5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid C-Terminal Domain
publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
3G26A 3DPHA 1AUMA 3G1IA 3P05A 4WYMA 2XT1A 3DS1A 1A43A 4XROA 5HGMA 2M8NA 2BUOA 2XV6A 3G28A 2M8PA 2M8LA 2EIAA 4COCA 4M0IA 3G0VA 2XXMA 1D1DA 2JYLA 4U0EA 2JYGA 3DS0A 3DS3A 4IPYA 3H4EA 4XFZA 3NTEA 5I4TG 5DCKA 4PH1A 1EIAA 3G29A 5HGOA 1EOQA 3H47A 3DS5A 2ONTA 5HGNA 2L6EA 4XFYA 5JPAA 1E6JP 2KODA 4QNBA 4PH0A 3DTJA 4U0BA 3DS4A 3MGEA 4U0AA 4U0CA 1BAJA 4U0FA 1QRJA 3DS2A 4U0DA 2LF4A 2JO0A 3LRYA 4XFXA 5HGLA 4COPA 3VRLC 3G21A 4XRQA 1A8OA 3G1GA
chains in the Genus database with same CATH superfamily
2KGCA 3G71P 1A43A 1OR5A 3CCSP 4BPHA 3Q20A 5HVCA 3B4QA 3H4EA 3CCUP 5HGNA 2OTJP 3HYBA 1DV5A 5KP8B 1E6JP 2PEJA 4H2WC 5HV8A 2FHSC 3CCVP 1VQ5P 1QVGO 2M5RA 2M8NA 4NEOA 3GZMA 2ROQA 4GR2A 2BHVA 2PEOA 2KGEA 2N6YA 3G4SP 2KR5A 1EIAA 3H0DA 4R0MA 3MGEA 1HY8A 1YI2P 1A8OA 2NO8A 3G1GA 3CXCO 2XV6A 2KWLA 1YJ9P 3GKLC 2JU1A 2L9FA 2Z46A 1VHNA 4XFYA 2GYKA 4COPA 2FVFA 2CGQA 2KG8A 2FQ1A 2AFDA 2QNWA 1VQ8P 4MRTC 2CQ8A 1VQ9P 5F2KA 1AYIA 1M6EX 1W2BO 2N6ZA 1L0IA 1DNYA 3GZLA 3CMAP 1RO2A 2KG6A 1QRJA 4GR6A 2PENA 1GPJA 3VRLC 3G21A 2FAEA 2N5HA 1ACPA 2GZFA 2BUOA 3G0VA 2JBGA 2JYLA 2GZJA 1M74A 2PY8A 2N50A 3CPWO 3NTEA 3OW2O 2L4BA 1FR2A 3G29A 1VQKP 5KP6B 1UJZA 2L22A 3EJBA 5F2NA 5CZDB 5BS2A 5EJDA 2EHTA 2GZEA 2DGYA 3CCMP 1K8AQ 1YJWP 2K2QA 2KOPA 2XZ0D 1VQNP 1Q81Q 2FVEA 2VSQA 1YIJP 2K94A 5EW5E 1RO0A 5BS1A 4U0EA 1GXHA 2GZIA 2N98A 2PEQA 3EJEA 2PEMA 4QNBA 1KC8Q 1BAJA 1X3OA 1HQBA 5HGLA 4XRQA 2MY5A 2FVAA 1VKUA 4HKGA 1YJNP 1M1KQ 2AFEA 2MF4A 3LMOA 3I55P 1YITP 3G6EP 2K92A 2ERHA 5DCKA 2X2BA 1L0HA 3M1MA 3HZQA 3DPHA 1AUMA 1M90Q 2KOSA 2FACA 2M8PA 3CD6P 3CCLP 2QA4P 2EHSA 2CWOA 1K73Q 1IMPA 2WPTA 1Q82Q 4QKOA 2VLQA 4PH0A 3CCRP 2CG5B 2LIWA 2AF8A 4XROA 5HGMA 2K0DX 2EIAA 2KGDA 1GXGA 2LIUA 4DG9A 2JYGA 2K0YA 2VLNA 2LL8A 1K30A 2VLOA 1EOQA 3RG6C 1IUQA 4U0BA 3NY7B 1N8RQ 3I56P 2GDWA 2M8LA 1VQ4P 2CNRA 2MR7A 3WBHA 2KORA 5F2OA 3DS3A 1QVFO 2JQ4A 2KW2A 3DS5A 2E1MA 4PXHB 1NJIQ 2L0QA 2K0XA 4WYMA 1VQOP 2Z44A 3CE7A 1VQ7P 4IZ6A 4COCA 1KD1Q 2LKIA 1JJ2O 1CEIA 2EG5A 2MVUA 2JGPA 2PNGA 3DS0A 3CC7P 1Q7YQ 4CA3A 2MVVA 2ONTA 2QEXP 2LOLA 2KODA 2OTLP 1VQMP 1S72P 3LRYA 1BXIA 2GDXA 3G26A 3P05A 2XT1A 3E2DA 2FQ2A 1M6NA 2EFJA 4M0IA 5KP7B 2FADA 1D1DA 2LPKA 4BPGA 3CMEP 1K9MQ 3H47A 2PEIA 3GJNA 1RNIA 2P9XA 3DS1A 2LMLA 4BPFA 2JAZA 2GDYA 1T8KA 4PWVB 1IMQA 1MZ8A 2JB0A 1Q86Q 3DS4A 4U0AA 3EJDA 3CCQP 3DS2A 4XFXA 1KQSO 3CC4P 2Z45A 1VQPP 2XXMA 4F37A 1EMVA 2XZ1C 1F80D 2JU2A 4XFZA 4H2XC 3CC2P 4UHPB 2L6EA 7CEIA 1ZMBA 4H2YC 2KOQA 4U0CA 1ZNVA 2KGAA 2JO0A 2KOOA 2MR8A 2K93A 4IPYA 2PEKA 1AF8A 5JPAA 2MD9A 3DTJA 1E0HA 2OARA 1UNKA 2LTEA 2KG9A 3G1IA 2FQ0A 1VQLP 2N5IA 3G28A 3CCJP 1NQ4A 3CCEP 1KLPA 2GZGA 5I4TG 2VLPA 4PH1A 3U43A 3B5IA 5HGOA 1VQ6P 2AVAA 2K5XA 1Z6MA 4U0DA 1YHQP 4U0FA 2LF4A 2DNWA 3RG2A
chains in the Genus database with same CATH topology
2P9XA 3G71P 3DS1A 1A43A 2BUOA 3CCSP 2EIAA 3G0VA 3Q20A 2JYLA 1M74A 2JYGA 2PY8A 3CPWO 1K30A 3H4EA 3CCUP 3NTEA 3OW2O 3G29A 1EOQA 1VQKP 3RG6C 5HGNA 2OTJP 3HYBA 1IUQA 1E6JP 2PEJA 1Q86Q 4U0BA 5F2NA 3DS4A 4U0AA 3CCQP 3DS2A 4XFXA 5BS2A 1N8RQ 3I56P 2DGYA 3CCMP 1K8AQ 3CCVP 2M8LA 1VQ5P 1YJWP 1KQSO 1VQNP 1QVGO 1Q81Q 2Z45A 3CC4P 1VQPP 1VQ4P 2M8NA 1YIJP 4GR2A 2BHVA 2PEOA 2XXMA 1RO0A 5BS1A 4U0EA 3WBHA 5F2OA 3DS3A 4XFZA 3G4SP 1EIAA 1QVFO 3CC2P 3DS5A 3H0DA 2L6EA 2PEQA 2PEMA 1ZMBA 4QNBA 1KC8Q 2E1MA 3MGEA 4U0CA 1BAJA 1NJIQ 2JO0A 1YI2P 5HGLA 4XRQA 1A8OA 3G1GA 4WYMA 1VQOP 3CXCO 5HGMA 2Z44A 2XV6A 1VQ7P 1YJ9P 4COCA 1YJNP 1M1KQ 1KD1Q 1JJ2O 2EG5A 3DS0A 2Z46A 3CC7P 4IPYA 3I55P 1YITP 2PEKA 1Q7YQ 3G6EP 2ONTA 2QEXP 5JPAA 4XFYA 2KODA 2OTLP 1VQMP 3DTJA 5DCKA 1S72P 2OARA 3LRYA 4COPA 3M1MA 3HZQA 3G26A 3DPHA 1AUMA 3G1IA 3P05A 1M90Q 2XT1A 3E2DA 1VQLP 3G28A 1M6NA 1VQ8P 2M8PA 1VQ9P 2EFJA 3CD6P 4M0IA 5F2KA 3CCJP 3CCEP 3CCLP 2QA4P 1D1DA 1M6EX 1W2BO 5I4TG 2CWOA 1K73Q 3CMAP 1RO2A 4PH1A 3CMEP 3B5IA 5HGOA 1K9MQ 1VQ6P 3H47A 2PEIA 1Q82Q 4PH0A 3CCRP 4U0DA 1YHQP 4U0FA 1QRJA 4GR6A 1RNIA 2LF4A 2PENA 3VRLC 3G21A 4XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G26 A;  3DPH A;  1AUM A;  3G1I A;  3P05 A;  4WYM A;  2XT1 A;  3DS1 A;  1A43 A;  4XRO A;  5HGM A;  2M8N A;  2BUO A;  2XV6 A;  3G28 A;  2M8P A;  2M8L A;  2EIA A;  4COC A;  4M0I A;  3G0V A;  2XXM A;  1D1D A;  2JYL A;  4U0E A;  2JYG A;  3DS0 A;  3DS3 A;  4IPY A;  3H4E A;  4XFZ A;  3NTE A;  5I4T G;  5DCK A;  4PH1 A;  1EIA A;  3G29 A;  5HGO A;  1EOQ A;  3H47 A;  3DS5 A;  2ONT A;  5HGN A;  2L6E A;  4XFY A;  5JPA A;  1E6J P;  2KOD A;  4QNB A;  4PH0 A;  3DTJ A;  4U0B A;  3DS4 A;  3MGE A;  4U0A A;  4U0C A;  1BAJ A;  4U0F A;  1QRJ A;  3DS2 A;  4U0D A;  2LF4 A;  2JO0 A;  3LRY A;  4XFX A;  5HGL A;  4COP A;  3VRL C;  3G21 A;  4XRQ A;  1A8O A;  3G1G A; 
#chains in the Genus database with same CATH topology
 2KGC A;  3G71 P;  1A43 A;  1OR5 A;  3CCS P;  4BPH A;  3Q20 A;  5HVC A;  3B4Q A;  3H4E A;  3CCU P;  5HGN A;  2OTJ P;  3HYB A;  1DV5 A;  5KP8 B;  1E6J P;  2PEJ A;  4H2W C;  5HV8 A;  2FHS C;  3CCV P;  1VQ5 P;  1QVG O;  2M5R A;  2M8N A;  4NEO A;  3GZM A;  2ROQ A;  4GR2 A;  2BHV A;  2PEO A;  2KGE A;  2N6Y A;  3G4S P;  2KR5 A;  1EIA A;  3H0D A;  4R0M A;  3MGE A;  1HY8 A;  1YI2 P;  1A8O A;  2NO8 A;  3G1G A;  3CXC O;  2XV6 A;  2KWL A;  1YJ9 P;  3GKL C;  2JU1 A;  2L9F A;  2Z46 A;  1VHN A;  4XFY A;  2GYK A;  4COP A;  2FVF A;  2CGQ A;  2KG8 A;  2FQ1 A;  2AFD A;  2QNW A;  1VQ8 P;  4MRT C;  2CQ8 A;  1VQ9 P;  5F2K A;  1AYI A;  1M6E X;  1W2B O;  2N6Z A;  1L0I A;  1DNY A;  3GZL A;  3CMA P;  1RO2 A;  2KG6 A;  1QRJ A;  4GR6 A;  2PEN A;  1GPJ A;  3VRL C;  3G21 A;  2FAE A;  2N5H A;  1ACP A;  2GZF A;  2BUO A;  3G0V A;  2JBG A;  2JYL A;  2GZJ A;  1M74 A;  2PY8 A;  2N50 A;  3CPW O;  3NTE A;  3OW2 O;  2L4B A;  1FR2 A;  3G29 A;  1VQK P;  5KP6 B;  1UJZ A;  2L22 A;  3EJB A;  5F2N A;  5CZD B;  5BS2 A;  5EJD A;  2EHT A;  2GZE A;  2DGY A;  3CCM P;  1K8A Q;  1YJW P;  2K2Q A;  2KOP A;  2XZ0 D;  1VQN P;  1Q81 Q;  2FVE A;  2VSQ A;  1YIJ P;  2K94 A;  5EW5 E;  1RO0 A;  5BS1 A;  4U0E A;  1GXH A;  2GZI A;  2N98 A;  2PEQ A;  3EJE A;  2PEM A;  4QNB A;  1KC8 Q;  1BAJ A;  1X3O A;  1HQB A;  5HGL A;  4XRQ A;  2MY5 A;  2FVA A;  1VKU A;  4HKG A;  1YJN P;  1M1K Q;  2AFE A;  2MF4 A;  3LMO A;  3I55 P;  1YIT P;  3G6E P;  2K92 A;  2ERH A;  5DCK A;  2X2B A;  1L0H A;  3M1M A;  3HZQ A;  3DPH A;  1AUM A;  1M90 Q;  2KOS A;  2FAC A;  2M8P A;  3CD6 P;  3CCL P;  2QA4 P;  2EHS A;  2CWO A;  1K73 Q;  1IMP A;  2WPT A;  1Q82 Q;  4QKO A;  2VLQ A;  4PH0 A;  3CCR P;  2CG5 B;  2LIW A;  2AF8 A;  4XRO A;  5HGM A;  2K0D X;  2EIA A;  2KGD A;  1GXG A;  2LIU A;  4DG9 A;  2JYG A;  2K0Y A;  2VLN A;  2LL8 A;  1K30 A;  2VLO A;  1EOQ A;  3RG6 C;  1IUQ A;  4U0B A;  3NY7 B;  1N8R Q;  3I56 P;  2GDW A;  2M8L A;  1VQ4 P;  2CNR A;  2MR7 A;  3WBH A;  2KOR A;  5F2O A;  3DS3 A;  1QVF O;  2JQ4 A;  2KW2 A;  3DS5 A;  2E1M A;  4PXH B;  1NJI Q;  2L0Q A;  2K0X A;  4WYM A;  1VQO P;  2Z44 A;  3CE7 A;  1VQ7 P;  4IZ6 A;  4COC A;  1KD1 Q;  2LKI A;  1JJ2 O;  1CEI A;  2EG5 A;  2MVU A;  2JGP A;  2PNG A;  3DS0 A;  3CC7 P;  1Q7Y Q;  4CA3 A;  2MVV A;  2ONT A;  2QEX P;  2LOL A;  2KOD A;  2OTL P;  1VQM P;  1S72 P;  3LRY A;  1BXI A;  2GDX A;  3G26 A;  3P05 A;  2XT1 A;  3E2D A;  2FQ2 A;  1M6N A;  2EFJ A;  4M0I A;  5KP7 B;  2FAD A;  1D1D A;  2LPK A;  4BPG A;  3CME P;  1K9M Q;  3H47 A;  2PEI A;  3GJN A;  1RNI A;  2P9X A;  3DS1 A;  2LML A;  4BPF A;  2JAZ A;  2GDY A;  1T8K A;  4PWV B;  1IMQ A;  1MZ8 A;  2JB0 A;  1Q86 Q;  3DS4 A;  4U0A A;  3EJD A;  3CCQ P;  3DS2 A;  4XFX A;  1KQS O;  3CC4 P;  2Z45 A;  1VQP P;  2XXM A;  4F37 A;  1EMV A;  2XZ1 C;  1F80 D;  2JU2 A;  4XFZ A;  4H2X C;  3CC2 P;  4UHP B;  2L6E A;  7CEI A;  1ZMB A;  4H2Y C;  2KOQ A;  4U0C A;  1ZNV A;  2KGA A;  2JO0 A;  2KOO A;  2MR8 A;  2K93 A;  4IPY A;  2PEK A;  1AF8 A;  5JPA A;  2MD9 A;  3DTJ A;  1E0H A;  2OAR A;  1UNK A;  2LTE A;  2KG9 A;  3G1I A;  2FQ0 A;  1VQL P;  2N5I A;  3G28 A;  3CCJ P;  1NQ4 A;  3CCE P;  1KLP A;  2GZG A;  5I4T G;  2VLP A;  4PH1 A;  3U43 A;  3B5I A;  5HGO A;  1VQ6 P;  2AVA A;  2K5X A;  1Z6M A;  4U0D A;  1YHQ P;  4U0F A;  2LF4 A;  2DNW A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 2P9X A;  3G71 P;  3DS1 A;  1A43 A;  2BUO A;  3CCS P;  2EIA A;  3G0V A;  3Q20 A;  2JYL A;  1M74 A;  2JYG A;  2PY8 A;  3CPW O;  1K30 A;  3H4E A;  3CCU P;  3NTE A;  3OW2 O;  3G29 A;  1EOQ A;  1VQK P;  3RG6 C;  5HGN A;  2OTJ P;  3HYB A;  1IUQ A;  1E6J P;  2PEJ A;  1Q86 Q;  4U0B A;  5F2N A;  3DS4 A;  4U0A A;  3CCQ P;  3DS2 A;  4XFX A;  5BS2 A;  1N8R Q;  3I56 P;  2DGY A;  3CCM P;  1K8A Q;  3CCV P;  2M8L A;  1VQ5 P;  1YJW P;  1KQS O;  1VQN P;  1QVG O;  1Q81 Q;  2Z45 A;  3CC4 P;  1VQP P;  1VQ4 P;  2M8N A;  1YIJ P;  4GR2 A;  2BHV A;  2PEO A;  2XXM A;  1RO0 A;  5BS1 A;  4U0E A;  3WBH A;  5F2O A;  3DS3 A;  4XFZ A;  3G4S P;  1EIA A;  1QVF O;  3CC2 P;  3DS5 A;  3H0D A;  2L6E A;  2PEQ A;  2PEM A;  1ZMB A;  4QNB A;  1KC8 Q;  2E1M A;  3MGE A;  4U0C A;  1BAJ A;  1NJI Q;  2JO0 A;  1YI2 P;  5HGL A;  4XRQ A;  1A8O A;  3G1G A;  4WYM A;  1VQO P;  3CXC O;  5HGM A;  2Z44 A;  2XV6 A;  1VQ7 P;  1YJ9 P;  4COC A;  1YJN P;  1M1K Q;  1KD1 Q;  1JJ2 O;  2EG5 A;  3DS0 A;  2Z46 A;  3CC7 P;  4IPY A;  3I55 P;  1YIT P;  2PEK A;  1Q7Y Q;  3G6E P;  2ONT A;  2QEX P;  5JPA A;  4XFY A;  2KOD A;  2OTL P;  1VQM P;  3DTJ A;  5DCK A;  1S72 P;  2OAR A;  3LRY A;  4COP A;  3M1M A;  3HZQ A;  3G26 A;  3DPH A;  1AUM A;  3G1I A;  3P05 A;  1M90 Q;  2XT1 A;  3E2D A;  1VQL P;  3G28 A;  1M6N A;  1VQ8 P;  2M8P A;  1VQ9 P;  2EFJ A;  3CD6 P;  4M0I A;  5F2K A;  3CCJ P;  3CCE P;  3CCL P;  2QA4 P;  1D1D A;  1M6E X;  1W2B O;  5I4T G;  2CWO A;  1K73 Q;  3CMA P;  1RO2 A;  4PH1 A;  3CME P;  3B5I A;  5HGO A;  1K9M Q;  1VQ6 P;  3H47 A;  2PEI A;  1Q82 Q;  4PH0 A;  3CCR P;  4U0D A;  1YHQ P;  4U0F A;  1QRJ A;  4GR6 A;  1RNI A;  2LF4 A;  2PEN A;  3VRL C;  3G21 A;  4XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...