5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid C-Terminal Domain
publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
3DS1A 1QRJA 4U0DA 4XFXA 3G21A 4COCA 2XXMA 5HGMA 3G0VA 3VRLC 2L6EA 3DPHA 2JYGA 5HGNA 3H47A 2M8NA 2M8PA 4PH1A 4M0IA 1EIAA 4U0BA 4PH0A 2KODA 3DS0A 3P05A 1A8OA 4U0FA 4U0CA 4U0EA 1A43A 5HGOA 2XV6A 4U0AA 1BAJA 2BUOA 3DS3A 4QNBA 3NTEA 2LF4A 4XRQA 4XROA 4COPA 1AUMA 2M8LA 3H4EA 2ONTA 4WYMA 1D1DA 3G28A 4XFYA 3G1GA 2JO0A 3G1IA 3G29A 3DS4A 3DS5A 3G26A 1EOQA 2EIAA 3MGEA 2XT1A 5I4TG 3LRYA 5JPAA 3DTJA 4XFZA 1E6JP 5HGLA 5DCKA 3DS2A 4IPYA 2JYLA
chains in the Genus database with same CATH superfamily
4MRTC 1QRJA 4COCA 1K9MQ 1M90Q 1IUQA 1M74A 3P05A 2Z44A 5BS1A 2LPKA 1VQ4P 4CA3A 2M8LA 4WYMA 3G1GA 3CCMP 3G4SP 2CQ8A 1VQ6P 1YHQP 4PXHB 1Q86Q 3G21A 2N50A 2BHVA 5HV8A 2EHTA 2KGAA 2PNGA 2VSQA 3WBHA 1EIAA 4DG9A 4PH0A 2MD9A 1A8OA 1Z6MA 3CMAP 1A43A 2DNWA 2L4BA 3CC4P 2KORA 1YITP 2KOPA 3CMEP 3CC7P 2P9XA 2PEIA 2QNWA 1BXIA 2MR8A 2N6ZA 3G71P 2Z45A 1DNYA 1KD1Q 2LMLA 1Q82Q 4XROA 2PY8A 1IMPA 2K93A 3H4EA 2PEJA 1D1DA 3G28A 5I4TG 2VLQA 2VLOA 5KP8B 2FVEA 1HQBA 5HGLA 5DCKA 2K94A 2OARA 1M1KQ 1NJIQ 2FQ0A 2FVAA 2M8PA 2KR5A 1VQPP 1VQLP 4UHPB 3CCSP 2PEMA 3G26A 3GZMA 2EIAA 1YJNP 2MVVA 3DS2A 2FVFA 2JBGA 5HGNA 2AF8A 5F2NA 1VQOP 2KW2A 1BAJA 2WPTA 3H0DA 1K73Q 4H2XC 2JO0A 3CC2P 2JAZA 2AFEA 3MGEA 3DTJA 2FQ1A 1AF8A 4U0DA 2LIWA 1VQ9P 2EHSA 2L6EA 1W2BO 2XV6A 2GDXA 1VQ5P 4IZ6A 1QVGO 2GYKA 1RNIA 3B5IA 3U43A 4GR2A 2PEQA 2XXMA 3Q20A 1KLPA 1VQ8P 2KG8A 3H47A 1IMQA 2L9FA 1T8KA 1UJZA 3CCLP 1VHNA 2K92A 3DS3A 4H2YC 1S72P 2GDYA 2KG6A 3I56P 2MF4A 1YJ9P 1YJWP 2CG5B 1GPJA 3OW2O 1L0IA 2JYLA 1DV5A 2KGCA 3G0VA 3CCJP 2M8NA 4PH1A 2N5HA 4U0CA 4U0FA 2L22A 3EJDA 1OR5A 4BPFA 5HVCA 2Z46A 1VKUA 2MVUA 2KG9A 2K2QA 3G29A 2K5XA 1KQSO 3DS1A 3G6EP 2JU1A 2ERHA 2KOSA 1JJ2O 2FADA 2KOQA 2LF4A 4NEOA 1QVFO 2FQ2A 1E6JP 4XFYA 2JQ4A 5BS2A 2GZIA 2PEKA 1GXGA 4BPHA 1MZ8A 3LMOA 2FACA 5EW5E 1X3OA 2KODA 5HGOA 1Q81Q 3CE7A 2EFJA 2LOLA 1NQ4A 2E1MA 2K0DX 1N8RQ 4XFZA 3EJEA 2LKIA 3CD6P 3GKLC 1EMVA 3DPHA 1VQMP 4M0IA 4U0BA 3DS0A 4U0EA 2N6YA 4BPGA 1ZNVA 2GZEA 3I55P 3GJNA 1HY8A 2LIUA 1AYIA 1GXHA 2CGQA 4IPYA 4XFXA 2N98A 1ACPA 1F80D 2QA4P 4HKGA 2LTEA 2JYGA 1YIJP 2NO8A 2K0XA 1K8AQ 2KOOA 1CEIA 4COPA 4QKOA 2XZ1C 2KGEA 2CNRA 2PENA 1Q7YQ 5F2KA 3RG2A 4GR6A 5JPAA 1VQ7P 3RG6C 1ZMBA 1K30A 1KC8Q 2GZFA 2L0QA 4R0MA 4U0AA 2FAEA 3CPWO 3EJBA 4PWVB 2AFDA 3DS4A 2KGDA 1UNKA 5KP7B 1FR2A 1AUMA 2MY5A 2K0YA 5F2OA 3CCEP 2OTLP 3GZLA 3VRLC 2JGPA 3B4QA 2VLNA 1VQNP 2BUOA 4QNBA 1RO2A 3NTEA 3M1MA 1E0HA 2GZJA 4F37A 2ONTA 2QEXP 2OTJP 2LL8A 2XT1A 2GDWA 3LRYA 3CCQP 2PEOA 2VLPA 1M6NA 5HGMA 5CZDB 2EG5A 2FHSC 3NY7B 2N5IA 3CCVP 3CCRP 2AVAA 5KP6B 2XZ0D 7CEIA 2M5RA 2CWOA 3HZQA 1YI2P 1VQKP 3HYBA 1L0HA 1RO0A 4H2WC 2X2BA 5EJDA 2GZGA 1M6EX 2ROQA 3CCUP 3E2DA 2DGYA 4XRQA 2MR7A 2JB0A 3G1IA 2JU2A 3DS5A 1EOQA 2KWLA 3CXCO
chains in the Genus database with same CATH topology
3DS1A 1QRJA 4COCA 3RG6C 1ZMBA 3G6EP 1K30A 1KC8Q 1K9MQ 1M90Q 1JJ2O 5HGNA 5F2NA 1VQOP 1IUQA 1M74A 3P05A 4U0AA 3CXCO 1BAJA 2Z44A 3CPWO 5BS1A 3H0DA 2LF4A 1VQ4P 1K73Q 2M8LA 4WYMA 3G1GA 3CCMP 2JO0A 3G4SP 3CC2P 3DS4A 1QVFO 3MGEA 1VQ6P 3DTJA 1YHQP 1Q86Q 1AUMA 1E6JP 4XFYA 4U0DA 3G21A 1VQ9P 5BS2A 3CCEP 5F2OA 2OTLP 2PEKA 2BHVA 3VRLC 2L6EA 3WBHA 1EIAA 4PH0A 2KODA 5HGOA 1A8OA 3CMAP 1W2BO 1A43A 2XV6A 3CC4P 1Q81Q 1YITP 1VQNP 1VQ5P 2BUOA 4QNBA 2EFJA 3CMEP 1RO2A 3NTEA 1QVGO 3M1MA 3CC7P 2ONTA 2P9XA 2QEXP 2E1MA 2OTJP 2PEIA 1RNIA 3B5IA 2XT1A 3LRYA 1N8RQ 4GR2A 4XFZA 2PEQA 3G71P 3CCQP 2PEOA 2XXMA 1M6NA 3Q20A 3CD6P 5HGMA 2Z45A 3DPHA 1VQ8P 2EG5A 1VQMP 3H47A 4M0IA 4U0BA 3CCVP 3DS0A 4U0EA 1KD1Q 3CCLP 3CCRP 3DS3A 1S72P 1Q82Q 4XROA 2PY8A 3I55P 3H4EA 2PEJA 1D1DA 3G28A 3I56P 5I4TG 1YJ9P 1YJWP 5HGLA 2CWOA 3OW2O 3HZQA 4IPYA 2JYLA 2OARA 1YI2P 4XFXA 1M1KQ 1VQKP 3HYBA 1NJIQ 3G0VA 2QA4P 1RO0A 2JYGA 3CCJP 2M8NA 2M8PA 4PH1A 1YIJP 1M6EX 4U0CA 4U0FA 3CCUP 1K8AQ 3E2DA 2DGYA 1VQPP 1VQLP 4XRQA 2Z46A 4COPA 3CCSP 2PENA 1Q7YQ 2PEMA 3G1IA 3G29A 3G26A 3DS5A 1EOQA 2EIAA 5F2KA 1KQSO 4GR6A 5JPAA 1VQ7P 1YJNP 3DS2A 5DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS1 A;  1QRJ A;  4U0D A;  4XFX A;  3G21 A;  4COC A;  2XXM A;  5HGM A;  3G0V A;  3VRL C;  2L6E A;  3DPH A;  2JYG A;  5HGN A;  3H47 A;  2M8N A;  2M8P A;  4PH1 A;  4M0I A;  1EIA A;  4U0B A;  4PH0 A;  2KOD A;  3DS0 A;  3P05 A;  1A8O A;  4U0F A;  4U0C A;  4U0E A;  1A43 A;  5HGO A;  2XV6 A;  4U0A A;  1BAJ A;  2BUO A;  3DS3 A;  4QNB A;  3NTE A;  2LF4 A;  4XRQ A;  4XRO A;  4COP A;  1AUM A;  2M8L A;  3H4E A;  2ONT A;  4WYM A;  1D1D A;  3G28 A;  4XFY A;  3G1G A;  2JO0 A;  3G1I A;  3G29 A;  3DS4 A;  3DS5 A;  3G26 A;  1EOQ A;  2EIA A;  3MGE A;  2XT1 A;  5I4T G;  3LRY A;  5JPA A;  3DTJ A;  4XFZ A;  1E6J P;  5HGL A;  5DCK A;  3DS2 A;  4IPY A;  2JYL A; 
#chains in the Genus database with same CATH topology
 4MRT C;  1QRJ A;  4COC A;  1K9M Q;  1M90 Q;  1IUQ A;  1M74 A;  3P05 A;  2Z44 A;  5BS1 A;  2LPK A;  1VQ4 P;  4CA3 A;  2M8L A;  4WYM A;  3G1G A;  3CCM P;  3G4S P;  2CQ8 A;  1VQ6 P;  1YHQ P;  4PXH B;  1Q86 Q;  3G21 A;  2N50 A;  2BHV A;  5HV8 A;  2EHT A;  2KGA A;  2PNG A;  2VSQ A;  3WBH A;  1EIA A;  4DG9 A;  4PH0 A;  2MD9 A;  1A8O A;  1Z6M A;  3CMA P;  1A43 A;  2DNW A;  2L4B A;  3CC4 P;  2KOR A;  1YIT P;  2KOP A;  3CME P;  3CC7 P;  2P9X A;  2PEI A;  2QNW A;  1BXI A;  2MR8 A;  2N6Z A;  3G71 P;  2Z45 A;  1DNY A;  1KD1 Q;  2LML A;  1Q82 Q;  4XRO A;  2PY8 A;  1IMP A;  2K93 A;  3H4E A;  2PEJ A;  1D1D A;  3G28 A;  5I4T G;  2VLQ A;  2VLO A;  5KP8 B;  2FVE A;  1HQB A;  5HGL A;  5DCK A;  2K94 A;  2OAR A;  1M1K Q;  1NJI Q;  2FQ0 A;  2FVA A;  2M8P A;  2KR5 A;  1VQP P;  1VQL P;  4UHP B;  3CCS P;  2PEM A;  3G26 A;  3GZM A;  2EIA A;  1YJN P;  2MVV A;  3DS2 A;  2FVF A;  2JBG A;  5HGN A;  2AF8 A;  5F2N A;  1VQO P;  2KW2 A;  1BAJ A;  2WPT A;  3H0D A;  1K73 Q;  4H2X C;  2JO0 A;  3CC2 P;  2JAZ A;  2AFE A;  3MGE A;  3DTJ A;  2FQ1 A;  1AF8 A;  4U0D A;  2LIW A;  1VQ9 P;  2EHS A;  2L6E A;  1W2B O;  2XV6 A;  2GDX A;  1VQ5 P;  4IZ6 A;  1QVG O;  2GYK A;  1RNI A;  3B5I A;  3U43 A;  4GR2 A;  2PEQ A;  2XXM A;  3Q20 A;  1KLP A;  1VQ8 P;  2KG8 A;  3H47 A;  1IMQ A;  2L9F A;  1T8K A;  1UJZ A;  3CCL P;  1VHN A;  2K92 A;  3DS3 A;  4H2Y C;  1S72 P;  2GDY A;  2KG6 A;  3I56 P;  2MF4 A;  1YJ9 P;  1YJW P;  2CG5 B;  1GPJ A;  3OW2 O;  1L0I A;  2JYL A;  1DV5 A;  2KGC A;  3G0V A;  3CCJ P;  2M8N A;  4PH1 A;  2N5H A;  4U0C A;  4U0F A;  2L22 A;  3EJD A;  1OR5 A;  4BPF A;  5HVC A;  2Z46 A;  1VKU A;  2MVU A;  2KG9 A;  2K2Q A;  3G29 A;  2K5X A;  1KQS O;  3DS1 A;  3G6E P;  2JU1 A;  2ERH A;  2KOS A;  1JJ2 O;  2FAD A;  2KOQ A;  2LF4 A;  4NEO A;  1QVF O;  2FQ2 A;  1E6J P;  4XFY A;  2JQ4 A;  5BS2 A;  2GZI A;  2PEK A;  1GXG A;  4BPH A;  1MZ8 A;  3LMO A;  2FAC A;  5EW5 E;  1X3O A;  2KOD A;  5HGO A;  1Q81 Q;  3CE7 A;  2EFJ A;  2LOL A;  1NQ4 A;  2E1M A;  2K0D X;  1N8R Q;  4XFZ A;  3EJE A;  2LKI A;  3CD6 P;  3GKL C;  1EMV A;  3DPH A;  1VQM P;  4M0I A;  4U0B A;  3DS0 A;  4U0E A;  2N6Y A;  4BPG A;  1ZNV A;  2GZE A;  3I55 P;  3GJN A;  1HY8 A;  2LIU A;  1AYI A;  1GXH A;  2CGQ A;  4IPY A;  4XFX A;  2N98 A;  1ACP A;  1F80 D;  2QA4 P;  4HKG A;  2LTE A;  2JYG A;  1YIJ P;  2NO8 A;  2K0X A;  1K8A Q;  2KOO A;  1CEI A;  4COP A;  4QKO A;  2XZ1 C;  2KGE A;  2CNR A;  2PEN A;  1Q7Y Q;  5F2K A;  3RG2 A;  4GR6 A;  5JPA A;  1VQ7 P;  3RG6 C;  1ZMB A;  1K30 A;  1KC8 Q;  2GZF A;  2L0Q A;  4R0M A;  4U0A A;  2FAE A;  3CPW O;  3EJB A;  4PWV B;  2AFD A;  3DS4 A;  2KGD A;  1UNK A;  5KP7 B;  1FR2 A;  1AUM A;  2MY5 A;  2K0Y A;  5F2O A;  3CCE P;  2OTL P;  3GZL A;  3VRL C;  2JGP A;  3B4Q A;  2VLN A;  1VQN P;  2BUO A;  4QNB A;  1RO2 A;  3NTE A;  3M1M A;  1E0H A;  2GZJ A;  4F37 A;  2ONT A;  2QEX P;  2OTJ P;  2LL8 A;  2XT1 A;  2GDW A;  3LRY A;  3CCQ P;  2PEO A;  2VLP A;  1M6N A;  5HGM A;  5CZD B;  2EG5 A;  2FHS C;  3NY7 B;  2N5I A;  3CCV P;  3CCR P;  2AVA A;  5KP6 B;  2XZ0 D;  7CEI A;  2M5R A;  2CWO A;  3HZQ A;  1YI2 P;  1VQK P;  3HYB A;  1L0H A;  1RO0 A;  4H2W C;  2X2B A;  5EJD A;  2GZG A;  1M6E X;  2ROQ A;  3CCU P;  3E2D A;  2DGY A;  4XRQ A;  2MR7 A;  2JB0 A;  3G1I A;  2JU2 A;  3DS5 A;  1EOQ A;  2KWL A;  3CXC O; 
#chains in the Genus database with same CATH homology
 3DS1 A;  1QRJ A;  4COC A;  3RG6 C;  1ZMB A;  3G6E P;  1K30 A;  1KC8 Q;  1K9M Q;  1M90 Q;  1JJ2 O;  5HGN A;  5F2N A;  1VQO P;  1IUQ A;  1M74 A;  3P05 A;  4U0A A;  3CXC O;  1BAJ A;  2Z44 A;  3CPW O;  5BS1 A;  3H0D A;  2LF4 A;  1VQ4 P;  1K73 Q;  2M8L A;  4WYM A;  3G1G A;  3CCM P;  2JO0 A;  3G4S P;  3CC2 P;  3DS4 A;  1QVF O;  3MGE A;  1VQ6 P;  3DTJ A;  1YHQ P;  1Q86 Q;  1AUM A;  1E6J P;  4XFY A;  4U0D A;  3G21 A;  1VQ9 P;  5BS2 A;  3CCE P;  5F2O A;  2OTL P;  2PEK A;  2BHV A;  3VRL C;  2L6E A;  3WBH A;  1EIA A;  4PH0 A;  2KOD A;  5HGO A;  1A8O A;  3CMA P;  1W2B O;  1A43 A;  2XV6 A;  3CC4 P;  1Q81 Q;  1YIT P;  1VQN P;  1VQ5 P;  2BUO A;  4QNB A;  2EFJ A;  3CME P;  1RO2 A;  3NTE A;  1QVG O;  3M1M A;  3CC7 P;  2ONT A;  2P9X A;  2QEX P;  2E1M A;  2OTJ P;  2PEI A;  1RNI A;  3B5I A;  2XT1 A;  3LRY A;  1N8R Q;  4GR2 A;  4XFZ A;  2PEQ A;  3G71 P;  3CCQ P;  2PEO A;  2XXM A;  1M6N A;  3Q20 A;  3CD6 P;  5HGM A;  2Z45 A;  3DPH A;  1VQ8 P;  2EG5 A;  1VQM P;  3H47 A;  4M0I A;  4U0B A;  3CCV P;  3DS0 A;  4U0E A;  1KD1 Q;  3CCL P;  3CCR P;  3DS3 A;  1S72 P;  1Q82 Q;  4XRO A;  2PY8 A;  3I55 P;  3H4E A;  2PEJ A;  1D1D A;  3G28 A;  3I56 P;  5I4T G;  1YJ9 P;  1YJW P;  5HGL A;  2CWO A;  3OW2 O;  3HZQ A;  4IPY A;  2JYL A;  2OAR A;  1YI2 P;  4XFX A;  1M1K Q;  1VQK P;  3HYB A;  1NJI Q;  3G0V A;  2QA4 P;  1RO0 A;  2JYG A;  3CCJ P;  2M8N A;  2M8P A;  4PH1 A;  1YIJ P;  1M6E X;  4U0C A;  4U0F A;  3CCU P;  1K8A Q;  3E2D A;  2DGY A;  1VQP P;  1VQL P;  4XRQ A;  2Z46 A;  4COP A;  3CCS P;  2PEN A;  1Q7Y Q;  2PEM A;  3G1I A;  3G29 A;  3G26 A;  3DS5 A;  1EOQ A;  2EIA A;  5F2K A;  1KQS O;  4GR6 A;  5JPA A;  1VQ7 P;  1YJN P;  3DS2 A;  5DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...