCJP 3CE7A 4COCA 1KLPA 1VQLP 2E1MA 1RNIA 1FR2A 3G1IA 2LTEA 1YIJP 1W2BO 3G1GA 2OTJP 1MZ8A 3WBHA 5KP6B 3CC7P 1A43A 1GPJA 1NJIQ 3CMAP 2KOOA 4F37A 2Z46A 2FADA 4DG9A 5HGNA 1VQPP 4U0EA 2MVUA 2KR5A 2WPTA 3VRLC 3DS0A 1EMVA 4PWVB 1DV5A 2Z44A 2JAZA 1YI2P 2KOQA 1VQ9P 2VLOA 3GZMA 2FQ1A 3RG6C 5HGLA 2M8LA 2NO8A 1L0HA 2JO0A 3G29A 2FVFA 2LIWA 4XFYA 1Q7YQ 4XFXA 3H4EA 1K8AQ 5KP7B 1ACPA 3LRYA 1BAJA 4XFZA 5I4TG 2JYLA 2PEIA 1VHNA
chains in the Genus database with same CATH topology
2N5HA 1T8KA 2KGDA 3NY7B 2X2BA 2KGEA 1F80D 2AFEA 2JQ4A 2EHTA 2K0XA 3EJDA 3EJEA 2FHSC 4BPGA 2N6ZA 3GZLA 2K2QA 2EHSA 2N5IA 3RG2A 2N50A 3CE7A 2GDXA 2LL8A 2AFDA 2L9FA 1NQ4A 2KG8A 1KLPA 2XZ1C 1L0IA 4IZ6A 2KOPA 2N98A 2KGCA 1OR5A 2GDWA 2LTEA 4PXHB 4NEOA 1HQBA 2FQ2A 4MRTC 5HVCA 3EJBA 2L0QA 2MD9A 2K94A 5KP6B 2JGPA 2ROQA 2KOSA 2FAEA 2CGQA 2KG6A 2XZ0D 2KG9A 1VKUA 2FVEA 5CZDB 2KOOA 2M5RA 2CNRA 4H2XC 2AF8A 2FADA 2FQ0A 2L22A 4DG9A 2CQ8A 3LMOA 2FVAA 2PNGA 2LKIA 2MY5A 4R0MA 2GDYA 2MVUA 2KR5A 2KORA 4BPFA 2MR8A 1X3OA 4PWVB 1DV5A 1AF8A 4H2WC 2QNWA 2K0YA 2KOQA 2MF4A 4CA3A 3GZMA 2FQ1A 5HV8A 2LOLA 2AVAA 4BPHA 2CG5B 2LPKA 1L0HA 2VSQA 2K92A 2KW2A 2MVVA 2LMLA 2L4BA 2FVFA 2LIWA 2FACA 2MR7A 2LIUA 1DNYA 5KP7B 1HY8A 1ACPA 2JU2A 2K93A 5EJDA 4H2YC 2N6YA 2KWLA 4HKGA 2KGAA 5KP8B 2DNWA 2JU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5H A;  1T8K A;  2KGD A;  3NY7 B;  2X2B A;  2KGE A;  1F80 D;  2AFE A;  2JQ4 A;  2EHT A;  2K0X A;  3EJD A;  3EJE A;  2FHS C;  4BPG A;  2N6Z A;  3GZL A;  2K2Q A;  2EHS A;  2N5I A;  3RG2 A;  2N50 A;  3CE7 A;  2GDX A;  2LL8 A;  2AFD A;  2L9F A;  1NQ4 A;  2KG8 A;  1KLP A;  2XZ1 C;  1L0I A;  4IZ6 A;  2KOP A;  2N98 A;  2KGC A;  1OR5 A;  2GDW A;  2LTE A;  4PXH B;  4NEO A;  1HQB A;  2FQ2 A;  4MRT C;  5HVC A;  3EJB A;  2L0Q A;  2MD9 A;  2K94 A;  5KP6 B;  2JGP A;  2ROQ A;  2KOS A;  2FAE A;  2CGQ A;  2KG6 A;  2XZ0 D;  2KG9 A;  1VKU A;  2FVE A;  5CZD B;  2KOO A;  2M5R A;  2CNR A;  4H2X C;  2AF8 A;  2FAD A;  2FQ0 A;  2L22 A;  4DG9 A;  2CQ8 A;  3LMO A;  2FVA A;  2PNG A;  2LKI A;  2MY5 A;  4R0M A;  2GDY A;  2MVU A;  2KR5 A;  2KOR A;  4BPF A;  2MR8 A;  1X3O A;  4PWV B;  1DV5 A;  1AF8 A;  4H2W C;  2QNW A;  2K0Y A;  2KOQ A;  2MF4 A;  4CA3 A;  3GZM A;  2FQ1 A;  5HV8 A;  2LOL A;  2AVA A;  4BPH A;  2CG5 B;  2LPK A;  1L0H A;  2VSQ A;  2K92 A;  2KW2 A;  2MVV A;  2LML A;  2L4B A;  2FVF A;  2LIW A;  2FAC A;  2MR7 A;  2LIU A;  1DNY A;  5KP7 B;  1HY8 A;  1ACP A;  2JU2 A;  2K93 A;  5EJD A;  4H2Y C;  2N6Y A;  2KWL A;  4HKG A;  2KGA A;  5KP8 B;  2DNW A;  2JU1 A; 
#chains in the Genus database with same CATH topology
 2VLQ A;  3NY7 B;  2X2B A;  1ZMB A;  3HYB A;  5BS1 A;  2AFE A;  3CCE P;  4M0I A;  4UHP B;  3CCR P;  3RG2 A;  1E6J P;  4PH0 A;  1NQ4 A;  1VQ7 P;  1VQ5 P;  1S72 P;  4NEO A;  5HVC A;  1KD1 Q;  2L6E A;  1KC8 Q;  2ROQ A;  2GZJ A;  1YJW P;  3CCM P;  2KG6 A;  1VKU A;  5BS2 A;  5F2N A;  2JYG A;  3CPW O;  1E0H A;  1AYI A;  2PEK A;  2AF8 A;  2FQ0 A;  2M8P A;  3G0V A;  1Q82 Q;  3H47 A;  1VQK P;  2PEO A;  3DS5 A;  4R0M A;  1D1D A;  1Z6M A;  2LF4 A;  2Z45 A;  1X3O A;  5HGO A;  1K30 A;  3G21 A;  3OW2 O;  3GKL C;  1UJZ A;  4IPY A;  5HV8 A;  2XXM A;  4BPH A;  2LPK A;  1UNK A;  2VSQ A;  2QA4 P;  2ONT A;  2KW2 A;  2LML A;  4GR6 A;  2PEJ A;  2MR7 A;  2K93 A;  4H2Y C;  4WYM A;  1YHQ P;  3CC4 P;  2KWL A;  1M1K Q;  3CD6 P;  3MGE A;  4HKG A;  2KGA A;  2JU1 A;  2PEM A;  1T8K A;  3G71 P;  3E2D A;  1VQ6 P;  2JBG A;  3CCV P;  1F80 D;  7CEI A;  1K9M Q;  1VQO P;  2JQ4 A;  4BPG A;  2K0X A;  3HZQ A;  2N6Z A;  2N5I A;  3CC2 P;  1RO0 A;  2XZ1 C;  1L0I A;  4IZ6 A;  2N98 A;  2KGC A;  1YJN P;  3DPH A;  1OR5 A;  4U0D A;  1HQB A;  1BXI A;  4MRT C;  2XT1 A;  3CCL P;  3I55 P;  1YIT P;  2L0Q A;  1QRJ A;  3DS2 A;  4PH1 A;  2BHV A;  2K94 A;  1RO2 A;  1A8O A;  2JGP A;  5HGM A;  2FAE A;  2KOD A;  2CGQ A;  2KG9 A;  2FVE A;  1EOQ A;  4COP A;  5CZD B;  2M5R A;  2VLP A;  2L22 A;  4QNB A;  1N8R Q;  1CEI A;  2CQ8 A;  2FVA A;  2K5X A;  2GDY A;  2KOR A;  4BPF A;  2EIA A;  3G4S P;  2CWO A;  1AF8 A;  4H2W C;  2QNW A;  2K0Y A;  1Q81 Q;  2XV6 A;  2CG5 B;  3M1M A;  2PY8 A;  2P9X A;  2MVV A;  2FAC A;  2LIU A;  1DNY A;  3B5I A;  1HY8 A;  2JU2 A;  5EJD A;  2VLN A;  4U0A A;  2GYK A;  2N6Y A;  4U0F A;  5KP8 B;  3H0D A;  2DNW A;  4QKO A;  1GXH A;  1ZNV A;  2JB0 A;  2KGE A;  2EFJ A;  4U0B A;  2EHT A;  1M6N A;  2EG5 A;  3GZL A;  3G6E P;  2N50 A;  2GDX A;  2LL8 A;  3B4Q A;  2AFD A;  2L9F A;  2KG8 A;  1YJ9 P;  2GZI A;  2KOP A;  1QVG O;  2GDW A;  2BUO A;  4XRO A;  4PXH B;  3DS4 A;  2FQ2 A;  3DS3 A;  2QEX P;  3EJB A;  1JJ2 O;  3CCU P;  1M6E X;  1VQ4 P;  2MD9 A;  2OTL P;  5EW5 E;  5F2K A;  2KOS A;  3Q20 A;  1VQ8 P;  1QVF O;  2XZ0 D;  2CNR A;  4H2X C;  3I56 P;  3LMO A;  2PEN A;  2PNG A;  2LKI A;  2DGY A;  2MY5 A;  3DTJ A;  3CCS P;  2MR8 A;  3CXC O;  4XRQ A;  1IMQ A;  3U43 A;  2MF4 A;  4CA3 A;  3GJN A;  2M8N A;  1Q86 Q;  1VQM P;  2LOL A;  2AVA A;  4U0C A;  2K92 A;  1M90 Q;  2K0D X;  2L4B A;  3NTE A;  1AUM A;  3CCQ P;  3DS1 A;  2GZF A;  2ERH A;  2PEQ A;  1IUQ A;  1KQS O;  3G28 A;  3G26 A;  5DCK A;  2GZE A;  1GXG A;  2N5H A;  2KGD A;  2GZG A;  4GR2 A;  5JPA A;  1IMP A;  1K73 Q;  1VQN P;  2OAR A;  1M74 A;  5F2O A;  3EJE A;  3EJD A;  2FHS C;  3P05 A;  3CME P;  2K2Q A;  1EIA A;  2EHS A;  3CCJ P;  3CE7 A;  4COC A;  1KLP A;  1VQL P;  2E1M A;  1RNI A;  1FR2 A;  3G1I A;  2LTE A;  1YIJ P;  1W2B O;  3G1G A;  2OTJ P;  1MZ8 A;  3WBH A;  5KP6 B;  3CC7 P;  1A43 A;  1GPJ A;  1NJI Q;  3CMA P;  2KOO A;  4F37 A;  2Z46 A;  2FAD A;  4DG9 A;  5HGN A;  1VQP P;  4U0E A;  2MVU A;  2KR5 A;  2WPT A;  3VRL C;  3DS0 A;  1EMV A;  4PWV B;  1DV5 A;  2Z44 A;  2JAZ A;  1YI2 P;  2KOQ A;  1VQ9 P;  2VLO A;  3GZM A;  2FQ1 A;  3RG6 C;  5HGL A;  2M8L A;  2NO8 A;  1L0H A;  2JO0 A;  3G29 A;  2FVF A;  2LIW A;  4XFY A;  1Q7Y Q;  4XFX A;  3H4E A;  1K8A Q;  5KP7 B;  1ACP A;  3LRY A;  1BAJ A;  4XFZ A;  5I4T G;  2JYL A;  2PEI A;  1VHN A; 
#chains in the Genus database with same CATH homology
 2N5H A;  1T8K A;  2KGD A;  3NY7 B;  2X2B A;  2KGE A;  1F80 D;  2AFE A;  2JQ4 A;  2EHT A;  2K0X A;  3EJD A;  3EJE A;  2FHS C;  4BPG A;  2N6Z A;  3GZL A;  2K2Q A;  2EHS A;  2N5I A;  3RG2 A;  2N50 A;  3CE7 A;  2GDX A;  2LL8 A;  2AFD A;  2L9F A;  1NQ4 A;  2KG8 A;  1KLP A;  2XZ1 C;  1L0I A;  4IZ6 A;  2KOP A;  2N98 A;  2KGC A;  1OR5 A;  2GDW A;  2LTE A;  4PXH B;  4NEO A;  1HQB A;  2FQ2 A;  4MRT C;  5HVC A;  3EJB A;  2L0Q A;  2MD9 A;  2K94 A;  5KP6 B;  2JGP A;  2ROQ A;  2KOS A;  2FAE A;  2CGQ A;  2KG6 A;  2XZ0 D;  2KG9 A;  1VKU A;  2FVE A;  5CZD B;  2KOO A;  2M5R A;  2CNR A;  4H2X C;  2AF8 A;  2FAD A;  2FQ0 A;  2L22 A;  4DG9 A;  2CQ8 A;  3LMO A;  2FVA A;  2PNG A;  2LKI A;  2MY5 A;  4R0M A;  2GDY A;  2MVU A;  2KR5 A;  2KOR A;  4BPF A;  2MR8 A;  1X3O A;  4PWV B;  1DV5 A;  1AF8 A;  4H2W C;  2QNW A;  2K0Y A;  2KOQ A;  2MF4 A;  4CA3 A;  3GZM A;  2FQ1 A;  5HV8 A;  2LOL A;  2AVA A;  4BPH A;  2CG5 B;  2LPK A;  1L0H A;  2VSQ A;  2K92 A;  2KW2 A;  2MVV A;  2LML A;  2L4B A;  2FVF A;  2LIW A;  2FAC A;  2MR7 A;  2LIU A;  1DNY A;  5KP7 B;  1HY8 A;  1ACP A;  2JU2 A;  2K93 A;  5EJD A;  4H2Y C;  2N6Y A;  2KWL A;  4HKG A;  2KGA A;  5KP8 B;  2DNW A;  2JU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...