5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
b'HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid C-Terminal Domain
publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
5I4TG 4U0CA 1BAJA 3G21A 3DS0A 4U0DA 2M8LA 2JO0A 5DCKA 4XRQA 2LF4A 3VRLC 3DPHA 4XFXA 1QRJA 3MGEA 2JYGA 1EIAA 3G1IA 3G26A 3DTJA 2M8PA 2BUOA 5JPAA 1A43A 3DS1A 1D1DA 5HGNA 2JYLA 4U0EA 3LRYA 2XV6A 3G1GA 4IPYA 5HGLA 2EIAA 3NTEA 3P05A 1A8OA 4QNBA 2KODA 3H4EA 2L6EA 1AUMA 3G29A 5HGOA 3G28A 3DS5A 5HGMA 1EOQA 4XROA 2XT1A 3G0VA 4PH1A 3H47A 4WYMA 4COCA 4U0FA 4PH0A 2ONTA 1E6JP 2XXMA 4U0AA 4U0BA 4M0IA 3DS3A 4XFZA 4XFYA 4COPA 3DS4A 2M8NA 3DS2A
chains in the Genus database with same CATH superfamily
1VQNP 4IZ6A 1DV5A 2JYGA 3DTJA 2FQ2A 5JPAA 2E1MA 3CCQP 3CCSP 3CMEP 2EFJA 1VKUA 2JQ4A 4HKGA 3HZQA 2FACA 4CA3A 2CWOA 3WBHA 2VLNA 2ONTA 1E6JP 2PEIA 3G4SP 1YHQP 2PEKA 2M8NA 3G1IA 2KG8A 1HQBA 2JU2A 2N5IA 2KGCA 1QRJA 2FVFA 3G26A 5F2NA 2M8PA 4U0EA 2EIAA 1KD1Q 2KOQA 3G0VA 2K0YA 3G71P 4COPA 3DS3A 2CQ8A 2JAZA 2ROQA 2CG5B 1HY8A 2GDXA 4DG9A 3G1GA 2K0DX 4H2YC 1VQKP 3DS5A 3RG6C 4XFYA 1VQ6P 3LMOA 3CPWO 3G21A 2KOPA 2AF8A 1IMQA 2QNWA 2BUOA 1L0HA 2MD9A 1L0IA 1E0HA 2L9FA 2EHSA 1NJIQ 1M90Q 3OW2O 2MVUA 2OTJP 2Z46A 2JBGA 3M1MA 2KR5A 1W2BO 3CCUP 2PEJA 1VQ5P 4U0BA 2N6ZA 3DS4A 2MVVA 4PXHB 3CC7P 3CE7A 3B4QA 2JGPA 2AFDA 3GZMA 5BS1A 1K30A 2K2QA 4UHPB 2LIWA 3CMAP 2PY8A 2K5XA 5EW5E 1VQMP 2FAEA 5I4TG 2JO0A 1KLPA 2KW2A 1K73Q 2OTLP 1M74A 1RO0A 2MR7A 4PWVB 5CZDB 2BHVA 4MRTC 3CC2P 2JB0A 1EMVA 2KG9A 2JU1A 3DS2A 4COCA 1Q82Q 1IMPA 1UJZA 1BAJA 1X3OA 3DS0A 5DCKA 2VSQA 2L0QA 1AYIA 2LOLA 1KQSO 1GXHA 2JYLA 3LRYA 1S72P 3I55P 4IPYA 1VQPP 1JJ2O 4QNBA 2FQ0A 2KWLA 2L6EA 5HVCA 3EJDA 1QVFO 2GZJA 2GZGA 3Q20A 4M0IA 1VQLP 2M8LA 2FADA 2LF4A 2LPKA 1EIAA 5KP6B 2L4BA 1Q86Q 4GR2A 3I56P 1VQ7P 2XV6A 2DGYA 2GZFA 2QA4P 3P05A 3B5IA 2K92A 1ZNVA 5KP7B 4BPGA 3G6EP 2Z45A 4H2XC 2PEOA 4GR6A 2KOOA 3CXCO 3GJNA 3GKLC 2VLPA 3NY7B 5F2KA 1VQ4P 2N98A 7CEIA 5HGMA 1DNYA 1N8RQ 1KC8Q 2AVAA 1VQ9P 3CCMP 3DS1A 3E2DA 2GYKA 3RG2A 3EJEA 2GZEA 2KGEA 1YJNP 3G29A 2FVEA 2EG5A 3G28A 1YITP 2N6YA 4WYMA 4U0FA 4PH0A 2K93A 2CNRA 2KOSA 1ACPA 4XRQA 2M5RA 1NQ4A 1YJ9P 1F80D 5KP8B 2GZIA 1A43A 1VQ8P 2QEXP 1ZMBA 1AF8A 1K9MQ 2MF4A 3H4EA 2MY5A 5HGOA 2AFEA 2KG6A 1RO2A 4BPHA 4U0AA 1MZ8A 2DNWA 5F2OA 2P9XA 2CGQA 2PNGA 1M6EX 4U0CA 2WPTA 2LKIA 3VRLC 2XZ0D 1QVGO 1M6NA 3EJBA 2LL8A 2LIUA 1CEIA 3GZLA 2LMLA 2KORA 2K0XA 3CC4P 4H2WC 3HYBA 3CCJP 5HV8A 2Z44A 2VLOA 3DPHA 1RNIA 2XZ1C 1BXIA 4QKOA 4F37A 2KGAA 1D1DA 2PENA 5HGLA 3NTEA 1YI2P 1A8OA 3H0DA 1Q81Q 2ERHA 2N5HA 3CCEP 2FVAA 1GXGA 1Q7YQ 4U0DA 2LTEA 2L22A 2N50A 4XFXA 1GPJA 1VQOP 4R0MA 5HGNA 2KODA 1AUMA 1K8AQ 4XFZA 2EHTA 2MR8A 2OARA 2PEQA 1FR2A 1YIJP 3MGEA 3CD6P 1T8KA 5EJDA 2PEMA 4NEOA 4PH1A 4BPFA 3CCVP 2VLQA 3CCRP 1VHNA 5BS2A 1Z6MA 2GDYA 2GDWA 1M1KQ 1OR5A 1IUQA 3CCLP 2NO8A 1YJWP 2X2BA 2KGDA 2K94A 2FHSC 1UNKA 1EOQA 4XROA 2XT1A 3H47A 3U43A 2XXMA 2FQ1A
chains in the Genus database with same CATH topology
3G6EP 2Z45A 1VQNP 3DPHA 1RNIA 2PEOA 2JYGA 4GR6A 3CC7P 3DTJA 5JPAA 2E1MA 3CXCO 3CCQP 3CCSP 1D1DA 3CMEP 2PENA 5HGLA 1K30A 3NTEA 5BS1A 1YI2P 2EFJA 1A8OA 5F2KA 1VQ4P 3H0DA 3HZQA 3CMAP 1Q81Q 3CCEP 5HGMA 2PY8A 2CWOA 3WBHA 1N8RQ 2ONTA 1E6JP 2PEIA 3G4SP 1YHQP 1KC8Q 2PEKA 1VQMP 3G1IA 2M8NA 1Q7YQ 5I4TG 4U0DA 2JO0A 1VQ9P 1K73Q 4XFXA 1QRJA 1VQOP 2OTLP 3G26A 5F2NA 3CCMP 2M8PA 1M74A 3DS1A 3E2DA 1RO0A 5HGNA 4U0EA 2EIAA 1YJNP 1KD1Q 2BHVA 2KODA 1AUMA 3G29A 1K8AQ 3CC2P 2EG5A 3G28A 1YITP 3G0VA 4WYMA 4U0FA 4PH0A 3G71P 4XFZA 4COPA 3DS3A 3DS2A 4COCA 1Q82Q 1BAJA 3DS0A 2OARA 5DCKA 2PEQA 4XRQA 1YIJP 3MGEA 1YJ9P 1KQSO 1A43A 1VQ8P 2QEXP 1ZMBA 2JYLA 3LRYA 1S72P 3G1GA 3I55P 4IPYA 3CD6P 1VQPP 1K9MQ 1JJ2O 4QNBA 3H4EA 2L6EA 5HGOA 2PEMA 1VQKP 3DS5A 3RG6C 4PH1A 1QVFO 1RO2A 4U0AA 3Q20A 4M0IA 4XFYA 1VQ6P 3CCVP 5F2OA 3CPWO 1VQLP 2P9XA 3CCRP 1M6EX 3G21A 4U0CA 5BS2A 2M8LA 2LF4A 3VRLC 1M1KQ 1EIAA 1QVGO 1IUQA 1Q86Q 2BUOA 3CCLP 4GR2A 3I56P 1YJWP 1M6NA 1VQ7P 2XV6A 2DGYA 2QA4P 3P05A 1NJIQ 1M90Q 3OW2O 3B5IA 2Z46A 2OTJP 3M1MA 1EOQA 4XROA 2XT1A 3CC4P 3H47A 1W2BO 3CCUP 2PEJA 1VQ5P 2XXMA 3HYBA 4U0BA 3CCJP 3DS4A 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4T G;  4U0C A;  1BAJ A;  3G21 A;  3DS0 A;  4U0D A;  2M8L A;  2JO0 A;  5DCK A;  4XRQ A;  2LF4 A;  3VRL C;  3DPH A;  4XFX A;  1QRJ A;  3MGE A;  2JYG A;  1EIA A;  3G1I A;  3G26 A;  3DTJ A;  2M8P A;  2BUO A;  5JPA A;  1A43 A;  3DS1 A;  1D1D A;  5HGN A;  2JYL A;  4U0E A;  3LRY A;  2XV6 A;  3G1G A;  4IPY A;  5HGL A;  2EIA A;  3NTE A;  3P05 A;  1A8O A;  4QNB A;  2KOD A;  3H4E A;  2L6E A;  1AUM A;  3G29 A;  5HGO A;  3G28 A;  3DS5 A;  5HGM A;  1EOQ A;  4XRO A;  2XT1 A;  3G0V A;  4PH1 A;  3H47 A;  4WYM A;  4COC A;  4U0F A;  4PH0 A;  2ONT A;  1E6J P;  2XXM A;  4U0A A;  4U0B A;  4M0I A;  3DS3 A;  4XFZ A;  4XFY A;  4COP A;  3DS4 A;  2M8N A;  3DS2 A; 
#chains in the Genus database with same CATH topology
 1VQN P;  4IZ6 A;  1DV5 A;  2JYG A;  3DTJ A;  2FQ2 A;  5JPA A;  2E1M A;  3CCQ P;  3CCS P;  3CME P;  2EFJ A;  1VKU A;  2JQ4 A;  4HKG A;  3HZQ A;  2FAC A;  4CA3 A;  2CWO A;  3WBH A;  2VLN A;  2ONT A;  1E6J P;  2PEI A;  3G4S P;  1YHQ P;  2PEK A;  2M8N A;  3G1I A;  2KG8 A;  1HQB A;  2JU2 A;  2N5I A;  2KGC A;  1QRJ A;  2FVF A;  3G26 A;  5F2N A;  2M8P A;  4U0E A;  2EIA A;  1KD1 Q;  2KOQ A;  3G0V A;  2K0Y A;  3G71 P;  4COP A;  3DS3 A;  2CQ8 A;  2JAZ A;  2ROQ A;  2CG5 B;  1HY8 A;  2GDX A;  4DG9 A;  3G1G A;  2K0D X;  4H2Y C;  1VQK P;  3DS5 A;  3RG6 C;  4XFY A;  1VQ6 P;  3LMO A;  3CPW O;  3G21 A;  2KOP A;  2AF8 A;  1IMQ A;  2QNW A;  2BUO A;  1L0H A;  2MD9 A;  1L0I A;  1E0H A;  2L9F A;  2EHS A;  1NJI Q;  1M90 Q;  3OW2 O;  2MVU A;  2OTJ P;  2Z46 A;  2JBG A;  3M1M A;  2KR5 A;  1W2B O;  3CCU P;  2PEJ A;  1VQ5 P;  4U0B A;  2N6Z A;  3DS4 A;  2MVV A;  4PXH B;  3CC7 P;  3CE7 A;  3B4Q A;  2JGP A;  2AFD A;  3GZM A;  5BS1 A;  1K30 A;  2K2Q A;  4UHP B;  2LIW A;  3CMA P;  2PY8 A;  2K5X A;  5EW5 E;  1VQM P;  2FAE A;  5I4T G;  2JO0 A;  1KLP A;  2KW2 A;  1K73 Q;  2OTL P;  1M74 A;  1RO0 A;  2MR7 A;  4PWV B;  5CZD B;  2BHV A;  4MRT C;  3CC2 P;  2JB0 A;  1EMV A;  2KG9 A;  2JU1 A;  3DS2 A;  4COC A;  1Q82 Q;  1IMP A;  1UJZ A;  1BAJ A;  1X3O A;  3DS0 A;  5DCK A;  2VSQ A;  2L0Q A;  1AYI A;  2LOL A;  1KQS O;  1GXH A;  2JYL A;  3LRY A;  1S72 P;  3I55 P;  4IPY A;  1VQP P;  1JJ2 O;  4QNB A;  2FQ0 A;  2KWL A;  2L6E A;  5HVC A;  3EJD A;  1QVF O;  2GZJ A;  2GZG A;  3Q20 A;  4M0I A;  1VQL P;  2M8L A;  2FAD A;  2LF4 A;  2LPK A;  1EIA A;  5KP6 B;  2L4B A;  1Q86 Q;  4GR2 A;  3I56 P;  1VQ7 P;  2XV6 A;  2DGY A;  2GZF A;  2QA4 P;  3P05 A;  3B5I A;  2K92 A;  1ZNV A;  5KP7 B;  4BPG A;  3G6E P;  2Z45 A;  4H2X C;  2PEO A;  4GR6 A;  2KOO A;  3CXC O;  3GJN A;  3GKL C;  2VLP A;  3NY7 B;  5F2K A;  1VQ4 P;  2N98 A;  7CEI A;  5HGM A;  1DNY A;  1N8R Q;  1KC8 Q;  2AVA A;  1VQ9 P;  3CCM P;  3DS1 A;  3E2D A;  2GYK A;  3RG2 A;  3EJE A;  2GZE A;  2KGE A;  1YJN P;  3G29 A;  2FVE A;  2EG5 A;  3G28 A;  1YIT P;  2N6Y A;  4WYM A;  4U0F A;  4PH0 A;  2K93 A;  2CNR A;  2KOS A;  1ACP A;  4XRQ A;  2M5R A;  1NQ4 A;  1YJ9 P;  1F80 D;  5KP8 B;  2GZI A;  1A43 A;  1VQ8 P;  2QEX P;  1ZMB A;  1AF8 A;  1K9M Q;  2MF4 A;  3H4E A;  2MY5 A;  5HGO A;  2AFE A;  2KG6 A;  1RO2 A;  4BPH A;  4U0A A;  1MZ8 A;  2DNW A;  5F2O A;  2P9X A;  2CGQ A;  2PNG A;  1M6E X;  4U0C A;  2WPT A;  2LKI A;  3VRL C;  2XZ0 D;  1QVG O;  1M6N A;  3EJB A;  2LL8 A;  2LIU A;  1CEI A;  3GZL A;  2LML A;  2KOR A;  2K0X A;  3CC4 P;  4H2W C;  3HYB A;  3CCJ P;  5HV8 A;  2Z44 A;  2VLO A;  3DPH A;  1RNI A;  2XZ1 C;  1BXI A;  4QKO A;  4F37 A;  2KGA A;  1D1D A;  2PEN A;  5HGL A;  3NTE A;  1YI2 P;  1A8O A;  3H0D A;  1Q81 Q;  2ERH A;  2N5H A;  3CCE P;  2FVA A;  1GXG A;  1Q7Y Q;  4U0D A;  2LTE A;  2L22 A;  2N50 A;  4XFX A;  1GPJ A;  1VQO P;  4R0M A;  5HGN A;  2KOD A;  1AUM A;  1K8A Q;  4XFZ A;  2EHT A;  2MR8 A;  2OAR A;  2PEQ A;  1FR2 A;  1YIJ P;  3MGE A;  3CD6 P;  1T8K A;  5EJD A;  2PEM A;  4NEO A;  4PH1 A;  4BPF A;  3CCV P;  2VLQ A;  3CCR P;  1VHN A;  5BS2 A;  1Z6M A;  2GDY A;  2GDW A;  1M1K Q;  1OR5 A;  1IUQ A;  3CCL P;  2NO8 A;  1YJW P;  2X2B A;  2KGD A;  2K94 A;  2FHS C;  1UNK A;  1EOQ A;  4XRO A;  2XT1 A;  3H47 A;  3U43 A;  2XXM A;  2FQ1 A; 
#chains in the Genus database with same CATH homology
 3G6E P;  2Z45 A;  1VQN P;  3DPH A;  1RNI A;  2PEO A;  2JYG A;  4GR6 A;  3CC7 P;  3DTJ A;  5JPA A;  2E1M A;  3CXC O;  3CCQ P;  3CCS P;  1D1D A;  3CME P;  2PEN A;  5HGL A;  1K30 A;  3NTE A;  5BS1 A;  1YI2 P;  2EFJ A;  1A8O A;  5F2K A;  1VQ4 P;  3H0D A;  3HZQ A;  3CMA P;  1Q81 Q;  3CCE P;  5HGM A;  2PY8 A;  2CWO A;  3WBH A;  1N8R Q;  2ONT A;  1E6J P;  2PEI A;  3G4S P;  1YHQ P;  1KC8 Q;  2PEK A;  1VQM P;  3G1I A;  2M8N A;  1Q7Y Q;  5I4T G;  4U0D A;  2JO0 A;  1VQ9 P;  1K73 Q;  4XFX A;  1QRJ A;  1VQO P;  2OTL P;  3G26 A;  5F2N A;  3CCM P;  2M8P A;  1M74 A;  3DS1 A;  3E2D A;  1RO0 A;  5HGN A;  4U0E A;  2EIA A;  1YJN P;  1KD1 Q;  2BHV A;  2KOD A;  1AUM A;  3G29 A;  1K8A Q;  3CC2 P;  2EG5 A;  3G28 A;  1YIT P;  3G0V A;  4WYM A;  4U0F A;  4PH0 A;  3G71 P;  4XFZ A;  4COP A;  3DS3 A;  3DS2 A;  4COC A;  1Q82 Q;  1BAJ A;  3DS0 A;  2OAR A;  5DCK A;  2PEQ A;  4XRQ A;  1YIJ P;  3MGE A;  1YJ9 P;  1KQS O;  1A43 A;  1VQ8 P;  2QEX P;  1ZMB A;  2JYL A;  3LRY A;  1S72 P;  3G1G A;  3I55 P;  4IPY A;  3CD6 P;  1VQP P;  1K9M Q;  1JJ2 O;  4QNB A;  3H4E A;  2L6E A;  5HGO A;  2PEM A;  1VQK P;  3DS5 A;  3RG6 C;  4PH1 A;  1QVF O;  1RO2 A;  4U0A A;  3Q20 A;  4M0I A;  4XFY A;  1VQ6 P;  3CCV P;  5F2O A;  3CPW O;  1VQL P;  2P9X A;  3CCR P;  1M6E X;  3G21 A;  4U0C A;  5BS2 A;  2M8L A;  2LF4 A;  3VRL C;  1M1K Q;  1EIA A;  1QVG O;  1IUQ A;  1Q86 Q;  2BUO A;  3CCL P;  4GR2 A;  3I56 P;  1YJW P;  1M6N A;  1VQ7 P;  2XV6 A;  2DGY A;  2QA4 P;  3P05 A;  1NJI Q;  1M90 Q;  3OW2 O;  3B5I A;  2Z46 A;  2OTJ P;  3M1M A;  1EOQ A;  4XRO A;  2XT1 A;  3CC4 P;  3H47 A;  1W2B O;  3CCU P;  2PEJ A;  1VQ5 P;  2XXM A;  3HYB A;  4U0B A;  3CCJ P;  3DS4 A;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...