2X2BA

Crystal structure of malonyl-acp (acyl carrier protein) from bacillus subtilis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
76
structure length
76
Chain Sequence
MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords ACYL CARRIER PROTEIN
publication title A Novel Role of Malonyl-Acp in Lipid Homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 27
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2x2bA00
2CGQA 2N5HA 2JU2A 4BPFA 1OR5A 3EJEA 2K94A 2LL8A 2GDYA 2FQ0A 2N5IA 2K92A 4HKGA 2FVEA 2CNRA 2K0XA 2FHSC 5HV8A 2LKIA 2MVVA 1KLPA 2KG6A 4CA3A 4BPHA 2FAEA 4NEOA 2CQ8A 2CG5B 1ACPA 2N50A 2AFEA 2K0YA 2N6YA 2FADA 1VKUA 2KOSA 2M5RA 2QNWA 4H2XC 2GDWA 2GDXA 2KGCA 2LPKA 2LOLA 2MD9A 5KP6B 2MF4A 2KG8A 2MR8A 5HVCA 2FVAA 2FACA 2L0QA 2L4BA 2MY5A 2FQ2A 1AF8A 2MVUA 2K93A 2EHSA 3RG2A 3CE7A 2LTEA 2KOPA 4H2WC 4DG9A 5KP7B 2N6ZA 2LMLA 2LIWA 2FVFA 2KG9A 5KP8B 2AVAA 1F80D 2AF8A 2AFDA 4PXHB 2K2QA 1L0HA 3EJBA 2JU1A 1NQ4A 4PWVB 3EJDA 5CZDB 1L0IA 1DV5A 2LIUA 3LMOA 3NY7B 3GZLA 1HQBA 1HY8A 2DNWA 2PNGA 2KGDA 3GZMA 2EHTA 2KORA 2FQ1A 2ROQA 4IZ6A 2KW2A 2JGPA 1X3OA 4MRTC 2KOOA 2XZ0D 2JQ4A 2VSQA 4BPGA 2L22A 2KR5A 4H2YC 5EJDA 4R0MA 2N98A 2XZ1C 1DNYA 2MR7A 2KGEA 2L9FA 1T8KA 2KGAA 2KOQA 2X2BA 2KWLA
chains in the Genus database with same CATH superfamily
1Q82Q 1OR5A 2GDYA 4IPYA 4U0EA 1VHNA 4UHPB 2FHSC 2P9XA 2EG5A 1KLPA 3DS2A 2FAEA 1RO0A 4NEOA 4F37A 2CWOA 5I4TG 2JBGA 2N50A 2N6YA 1KQSO 1IMPA 2LPKA 1VQ6P 3HYBA 1EIAA 2M8LA 2GZFA 4COPA 5HVCA 1ZMBA 3G4SP 2L0QA 2MY5A 1M6NA 2BUOA 2KOPA 5KP7B 3CCSP 1K8AQ 2N6ZA 5KP8B 1F80D 3EJBA 4PH0A 1NQ4A 3G0VA 1VQ7P 3EJDA 2LF4A 1M6EX 1IMQA 2Z44A 1YHQP 2VLQA 3LMOA 4XFZA 3CC7P 1K73Q 2PNGA 5DCKA 1M90Q 2GZEA 4PH1A 3GZMA 3B5IA 1VQKP 2VSQA 3CMAP 1Z6MA 1YITP 1RO2A 4GR6A 2KR5A 4H2YC 1GXGA 1DNYA 4WYMA 2L9FA 1NJIQ 2EIAA 2ERHA 2X2BA 5F2NA 2JU2A 2K94A 4U0CA 3CCLP 5EW5E 3CCQP 2FQ0A 2JO0A 3G6EP 2M8PA 1YJ9P 2K92A 3DS0A 2FVEA 2K0XA 5HV8A 2LKIA 3DS4A 2MVVA 3GJNA 2JAZA 4BPHA 1W2BO 3U43A 2CG5B 1K30A 2AFEA 5HGOA 2PEKA 2KOSA 1A43A 2KGCA 2OTLP 2LOLA 5KP6B 2MF4A 1YJNP 1D1DA 2PEOA 1FR2A 1AYIA 4H2WC 2LTEA 4DG9A 1YI2P 2EFJA 2GZJA 3CCMP 4XFXA 2KG9A 2AVAA 3NTEA 3LRYA 3CCVP 2K2QA 1VQMP 1CEIA 3OW2O 1L0IA 2XXMA 2M8NA 1HQBA 3DPHA 2KGDA 5HGNA 2GZIA 2EHTA 2FQ1A 2ROQA 3CPWO 4IZ6A 4U0AA 5BS2A 2K0DX 1X3OA 4MRTC 2XZ0D 1Q86Q 1GXHA 2XV6A 2MR7A 3I55P 2VLOA 5JPAA 1T8KA 2KOQA 1M1KQ 2BHVA 3G1GA 1A8OA 2KWLA 1VQNP 2GZGA 2CGQA 2N5HA 1YJWP 3EJEA 2LL8A 2N5IA 1UNKA 4HKGA 2ONTA 2CNRA 2PEJA 1BXIA 5HGLA 4CA3A 1Q81Q 1ACPA 2K0YA 3HZQA 2FADA 1QRJA 3G26A 3G1IA 2M5RA 2GDWA 2MD9A 2FVAA 2FACA 2PEIA 5BS1A 2L4BA 1AF8A 3B4QA 3RG2A 3CE7A 3I56P 2LMLA 2PEMA 3DS5A 2AF8A 2AFDA 4PXHB 2JB0A 2JU1A 4XRQA 3CCRP 1K9MQ 4PWVB 1KC8Q 2PY8A 5CZDB 1EOQA 4XROA 2PENA 3MGEA 3GZLA 3DTJA 1HY8A 2DNWA 1E0HA 1QVGO 1JJ2O 4U0DA 3E2DA 2KORA 1VQ5P 2KW2A 3DS3A 2Z46A 1IUQA 2KOOA 7CEIA 2K5XA 4M0IA 4R0MA 2N98A 2XZ1C 2E1MA 2KGEA 1BAJA 3H0DA 2KGAA 3WBHA 1VQPP 3CC2P 2GYKA 3G28A 1VQLP 4BPFA 1ZNVA 2L6EA 2OTJP 2JYLA 1Q7YQ 3P05A 2Z45A 2QEXP 3CMEP 2KODA 2PEQA 2KG6A 3M1MA 1KD1Q 3GKLC 2CQ8A 1UJZA 1YIJP 4COCA 3CD6P 1VKUA 2QNWA 3G29A 4H2XC 2GDXA 1VQ9P 2KG8A 3G71P 2MR8A 1MZ8A 2VLPA 2QA4P 2FQ2A 2MVUA 2K93A 2EHSA 1VQOP 5HGMA 3CCEP 2LIWA 2VLNA 2FVFA 3CCUP 2OARA 1AUMA 3H4EA 4U0BA 1L0HA 3H47A 4QNBA 1M74A 2DGYA 4U0FA 1VQ8P 3CCJP 3VRLC 1N8RQ 1DV5A 2LIUA 3G21A 3NY7B 3DS1A 2JYGA 5F2KA 2WPTA 1EMVA 1GPJA 2JGPA 4XFYA 1VQ4P 2JQ4A 3RG6C 4BPGA 2L22A 5F2OA 3CXCO 5EJDA 2XT1A 1RNIA 1QVFO 4QKOA 3Q20A 3CC4P 1E6JP 1S72P 4GR2A 2NO8A
chains in the Genus database with same CATH topology
2CGQA 2N5HA 2JU2A 4BPFA 1OR5A 3EJEA 2K94A 2LL8A 2GDYA 2FQ0A 2N5IA 2K92A 4HKGA 2FVEA 2CNRA 2K0XA 2FHSC 5HV8A 2LKIA 2MVVA 1KLPA 2KG6A 4CA3A 4BPHA 2FAEA 4NEOA 2CQ8A 2CG5B 1ACPA 2N50A 2AFEA 2K0YA 2N6YA 2FADA 1VKUA 2KOSA 2M5RA 2QNWA 4H2XC 2GDWA 2GDXA 2KGCA 2LPKA 2LOLA 2MD9A 5KP6B 2MF4A 2KG8A 2MR8A 5HVCA 2FVAA 2FACA 2L0QA 2L4BA 2MY5A 2FQ2A 1AF8A 2MVUA 2K93A 2EHSA 3RG2A 3CE7A 2LTEA 2KOPA 4H2WC 4DG9A 5KP7B 2N6ZA 2LMLA 2LIWA 2FVFA 2KG9A 5KP8B 2AVAA 1F80D 2AF8A 2AFDA 4PXHB 2K2QA 1L0HA 3EJBA 2JU1A 1NQ4A 4PWVB 3EJDA 5CZDB 1L0IA 1DV5A 2LIUA 3LMOA 3NY7B 3GZLA 1HQBA 1HY8A 2DNWA 2PNGA 2KGDA 3GZMA 2EHTA 2KORA 2FQ1A 2ROQA 4IZ6A 2KW2A 2JGPA 1X3OA 4MRTC 2KOOA 2XZ0D 2JQ4A 2VSQA 4BPGA 2L22A 2KR5A 4H2YC 5EJDA 4R0MA 2N98A 2XZ1C 1DNYA 2MR7A 2KGEA 2L9FA 1T8KA 2KGAA 2KOQA 2X2BA 2KWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGQ A;  2N5H A;  2JU2 A;  4BPF A;  1OR5 A;  3EJE A;  2K94 A;  2LL8 A;  2GDY A;  2FQ0 A;  2N5I A;  2K92 A;  4HKG A;  2FVE A;  2CNR A;  2K0X A;  2FHS C;  5HV8 A;  2LKI A;  2MVV A;  1KLP A;  2KG6 A;  4CA3 A;  4BPH A;  2FAE A;  4NEO A;  2CQ8 A;  2CG5 B;  1ACP A;  2N50 A;  2AFE A;  2K0Y A;  2N6Y A;  2FAD A;  1VKU A;  2KOS A;  2M5R A;  2QNW A;  4H2X C;  2GDW A;  2GDX A;  2KGC A;  2LPK A;  2LOL A;  2MD9 A;  5KP6 B;  2MF4 A;  2KG8 A;  2MR8 A;  5HVC A;  2FVA A;  2FAC A;  2L0Q A;  2L4B A;  2MY5 A;  2FQ2 A;  1AF8 A;  2MVU A;  2K93 A;  2EHS A;  3RG2 A;  3CE7 A;  2LTE A;  2KOP A;  4H2W C;  4DG9 A;  5KP7 B;  2N6Z A;  2LML A;  2LIW A;  2FVF A;  2KG9 A;  5KP8 B;  2AVA A;  1F80 D;  2AF8 A;  2AFD A;  4PXH B;  2K2Q A;  1L0H A;  3EJB A;  2JU1 A;  1NQ4 A;  4PWV B;  3EJD A;  5CZD B;  1L0I A;  1DV5 A;  2LIU A;  3LMO A;  3NY7 B;  3GZL A;  1HQB A;  1HY8 A;  2DNW A;  2PNG A;  2KGD A;  3GZM A;  2EHT A;  2KOR A;  2FQ1 A;  2ROQ A;  4IZ6 A;  2KW2 A;  2JGP A;  1X3O A;  4MRT C;  2KOO A;  2XZ0 D;  2JQ4 A;  2VSQ A;  4BPG A;  2L22 A;  2KR5 A;  4H2Y C;  5EJD A;  4R0M A;  2N98 A;  2XZ1 C;  1DNY A;  2MR7 A;  2KGE A;  2L9F A;  1T8K A;  2KGA A;  2KOQ A;  2X2B A;  2KWL A; 
#chains in the Genus database with same CATH topology
 1Q82 Q;  1OR5 A;  2GDY A;  4IPY A;  4U0E A;  1VHN A;  4UHP B;  2FHS C;  2P9X A;  2EG5 A;  1KLP A;  3DS2 A;  2FAE A;  1RO0 A;  4NEO A;  4F37 A;  2CWO A;  5I4T G;  2JBG A;  2N50 A;  2N6Y A;  1KQS O;  1IMP A;  2LPK A;  1VQ6 P;  3HYB A;  1EIA A;  2M8L A;  2GZF A;  4COP A;  5HVC A;  1ZMB A;  3G4S P;  2L0Q A;  2MY5 A;  1M6N A;  2BUO A;  2KOP A;  5KP7 B;  3CCS P;  1K8A Q;  2N6Z A;  5KP8 B;  1F80 D;  3EJB A;  4PH0 A;  1NQ4 A;  3G0V A;  1VQ7 P;  3EJD A;  2LF4 A;  1M6E X;  1IMQ A;  2Z44 A;  1YHQ P;  2VLQ A;  3LMO A;  4XFZ A;  3CC7 P;  1K73 Q;  2PNG A;  5DCK A;  1M90 Q;  2GZE A;  4PH1 A;  3GZM A;  3B5I A;  1VQK P;  2VSQ A;  3CMA P;  1Z6M A;  1YIT P;  1RO2 A;  4GR6 A;  2KR5 A;  4H2Y C;  1GXG A;  1DNY A;  4WYM A;  2L9F A;  1NJI Q;  2EIA A;  2ERH A;  2X2B A;  5F2N A;  2JU2 A;  2K94 A;  4U0C A;  3CCL P;  5EW5 E;  3CCQ P;  2FQ0 A;  2JO0 A;  3G6E P;  2M8P A;  1YJ9 P;  2K92 A;  3DS0 A;  2FVE A;  2K0X A;  5HV8 A;  2LKI A;  3DS4 A;  2MVV A;  3GJN A;  2JAZ A;  4BPH A;  1W2B O;  3U43 A;  2CG5 B;  1K30 A;  2AFE A;  5HGO A;  2PEK A;  2KOS A;  1A43 A;  2KGC A;  2OTL P;  2LOL A;  5KP6 B;  2MF4 A;  1YJN P;  1D1D A;  2PEO A;  1FR2 A;  1AYI A;  4H2W C;  2LTE A;  4DG9 A;  1YI2 P;  2EFJ A;  2GZJ A;  3CCM P;  4XFX A;  2KG9 A;  2AVA A;  3NTE A;  3LRY A;  3CCV P;  2K2Q A;  1VQM P;  1CEI A;  3OW2 O;  1L0I A;  2XXM A;  2M8N A;  1HQB A;  3DPH A;  2KGD A;  5HGN A;  2GZI A;  2EHT A;  2FQ1 A;  2ROQ A;  3CPW O;  4IZ6 A;  4U0A A;  5BS2 A;  2K0D X;  1X3O A;  4MRT C;  2XZ0 D;  1Q86 Q;  1GXH A;  2XV6 A;  2MR7 A;  3I55 P;  2VLO A;  5JPA A;  1T8K A;  2KOQ A;  1M1K Q;  2BHV A;  3G1G A;  1A8O A;  2KWL A;  1VQN P;  2GZG A;  2CGQ A;  2N5H A;  1YJW P;  3EJE A;  2LL8 A;  2N5I A;  1UNK A;  4HKG A;  2ONT A;  2CNR A;  2PEJ A;  1BXI A;  5HGL A;  4CA3 A;  1Q81 Q;  1ACP A;  2K0Y A;  3HZQ A;  2FAD A;  1QRJ A;  3G26 A;  3G1I A;  2M5R A;  2GDW A;  2MD9 A;  2FVA A;  2FAC A;  2PEI A;  5BS1 A;  2L4B A;  1AF8 A;  3B4Q A;  3RG2 A;  3CE7 A;  3I56 P;  2LML A;  2PEM A;  3DS5 A;  2AF8 A;  2AFD A;  4PXH B;  2JB0 A;  2JU1 A;  4XRQ A;  3CCR P;  1K9M Q;  4PWV B;  1KC8 Q;  2PY8 A;  5CZD B;  1EOQ A;  4XRO A;  2PEN A;  3MGE A;  3GZL A;  3DTJ A;  1HY8 A;  2DNW A;  1E0H A;  1QVG O;  1JJ2 O;  4U0D A;  3E2D A;  2KOR A;  1VQ5 P;  2KW2 A;  3DS3 A;  2Z46 A;  1IUQ A;  2KOO A;  7CEI A;  2K5X A;  4M0I A;  4R0M A;  2N98 A;  2XZ1 C;  2E1M A;  2KGE A;  1BAJ A;  3H0D A;  2KGA A;  3WBH A;  1VQP P;  3CC2 P;  2GYK A;  3G28 A;  1VQL P;  4BPF A;  1ZNV A;  2L6E A;  2OTJ P;  2JYL A;  1Q7Y Q;  3P05 A;  2Z45 A;  2QEX P;  3CME P;  2KOD A;  2PEQ A;  2KG6 A;  3M1M A;  1KD1 Q;  3GKL C;  2CQ8 A;  1UJZ A;  1YIJ P;  4COC A;  3CD6 P;  1VKU A;  2QNW A;  3G29 A;  4H2X C;  2GDX A;  1VQ9 P;  2KG8 A;  3G71 P;  2MR8 A;  1MZ8 A;  2VLP A;  2QA4 P;  2FQ2 A;  2MVU A;  2K93 A;  2EHS A;  1VQO P;  5HGM A;  3CCE P;  2LIW A;  2VLN A;  2FVF A;  3CCU P;  2OAR A;  1AUM A;  3H4E A;  4U0B A;  1L0H A;  3H47 A;  4QNB A;  1M74 A;  2DGY A;  4U0F A;  1VQ8 P;  3CCJ P;  3VRL C;  1N8R Q;  1DV5 A;  2LIU A;  3G21 A;  3NY7 B;  3DS1 A;  2JYG A;  5F2K A;  2WPT A;  1EMV A;  1GPJ A;  2JGP A;  4XFY A;  1VQ4 P;  2JQ4 A;  3RG6 C;  4BPG A;  2L22 A;  5F2O A;  3CXC O;  5EJD A;  2XT1 A;  1RNI A;  1QVF O;  4QKO A;  3Q20 A;  3CC4 P;  1E6J P;  1S72 P;  4GR2 A;  2NO8 A; 
#chains in the Genus database with same CATH homology
 2CGQ A;  2N5H A;  2JU2 A;  4BPF A;  1OR5 A;  3EJE A;  2K94 A;  2LL8 A;  2GDY A;  2FQ0 A;  2N5I A;  2K92 A;  4HKG A;  2FVE A;  2CNR A;  2K0X A;  2FHS C;  5HV8 A;  2LKI A;  2MVV A;  1KLP A;  2KG6 A;  4CA3 A;  4BPH A;  2FAE A;  4NEO A;  2CQ8 A;  2CG5 B;  1ACP A;  2N50 A;  2AFE A;  2K0Y A;  2N6Y A;  2FAD A;  1VKU A;  2KOS A;  2M5R A;  2QNW A;  4H2X C;  2GDW A;  2GDX A;  2KGC A;  2LPK A;  2LOL A;  2MD9 A;  5KP6 B;  2MF4 A;  2KG8 A;  2MR8 A;  5HVC A;  2FVA A;  2FAC A;  2L0Q A;  2L4B A;  2MY5 A;  2FQ2 A;  1AF8 A;  2MVU A;  2K93 A;  2EHS A;  3RG2 A;  3CE7 A;  2LTE A;  2KOP A;  4H2W C;  4DG9 A;  5KP7 B;  2N6Z A;  2LML A;  2LIW A;  2FVF A;  2KG9 A;  5KP8 B;  2AVA A;  1F80 D;  2AF8 A;  2AFD A;  4PXH B;  2K2Q A;  1L0H A;  3EJB A;  2JU1 A;  1NQ4 A;  4PWV B;  3EJD A;  5CZD B;  1L0I A;  1DV5 A;  2LIU A;  3LMO A;  3NY7 B;  3GZL A;  1HQB A;  1HY8 A;  2DNW A;  2PNG A;  2KGD A;  3GZM A;  2EHT A;  2KOR A;  2FQ1 A;  2ROQ A;  4IZ6 A;  2KW2 A;  2JGP A;  1X3O A;  4MRT C;  2KOO A;  2XZ0 D;  2JQ4 A;  2VSQ A;  4BPG A;  2L22 A;  2KR5 A;  4H2Y C;  5EJD A;  4R0M A;  2N98 A;  2XZ1 C;  1DNY A;  2MR7 A;  2KGE A;  2L9F A;  1T8K A;  2KGA A;  2KOQ A;  2X2B A;  2KWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...