5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
molecule keywords Capsid C-Terminal Domain
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
4U0BA 1A8OA 3DS0A 3MGEA 5DCKA 1D1DA 3G21A 4COPA 5JPAA 2JO0A 4M0IA 2EIAA 2BUOA 2L6EA 2JYLA 1EIAA 2M8PA 3G28A 2XV6A 4PH0A 2KODA 5HGOA 4XROA 2JYGA 2XT1A 3H4EA 3NTEA 2M8LA 3G26A 5HGNA 4COCA 4WYMA 1AUMA 3DS3A 3LRYA 4PH1A 3G1IA 4QNBA 4U0EA 4U0DA 3DS5A 1EOQA 2XXMA 4U0FA 5HGLA 3DPHA 3DS2A 4XRQA 1A43A 4XFZA 2ONTA 4U0AA 4U0CA 3DS4A 1BAJA 3G29A 3DTJA 4XFYA 3G0VA 5HGMA 3DS1A 2M8NA 3G1GA 5I4TG 1E6JP 3H47A 3P05A 4IPYA 4XFXA 1QRJA 3VRLC 2LF4A
chains in the Genus database with same CATH superfamily
1M90Q 2ERHA 4COPA 1VQ6P 2GYKA 2XZ1C 2EHTA 1QVFO 2KGDA 4CA3A 2VLNA 3CXCO 3CCLP 3I56P 4H2WC 5HGMA 1VHNA 1Q7YQ 3GKLC 1A8OA 3GZLA 3MGEA 1YJNP 2EIAA 2Z45A 1K30A 3LRYA 2KOQA 3E2DA 1EOQA 2KGCA 1M6EX 4H2XC 2K93A 3G4SP 5F2NA 1L0HA 2JAZA 2DGYA 1IMQA 4U0BA 1VQ5P 1Z6MA 5DCKA 2PEIA 2EHSA 2XT1A 3DS3A 1VQ4P 1QVGO 4XFZA 4H2YC 2JB0A 2OTLP 4PXHB 3DS1A 2GZGA 2PNGA 2JU2A 1EIAA 2Z44A 2PEKA 2AF8A 4QNBA 2KR5A 2AFEA 1M74A 2K92A 1AYIA 2N98A 3U43A 1GXGA 2LIUA 2LF4A 3CC4P 5EW5E 1RNIA 2JQ4A 1IMPA 2MY5A 2CGQA 1L0IA 1YI2P 2QNWA 3B5IA 2QEXP 2EFJA 5BS1A 1JJ2O 3DS5A 5KP6B 2FVEA 2GZIA 3CCVP 3RG2A 1DV5A 1OR5A 1MZ8A 1VQOP 3CMEP 3P05A 1NQ4A 1HY8A 3M1MA 1D1DA 1VKUA 4M0IA 1RO2A 2N5IA 2Z46A 5HGOA 1VQLP 3G26A 1KD1Q 1W2BO 3GZMA 3H0DA 3G71P 2FAEA 3G21A 2L6EA 2FVAA 3Q20A 1IUQA 2M5RA 3NTEA 2X2BA 5EJDA 4U0FA 2K94A 3CCRP 4BPHA 2KOPA 2MVVA 4GR2A 2FQ0A 3CCEP 1HQBA 2JBGA 2XV6A 2KODA 3HYBA 2EG5A 1VQ9P 2FHSC 5CZDB 5HGLA 3CE7A 3DS2A 2N5HA 5F2KA 4U0AA 3CCJP 4XFYA 5HVCA 3VRLC 2GDXA 2MR8A 4BPGA 1YJ9P 3G28A 1CEIA 2M8LA 1YIJP 4WYMA 2CWOA 2FQ2A 5F2OA 1UNKA 2QA4P 3DS4A 2L0QA 2LL8A 3EJEA 3I55P 2L9FA 3G1GA 1KC8Q 5I4TG 1BXIA 2PEJA 1M1KQ 4GR6A 1VQMP 2FACA 5JPAA 3B4QA 1YHQP 4DG9A 5KP8B 2JYLA 2K2QA 1K8AQ 3EJBA 2JYGA 3H4EA 2KGEA 1ACPA 4IZ6A 4MRTC 1YITP 3G1IA 4U0EA 3NY7B 4BPFA 3CCUP 2LOLA 3LMOA 3G29A 3GJNA 3CCQP 1ZNVA 3G0VA 3CMAP 3CC2P 2GZEA 2LKIA 2BHVA 2JO0A 2M8PA 5KP7B 4F37A 7CEIA 1FR2A 1GXHA 2K0XA 2MD9A 1DNYA 2GZFA 2KORA 2N6YA 1A43A 2LTEA 5HV8A 2AVAA 1NJIQ 4IPYA 4HKGA 3CCSP 1K73Q 1GPJA 2MF4A 2BUOA 1KQSO 2LPKA 1Q86Q 3RG6C 2LMLA 2L4BA 2K0YA 1AUMA 1ZMBA 2MR7A 1EMVA 2XXMA 3WBHA 3OW2O 4U0CA 3G6EP 2M8NA 2ROQA 2GZJA 3H47A 4XFXA 2KOSA 1QRJA 2CG5B 2FQ1A 1VQKP 2P9XA 2XZ0D 3HZQA 1YJWP 4QKOA 5HGNA 4COCA 2PY8A 2VLPA 2KG9A 2GDWA 3CCMP 2OTJP 3CC7P 2N6ZA 3DPHA 2VSQA 4XRQA 2L22A 2KOOA 1E6JP 1VQ7P 2FADA 1VQ8P 4R0MA 3CD6P 3CPWO 1VQNP 1S72P 4XROA 2PENA 2AFDA 1M6NA 1E0HA 4NEOA 2OARA 2DNWA 2JU1A 1K9MQ 2VLOA 2K0DX 2JGPA 2KWLA 2PEMA 5BS2A 2N50A 2NO8A 2KG8A 4U0DA 2FVFA 1F80D 1Q82Q 4PWVB 2KW2A 2ONTA 1RO0A 1UJZA 2PEOA 2VLQA 2WPTA 2K5XA 1T8KA 3DS0A 2GDYA 3EJDA 2PEQA 4UHPB 4PH0A 1X3OA 4PH1A 2KGAA 1AF8A 1N8RQ 2KG6A 1VQPP 2MVUA 1BAJA 3DTJA 2LIWA 1Q81Q 2CQ8A 2E1MA 1KLPA 2CNRA
chains in the Genus database with same CATH topology
2P9XA 1M90Q 3CC4P 1RNIA 4COPA 1YJ9P 1VQ6P 3HZQA 3G28A 1YJWP 1YI2P 3B5IA 2QEXP 2EFJA 2M8LA 1YIJP 5BS1A 5HGNA 4COCA 1JJ2O 4WYMA 1QVFO 2PY8A 2CWOA 5F2OA 3CCMP 2OTJP 3DS5A 3CC7P 3CCVP 3DPHA 4XRQA 2QA4P 3DS4A 3CXCO 3CCLP 3I56P 5HGMA 3I55P 3G1GA 1KC8Q 5I4TG 1VQOP 3CMEP 1E6JP 2PEJA 3P05A 1Q7YQ 1VQ7P 1VQ8P 1A8OA 1M1KQ 4GR6A 1VQMP 3MGEA 3M1MA 1D1DA 5JPAA 4M0IA 1YJNP 1RO2A 2EIAA 3CPWO 1YHQP 1VQNP 2JYLA 3CD6P 2Z45A 1K8AQ 2Z46A 1S72P 5HGOA 4XROA 2JYGA 1VQLP 3H4EA 2PENA 3G26A 1K30A 3LRYA 3E2DA 1YITP 3G1IA 1M6NA 4U0EA 1KD1Q 1EOQA 2OARA 3CCUP 1W2BO 1M6EX 3G29A 3G4SP 1K9MQ 3CCQP 3G0VA 5F2NA 3CMAP 3CC2P 3H0DA 2DGYA 3G71P 2BHVA 4U0BA 1VQ5P 5DCKA 3G21A 2JO0A 2L6EA 2M8PA 2PEMA 3Q20A 2PEIA 2XT1A 1IUQA 3NTEA 5BS2A 3DS3A 1VQ4P 4U0DA 4U0FA 1Q82Q 3CCRP 1QVGO 1A43A 4XFZA 2ONTA 1RO0A 2OTLP 4GR2A 3DS1A 2PEOA 1NJIQ 4IPYA 3CCSP 1K73Q 3CCEP 3DS0A 2PEQA 2BUOA 1KQSO 1EIAA 2Z44A 2XV6A 4PH0A 3RG6C 2KODA 1Q86Q 3HYBA 2PEKA 4PH1A 1AUMA 1ZMBA 2EG5A 1VQ9P 4QNBA 1M74A 2XXMA 5HGLA 3WBHA 1N8RQ 3OW2O 3DS2A 5F2KA 4U0AA 4U0CA 3CCJP 1BAJA 1VQPP 3DTJA 4XFYA 1Q81Q 3G6EP 2M8NA 2E1MA 3H47A 4XFXA 1QRJA 3VRLC 2LF4A 1VQKP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0B A;  1A8O A;  3DS0 A;  3MGE A;  5DCK A;  1D1D A;  3G21 A;  4COP A;  5JPA A;  2JO0 A;  4M0I A;  2EIA A;  2BUO A;  2L6E A;  2JYL A;  1EIA A;  2M8P A;  3G28 A;  2XV6 A;  4PH0 A;  2KOD A;  5HGO A;  4XRO A;  2JYG A;  2XT1 A;  3H4E A;  3NTE A;  2M8L A;  3G26 A;  5HGN A;  4COC A;  4WYM A;  1AUM A;  3DS3 A;  3LRY A;  4PH1 A;  3G1I A;  4QNB A;  4U0E A;  4U0D A;  3DS5 A;  1EOQ A;  2XXM A;  4U0F A;  5HGL A;  3DPH A;  3DS2 A;  4XRQ A;  1A43 A;  4XFZ A;  2ONT A;  4U0A A;  4U0C A;  3DS4 A;  1BAJ A;  3G29 A;  3DTJ A;  4XFY A;  3G0V A;  5HGM A;  3DS1 A;  2M8N A;  3G1G A;  5I4T G;  1E6J P;  3H47 A;  3P05 A;  4IPY A;  4XFX A;  1QRJ A;  3VRL C;  2LF4 A; 
#chains in the Genus database with same CATH topology
 1M90 Q;  2ERH A;  4COP A;  1VQ6 P;  2GYK A;  2XZ1 C;  2EHT A;  1QVF O;  2KGD A;  4CA3 A;  2VLN A;  3CXC O;  3CCL P;  3I56 P;  4H2W C;  5HGM A;  1VHN A;  1Q7Y Q;  3GKL C;  1A8O A;  3GZL A;  3MGE A;  1YJN P;  2EIA A;  2Z45 A;  1K30 A;  3LRY A;  2KOQ A;  3E2D A;  1EOQ A;  2KGC A;  1M6E X;  4H2X C;  2K93 A;  3G4S P;  5F2N A;  1L0H A;  2JAZ A;  2DGY A;  1IMQ A;  4U0B A;  1VQ5 P;  1Z6M A;  5DCK A;  2PEI A;  2EHS A;  2XT1 A;  3DS3 A;  1VQ4 P;  1QVG O;  4XFZ A;  4H2Y C;  2JB0 A;  2OTL P;  4PXH B;  3DS1 A;  2GZG A;  2PNG A;  2JU2 A;  1EIA A;  2Z44 A;  2PEK A;  2AF8 A;  4QNB A;  2KR5 A;  2AFE A;  1M74 A;  2K92 A;  1AYI A;  2N98 A;  3U43 A;  1GXG A;  2LIU A;  2LF4 A;  3CC4 P;  5EW5 E;  1RNI A;  2JQ4 A;  1IMP A;  2MY5 A;  2CGQ A;  1L0I A;  1YI2 P;  2QNW A;  3B5I A;  2QEX P;  2EFJ A;  5BS1 A;  1JJ2 O;  3DS5 A;  5KP6 B;  2FVE A;  2GZI A;  3CCV P;  3RG2 A;  1DV5 A;  1OR5 A;  1MZ8 A;  1VQO P;  3CME P;  3P05 A;  1NQ4 A;  1HY8 A;  3M1M A;  1D1D A;  1VKU A;  4M0I A;  1RO2 A;  2N5I A;  2Z46 A;  5HGO A;  1VQL P;  3G26 A;  1KD1 Q;  1W2B O;  3GZM A;  3H0D A;  3G71 P;  2FAE A;  3G21 A;  2L6E A;  2FVA A;  3Q20 A;  1IUQ A;  2M5R A;  3NTE A;  2X2B A;  5EJD A;  4U0F A;  2K94 A;  3CCR P;  4BPH A;  2KOP A;  2MVV A;  4GR2 A;  2FQ0 A;  3CCE P;  1HQB A;  2JBG A;  2XV6 A;  2KOD A;  3HYB A;  2EG5 A;  1VQ9 P;  2FHS C;  5CZD B;  5HGL A;  3CE7 A;  3DS2 A;  2N5H A;  5F2K A;  4U0A A;  3CCJ P;  4XFY A;  5HVC A;  3VRL C;  2GDX A;  2MR8 A;  4BPG A;  1YJ9 P;  3G28 A;  1CEI A;  2M8L A;  1YIJ P;  4WYM A;  2CWO A;  2FQ2 A;  5F2O A;  1UNK A;  2QA4 P;  3DS4 A;  2L0Q A;  2LL8 A;  3EJE A;  3I55 P;  2L9F A;  3G1G A;  1KC8 Q;  5I4T G;  1BXI A;  2PEJ A;  1M1K Q;  4GR6 A;  1VQM P;  2FAC A;  5JPA A;  3B4Q A;  1YHQ P;  4DG9 A;  5KP8 B;  2JYL A;  2K2Q A;  1K8A Q;  3EJB A;  2JYG A;  3H4E A;  2KGE A;  1ACP A;  4IZ6 A;  4MRT C;  1YIT P;  3G1I A;  4U0E A;  3NY7 B;  4BPF A;  3CCU P;  2LOL A;  3LMO A;  3G29 A;  3GJN A;  3CCQ P;  1ZNV A;  3G0V A;  3CMA P;  3CC2 P;  2GZE A;  2LKI A;  2BHV A;  2JO0 A;  2M8P A;  5KP7 B;  4F37 A;  7CEI A;  1FR2 A;  1GXH A;  2K0X A;  2MD9 A;  1DNY A;  2GZF A;  2KOR A;  2N6Y A;  1A43 A;  2LTE A;  5HV8 A;  2AVA A;  1NJI Q;  4IPY A;  4HKG A;  3CCS P;  1K73 Q;  1GPJ A;  2MF4 A;  2BUO A;  1KQS O;  2LPK A;  1Q86 Q;  3RG6 C;  2LML A;  2L4B A;  2K0Y A;  1AUM A;  1ZMB A;  2MR7 A;  1EMV A;  2XXM A;  3WBH A;  3OW2 O;  4U0C A;  3G6E P;  2M8N A;  2ROQ A;  2GZJ A;  3H47 A;  4XFX A;  2KOS A;  1QRJ A;  2CG5 B;  2FQ1 A;  1VQK P;  2P9X A;  2XZ0 D;  3HZQ A;  1YJW P;  4QKO A;  5HGN A;  4COC A;  2PY8 A;  2VLP A;  2KG9 A;  2GDW A;  3CCM P;  2OTJ P;  3CC7 P;  2N6Z A;  3DPH A;  2VSQ A;  4XRQ A;  2L22 A;  2KOO A;  1E6J P;  1VQ7 P;  2FAD A;  1VQ8 P;  4R0M A;  3CD6 P;  3CPW O;  1VQN P;  1S72 P;  4XRO A;  2PEN A;  2AFD A;  1M6N A;  1E0H A;  4NEO A;  2OAR A;  2DNW A;  2JU1 A;  1K9M Q;  2VLO A;  2K0D X;  2JGP A;  2KWL A;  2PEM A;  5BS2 A;  2N50 A;  2NO8 A;  2KG8 A;  4U0D A;  2FVF A;  1F80 D;  1Q82 Q;  4PWV B;  2KW2 A;  2ONT A;  1RO0 A;  1UJZ A;  2PEO A;  2VLQ A;  2WPT A;  2K5X A;  1T8K A;  3DS0 A;  2GDY A;  3EJD A;  2PEQ A;  4UHP B;  4PH0 A;  1X3O A;  4PH1 A;  2KGA A;  1AF8 A;  1N8R Q;  2KG6 A;  1VQP P;  2MVU A;  1BAJ A;  3DTJ A;  2LIW A;  1Q81 Q;  2CQ8 A;  2E1M A;  1KLP A;  2CNR A; 
#chains in the Genus database with same CATH homology
 2P9X A;  1M90 Q;  3CC4 P;  1RNI A;  4COP A;  1YJ9 P;  1VQ6 P;  3HZQ A;  3G28 A;  1YJW P;  1YI2 P;  3B5I A;  2QEX P;  2EFJ A;  2M8L A;  1YIJ P;  5BS1 A;  5HGN A;  4COC A;  1JJ2 O;  4WYM A;  1QVF O;  2PY8 A;  2CWO A;  5F2O A;  3CCM P;  2OTJ P;  3DS5 A;  3CC7 P;  3CCV P;  3DPH A;  4XRQ A;  2QA4 P;  3DS4 A;  3CXC O;  3CCL P;  3I56 P;  5HGM A;  3I55 P;  3G1G A;  1KC8 Q;  5I4T G;  1VQO P;  3CME P;  1E6J P;  2PEJ A;  3P05 A;  1Q7Y Q;  1VQ7 P;  1VQ8 P;  1A8O A;  1M1K Q;  4GR6 A;  1VQM P;  3MGE A;  3M1M A;  1D1D A;  5JPA A;  4M0I A;  1YJN P;  1RO2 A;  2EIA A;  3CPW O;  1YHQ P;  1VQN P;  2JYL A;  3CD6 P;  2Z45 A;  1K8A Q;  2Z46 A;  1S72 P;  5HGO A;  4XRO A;  2JYG A;  1VQL P;  3H4E A;  2PEN A;  3G26 A;  1K30 A;  3LRY A;  3E2D A;  1YIT P;  3G1I A;  1M6N A;  4U0E A;  1KD1 Q;  1EOQ A;  2OAR A;  3CCU P;  1W2B O;  1M6E X;  3G29 A;  3G4S P;  1K9M Q;  3CCQ P;  3G0V A;  5F2N A;  3CMA P;  3CC2 P;  3H0D A;  2DGY A;  3G71 P;  2BHV A;  4U0B A;  1VQ5 P;  5DCK A;  3G21 A;  2JO0 A;  2L6E A;  2M8P A;  2PEM A;  3Q20 A;  2PEI A;  2XT1 A;  1IUQ A;  3NTE A;  5BS2 A;  3DS3 A;  1VQ4 P;  4U0D A;  4U0F A;  1Q82 Q;  3CCR P;  1QVG O;  1A43 A;  4XFZ A;  2ONT A;  1RO0 A;  2OTL P;  4GR2 A;  3DS1 A;  2PEO A;  1NJI Q;  4IPY A;  3CCS P;  1K73 Q;  3CCE P;  3DS0 A;  2PEQ A;  2BUO A;  1KQS O;  1EIA A;  2Z44 A;  2XV6 A;  4PH0 A;  3RG6 C;  2KOD A;  1Q86 Q;  3HYB A;  2PEK A;  4PH1 A;  1AUM A;  1ZMB A;  2EG5 A;  1VQ9 P;  4QNB A;  1M74 A;  2XXM A;  5HGL A;  3WBH A;  1N8R Q;  3OW2 O;  3DS2 A;  5F2K A;  4U0A A;  4U0C A;  3CCJ P;  1BAJ A;  1VQP P;  3DTJ A;  4XFY A;  1Q81 Q;  3G6E P;  2M8N A;  2E1M A;  3H47 A;  4XFX A;  1QRJ A;  3VRL C;  2LF4 A;  1VQK P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...