5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
molecule keywords Capsid C-Terminal Domain
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
5JPAA 4COCA 4QNBA 4WYMA 3G0VA 4M0IA 3G28A 4XFZA 3DS5A 4COPA 2EIAA 3G26A 4IPYA 5HGOA 3MGEA 1A8OA 3DS3A 2LF4A 2M8PA 2XXMA 4PH1A 4XFXA 4XFYA 5HGMA 5HGNA 2KODA 4U0DA 3DS1A 3DS2A 3LRYA 2M8LA 2JO0A 4U0EA 3H47A 2JYGA 3DS4A 2ONTA 1EOQA 3NTEA 1A43A 1D1DA 2M8NA 4U0CA 1QRJA 2JYLA 2XV6A 3G29A 3G1GA 5I4TG 3DS0A 1E6JP 1EIAA 3VRLC 2BUOA 3DTJA 4U0AA 5DCKA 3P05A 3G1IA 2XT1A 3G21A 4XRQA 1BAJA 4U0FA 4XROA 1AUMA 3H4EA 5HGLA 4U0BA 3DPHA 2L6EA 4PH0A
chains in the Genus database with same CATH superfamily
4COCA 2MF4A 2K93A 4M0IA 3CCLP 3G4SP 2JU1A 7CEIA 3CCSP 1CEIA 1DV5A 1E6JP 3DTJA 2K5XA 3H0DA 2K0XA 1VQ8P 4BPHA 2JU2A 2L0QA 3CMEP 4XFXA 1YI2P 3LRYA 2FAEA 2QNWA 3B5IA 1QVFO 2M8NA 4BPGA 1QRJA 5I4TG 2L22A 1Z6MA 2CGQA 3P05A 5F2OA 2AF8A 1YHQP 4U0BA 2OTJP 3CD6P 1W2BO 1DNYA 2NO8A 2PEKA 2EIAA 1T8KA 2KGCA 2AFDA 2LTEA 2JO0A 2BHVA 2K92A 2VLOA 3GZMA 3CE7A 1AUMA 2GZFA 3RG2A 1UJZA 2FHSC 5HGNA 3HZQA 2KGDA 2VSQA 3GJNA 3CPWO 4PXHB 2JYGA 3CCRP 2MVUA 4HKGA 4U0CA 1GXGA 2Z44A 2XZ1C 2KOQA 4U0AA 2EG5A 2CQ8A 2PNGA 3G21A 2N5HA 4PWVB 2GZEA 2N5IA 2CNRA 1KC8Q 4H2WC 3MGEA 1A8OA 1HQBA 3HYBA 1VQ7P 4U0EA 5BS1A 2L9FA 1YJWP 4H2XC 5DCKA 3I56P 1L0IA 1ZMBA 3LMOA 3H4EA 3RG6C 3B4QA 4XFZA 5KP8B 5HGOA 1GPJA 2MR8A 4XFYA 2P9XA 5EJDA 3DS4A 1EOQA 2KWLA 5HVCA 2KORA 1YIJP 1EIAA 2EFJA 2GDXA 2K94A 2PENA 1K73Q 1KLPA 3Q20A 1Q86Q 3I55P 1L0HA 3CC4P 4BPFA 2JGPA 2KGEA 4COPA 1M1KQ 1N8RQ 2CG5B 3G26A 1M6NA 2EHSA 3CCMP 2FQ1A 2LF4A 2PEIA 4GR2A 2VLPA 2FVAA 3G6EP 2FACA 2Z45A 4F37A 1VQ5P 3G71P 4XROA 2KG9A 2DGYA 1IUQA 2GZIA 2JBGA 4QNBA 5JPAA 3G28A 1JJ2O 1IMQA 2GDWA 2KODA 3DS1A 1YJ9P 2M8LA 2JAZA 2ONTA 3CCUP 3CMAP 1Q7YQ 2FADA 2AVAA 4MRTC 4DG9A 2MR7A 2MD9A 3CCJP 2K2QA 1HY8A 5HGMA 2M8PA 2XXMA 2WPTA 2K0DX 1RNIA 3NTEA 2JYLA 2FQ0A 3G29A 5BS2A 2OTLP 2MY5A 1ZNVA 3NY7B 3OW2O 2LKIA 4IPYA 1QVGO 1VHNA 3DS2A 1F80D 2KG8A 1KD1Q 2PEJA 2PY8A 3GZLA 2K0YA 2KW2A 1VQKP 3CCEP 2KOOA 2LIUA 3GKLC 4PH0A 3CC7P 3CC2P 1VKUA 1S72P 3E2DA 3DS5A 1FR2A 2LL8A 5EW5E 2M5RA 1BXIA 2EHTA 2GDYA 2LIWA 2LPKA 2N50A 2GZGA 2QA4P 1YITP 1K9MQ 1VQOP 1Q81Q 1VQ4P 2OARA 3DS0A 2FQ2A 2DNWA 3G1IA 1BAJA 1KQSO 2AFEA 2L6EA 1Q82Q 4QKOA 1VQ6P 3CCVP 1M6EX 4IZ6A 5F2NA 1NJIQ 2XV6A 2ERHA 1VQMP 2KGAA 4XRQA 2XZ0D 3DPHA 1VQNP 3U43A 2N6ZA 1K30A 3WBHA 1AYIA 1GXHA 2JQ4A 2KG6A 2KOPA 2VLNA 3G1GA 1IMPA 5CZDB 2ROQA 1EMVA 3CCQP 2LMLA 1YJNP 3G0VA 1VQ9P 2GZJA 3EJDA 5KP7B 1M74A 3DS3A 2GYKA 1K8AQ 4U0DA 1NQ4A 2KR5A 1A43A 1D1DA 2X2BA 2Z46A 4R0MA 2KOSA 1E0HA 2JB0A 5F2KA 2L4BA 5HGLA 2N98A 4U0FA 1ACPA 2PEQA 1RO2A 3EJBA 1UNKA 1RO0A 3EJEA 3CXCO 4CA3A 1AF8A 3H47A 2MVVA 2FVFA 1OR5A 3VRLC 4UHPB 2BUOA 2FVEA 1X3OA 2LOLA 4WYMA 2PEMA 2E1MA 5HV8A 1VQPP 4PH1A 2VLQA 1M90Q 1VQLP 2CWOA 4NEOA 4H2YC 4GR6A 2QEXP 2PEOA 1MZ8A 3M1MA 2XT1A 5KP6B 2N6YA
chains in the Genus database with same CATH topology
4COCA 4M0IA 1KC8Q 3CCLP 1K30A 3G4SP 3MGEA 1A8OA 5HGMA 2M8PA 2XXMA 3WBHA 3HYBA 1VQ7P 3CCSP 4U0EA 1RNIA 3NTEA 5BS1A 1YJWP 2JYLA 3G29A 3G1GA 5BS2A 1E6JP 3DTJA 5DCKA 3H0DA 3I56P 2OTLP 1ZMBA 1VQ8P 3H4EA 3RG6C 3CCQP 1YJNP 3G0VA 3OW2O 1VQ9P 4XFZA 5HGOA 4IPYA 1M74A 3CMEP 4XFXA 3DS3A 4XFYA 1QVGO 1K8AQ 1YI2P 2P9XA 4U0DA 3DS2A 3LRYA 3DS4A 1EOQA 3B5IA 1KD1Q 1QVFO 2PEJA 1A43A 2PY8A 2M8NA 1D1DA 1QRJA 2Z46A 1YIJP 5I4TG 1EIAA 2EFJA 3P05A 5F2OA 1VQKP 5F2KA 2PENA 5HGLA 4U0FA 1YHQP 1K73Q 3CCEP 4U0BA 3Q20A 1Q86Q 3I55P 2OTJP 2PEQA 4PH0A 3CC4P 3CC7P 3CC2P 1W2BO 3CD6P 1RO2A 1S72P 3E2DA 2PEKA 3DS5A 4COPA 1N8RQ 1M1KQ 1M6NA 2EIAA 3G26A 3CCMP 2LF4A 2PEIA 1RO0A 3CXCO 2JO0A 2BHVA 3H47A 2QA4P 1YITP 4GR2A 1K9MQ 1VQOP 1Q81Q 3G6EP 1VQ4P 2OARA 3DS0A 3VRLC 2BUOA 2Z45A 1VQ5P 3G71P 3G1IA 4XROA 1BAJA 1KQSO 1AUMA 2DGYA 2L6EA 1IUQA 5JPAA 4QNBA 4WYMA 1Q82Q 2PEMA 3G28A 2E1MA 1VQPP 1JJ2O 5HGNA 4PH1A 1VQ6P 3HZQA 2KODA 3DS1A 3CCVP 1YJ9P 2M8LA 1M90Q 3CPWO 2JYGA 1M6EX 2ONTA 3CCRP 3CCUP 5F2NA 1VQLP 2CWOA 4U0CA 3CMAP 1Q7YQ 1NJIQ 2XV6A 4GR6A 2QEXP 2Z44A 4U0AA 1VQMP 2EG5A 2PEOA 3M1MA 2XT1A 3G21A 4XRQA 3CCJP 3DPHA 1VQNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  4COC A;  4QNB A;  4WYM A;  3G0V A;  4M0I A;  3G28 A;  4XFZ A;  3DS5 A;  4COP A;  2EIA A;  3G26 A;  4IPY A;  5HGO A;  3MGE A;  1A8O A;  3DS3 A;  2LF4 A;  2M8P A;  2XXM A;  4PH1 A;  4XFX A;  4XFY A;  5HGM A;  5HGN A;  2KOD A;  4U0D A;  3DS1 A;  3DS2 A;  3LRY A;  2M8L A;  2JO0 A;  4U0E A;  3H47 A;  2JYG A;  3DS4 A;  2ONT A;  1EOQ A;  3NTE A;  1A43 A;  1D1D A;  2M8N A;  4U0C A;  1QRJ A;  2JYL A;  2XV6 A;  3G29 A;  3G1G A;  5I4T G;  3DS0 A;  1E6J P;  1EIA A;  3VRL C;  2BUO A;  3DTJ A;  4U0A A;  5DCK A;  3P05 A;  3G1I A;  2XT1 A;  3G21 A;  4XRQ A;  1BAJ A;  4U0F A;  4XRO A;  1AUM A;  3H4E A;  5HGL A;  4U0B A;  3DPH A;  2L6E A;  4PH0 A; 
#chains in the Genus database with same CATH topology
 4COC A;  2MF4 A;  2K93 A;  4M0I A;  3CCL P;  3G4S P;  2JU1 A;  7CEI A;  3CCS P;  1CEI A;  1DV5 A;  1E6J P;  3DTJ A;  2K5X A;  3H0D A;  2K0X A;  1VQ8 P;  4BPH A;  2JU2 A;  2L0Q A;  3CME P;  4XFX A;  1YI2 P;  3LRY A;  2FAE A;  2QNW A;  3B5I A;  1QVF O;  2M8N A;  4BPG A;  1QRJ A;  5I4T G;  2L22 A;  1Z6M A;  2CGQ A;  3P05 A;  5F2O A;  2AF8 A;  1YHQ P;  4U0B A;  2OTJ P;  3CD6 P;  1W2B O;  1DNY A;  2NO8 A;  2PEK A;  2EIA A;  1T8K A;  2KGC A;  2AFD A;  2LTE A;  2JO0 A;  2BHV A;  2K92 A;  2VLO A;  3GZM A;  3CE7 A;  1AUM A;  2GZF A;  3RG2 A;  1UJZ A;  2FHS C;  5HGN A;  3HZQ A;  2KGD A;  2VSQ A;  3GJN A;  3CPW O;  4PXH B;  2JYG A;  3CCR P;  2MVU A;  4HKG A;  4U0C A;  1GXG A;  2Z44 A;  2XZ1 C;  2KOQ A;  4U0A A;  2EG5 A;  2CQ8 A;  2PNG A;  3G21 A;  2N5H A;  4PWV B;  2GZE A;  2N5I A;  2CNR A;  1KC8 Q;  4H2W C;  3MGE A;  1A8O A;  1HQB A;  3HYB A;  1VQ7 P;  4U0E A;  5BS1 A;  2L9F A;  1YJW P;  4H2X C;  5DCK A;  3I56 P;  1L0I A;  1ZMB A;  3LMO A;  3H4E A;  3RG6 C;  3B4Q A;  4XFZ A;  5KP8 B;  5HGO A;  1GPJ A;  2MR8 A;  4XFY A;  2P9X A;  5EJD A;  3DS4 A;  1EOQ A;  2KWL A;  5HVC A;  2KOR A;  1YIJ P;  1EIA A;  2EFJ A;  2GDX A;  2K94 A;  2PEN A;  1K73 Q;  1KLP A;  3Q20 A;  1Q86 Q;  3I55 P;  1L0H A;  3CC4 P;  4BPF A;  2JGP A;  2KGE A;  4COP A;  1M1K Q;  1N8R Q;  2CG5 B;  3G26 A;  1M6N A;  2EHS A;  3CCM P;  2FQ1 A;  2LF4 A;  2PEI A;  4GR2 A;  2VLP A;  2FVA A;  3G6E P;  2FAC A;  2Z45 A;  4F37 A;  1VQ5 P;  3G71 P;  4XRO A;  2KG9 A;  2DGY A;  1IUQ A;  2GZI A;  2JBG A;  4QNB A;  5JPA A;  3G28 A;  1JJ2 O;  1IMQ A;  2GDW A;  2KOD A;  3DS1 A;  1YJ9 P;  2M8L A;  2JAZ A;  2ONT A;  3CCU P;  3CMA P;  1Q7Y Q;  2FAD A;  2AVA A;  4MRT C;  4DG9 A;  2MR7 A;  2MD9 A;  3CCJ P;  2K2Q A;  1HY8 A;  5HGM A;  2M8P A;  2XXM A;  2WPT A;  2K0D X;  1RNI A;  3NTE A;  2JYL A;  2FQ0 A;  3G29 A;  5BS2 A;  2OTL P;  2MY5 A;  1ZNV A;  3NY7 B;  3OW2 O;  2LKI A;  4IPY A;  1QVG O;  1VHN A;  3DS2 A;  1F80 D;  2KG8 A;  1KD1 Q;  2PEJ A;  2PY8 A;  3GZL A;  2K0Y A;  2KW2 A;  1VQK P;  3CCE P;  2KOO A;  2LIU A;  3GKL C;  4PH0 A;  3CC7 P;  3CC2 P;  1VKU A;  1S72 P;  3E2D A;  3DS5 A;  1FR2 A;  2LL8 A;  5EW5 E;  2M5R A;  1BXI A;  2EHT A;  2GDY A;  2LIW A;  2LPK A;  2N50 A;  2GZG A;  2QA4 P;  1YIT P;  1K9M Q;  1VQO P;  1Q81 Q;  1VQ4 P;  2OAR A;  3DS0 A;  2FQ2 A;  2DNW A;  3G1I A;  1BAJ A;  1KQS O;  2AFE A;  2L6E A;  1Q82 Q;  4QKO A;  1VQ6 P;  3CCV P;  1M6E X;  4IZ6 A;  5F2N A;  1NJI Q;  2XV6 A;  2ERH A;  1VQM P;  2KGA A;  4XRQ A;  2XZ0 D;  3DPH A;  1VQN P;  3U43 A;  2N6Z A;  1K30 A;  3WBH A;  1AYI A;  1GXH A;  2JQ4 A;  2KG6 A;  2KOP A;  2VLN A;  3G1G A;  1IMP A;  5CZD B;  2ROQ A;  1EMV A;  3CCQ P;  2LML A;  1YJN P;  3G0V A;  1VQ9 P;  2GZJ A;  3EJD A;  5KP7 B;  1M74 A;  3DS3 A;  2GYK A;  1K8A Q;  4U0D A;  1NQ4 A;  2KR5 A;  1A43 A;  1D1D A;  2X2B A;  2Z46 A;  4R0M A;  2KOS A;  1E0H A;  2JB0 A;  5F2K A;  2L4B A;  5HGL A;  2N98 A;  4U0F A;  1ACP A;  2PEQ A;  1RO2 A;  3EJB A;  1UNK A;  1RO0 A;  3EJE A;  3CXC O;  4CA3 A;  1AF8 A;  3H47 A;  2MVV A;  2FVF A;  1OR5 A;  3VRL C;  4UHP B;  2BUO A;  2FVE A;  1X3O A;  2LOL A;  4WYM A;  2PEM A;  2E1M A;  5HV8 A;  1VQP P;  4PH1 A;  2VLQ A;  1M90 Q;  1VQL P;  2CWO A;  4NEO A;  4H2Y C;  4GR6 A;  2QEX P;  2PEO A;  1MZ8 A;  3M1M A;  2XT1 A;  5KP6 B;  2N6Y A; 
#chains in the Genus database with same CATH homology
 4COC A;  4M0I A;  1KC8 Q;  3CCL P;  1K30 A;  3G4S P;  3MGE A;  1A8O A;  5HGM A;  2M8P A;  2XXM A;  3WBH A;  3HYB A;  1VQ7 P;  3CCS P;  4U0E A;  1RNI A;  3NTE A;  5BS1 A;  1YJW P;  2JYL A;  3G29 A;  3G1G A;  5BS2 A;  1E6J P;  3DTJ A;  5DCK A;  3H0D A;  3I56 P;  2OTL P;  1ZMB A;  1VQ8 P;  3H4E A;  3RG6 C;  3CCQ P;  1YJN P;  3G0V A;  3OW2 O;  1VQ9 P;  4XFZ A;  5HGO A;  4IPY A;  1M74 A;  3CME P;  4XFX A;  3DS3 A;  4XFY A;  1QVG O;  1K8A Q;  1YI2 P;  2P9X A;  4U0D A;  3DS2 A;  3LRY A;  3DS4 A;  1EOQ A;  3B5I A;  1KD1 Q;  1QVF O;  2PEJ A;  1A43 A;  2PY8 A;  2M8N A;  1D1D A;  1QRJ A;  2Z46 A;  1YIJ P;  5I4T G;  1EIA A;  2EFJ A;  3P05 A;  5F2O A;  1VQK P;  5F2K A;  2PEN A;  5HGL A;  4U0F A;  1YHQ P;  1K73 Q;  3CCE P;  4U0B A;  3Q20 A;  1Q86 Q;  3I55 P;  2OTJ P;  2PEQ A;  4PH0 A;  3CC4 P;  3CC7 P;  3CC2 P;  1W2B O;  3CD6 P;  1RO2 A;  1S72 P;  3E2D A;  2PEK A;  3DS5 A;  4COP A;  1N8R Q;  1M1K Q;  1M6N A;  2EIA A;  3G26 A;  3CCM P;  2LF4 A;  2PEI A;  1RO0 A;  3CXC O;  2JO0 A;  2BHV A;  3H47 A;  2QA4 P;  1YIT P;  4GR2 A;  1K9M Q;  1VQO P;  1Q81 Q;  3G6E P;  1VQ4 P;  2OAR A;  3DS0 A;  3VRL C;  2BUO A;  2Z45 A;  1VQ5 P;  3G71 P;  3G1I A;  4XRO A;  1BAJ A;  1KQS O;  1AUM A;  2DGY A;  2L6E A;  1IUQ A;  5JPA A;  4QNB A;  4WYM A;  1Q82 Q;  2PEM A;  3G28 A;  2E1M A;  1VQP P;  1JJ2 O;  5HGN A;  4PH1 A;  1VQ6 P;  3HZQ A;  2KOD A;  3DS1 A;  3CCV P;  1YJ9 P;  2M8L A;  1M90 Q;  3CPW O;  2JYG A;  1M6E X;  2ONT A;  3CCR P;  3CCU P;  5F2N A;  1VQL P;  2CWO A;  4U0C A;  3CMA P;  1Q7Y Q;  1NJI Q;  2XV6 A;  4GR6 A;  2QEX P;  2Z44 A;  4U0A A;  1VQM P;  2EG5 A;  2PEO A;  3M1M A;  2XT1 A;  3G21 A;  4XRQ A;  3CCJ P;  3DPH A;  1VQN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...