5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
molecule tags Viral protein
molecule keywords Capsid C-Terminal Domain
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
2EIAA 1E6JP 4U0DA 2M8NA 5HGLA 2JO0A 5JPAA 2JYGA 3DPHA 4U0BA 2XV6A 4XFYA 2JYLA 4PH0A 1AUMA 2LF4A 3MGEA 4COCA 3DS1A 3DS5A 4XFZA 4XROA 2M8LA 4U0CA 5HGOA 2XXMA 4M0IA 3LRYA 4QNBA 3DTJA 3G0VA 3DS3A 4U0EA 3H47A 4COPA 2L6EA 3G26A 1D1DA 5I4TG 2KODA 2ONTA 5HGNA 3NTEA 3DS2A 1A43A 4PH1A 4U0AA 2BUOA 4IPYA 5DCKA 1EIAA 3G21A 1A8OA 4U0FA 3H4EA 4XFXA 3DS4A 3G1GA 3VRLC 1QRJA 4XRQA 3G1IA 1EOQA 3P05A 3G29A 1BAJA 3DS0A 2XT1A 5HGMA 2M8PA 4WYMA 3G28A
chains in the Genus database with same CATH superfamily
2XZ1C 1ZMBA 3CCMP 2K92A 2CNRA 2JO0A 2KGAA 5HGLA 2MF4A 5CZDB 1YITP 1AUMA 4XFZA 2LIUA 2GZIA 1GXHA 3I55P 2JB0A 4WYMA 5JPAA 1DV5A 2Z46A 4H2XC 5EW5E 1GXGA 2X2BA 2AFEA 3NTEA 2EHTA 2KR5A 4U0AA 1YJWP 2K0XA 4PXHB 4QKOA 2KGCA 2JU1A 2QA4P 3GZMA 1JJ2O 4PWVB 3E2DA 3DPHA 2K5XA 3EJBA 4HKGA 2FVFA 2JBGA 2GDWA 4BPGA 2L6EA 3G26A 3DS2A 5F2NA 3VRLC 1Q86Q 3EJEA 3B4QA 4BPHA 3CC4P 3B5IA 1M74A 2BHVA 2EIAA 2JU2A 1NQ4A 2KGDA 2JAZA 2N6YA 3CCQP 2VLOA 3LRYA 1QVGO 4QNBA 3H47A 2PENA 1A43A 4IPYA 3OW2O 3G1GA 5HV8A 2MVUA 1L0HA 1QRJA 2FACA 3LMOA 3CCJP 3G6EP 3G28A 1E6JP 3WBHA 2LIWA 2OTJP 1GPJA 2FVEA 2LKIA 5BS2A 2K93A 2AFDA 2PEQA 5F2KA 2CQ8A 2XT1A 2N5IA 3CCUP 2EFJA 5EJDA 2LL8A 2PEJA 4U0BA 2VLQA 4XFYA 3CCRP 1M6EX 4COCA 2KORA 2XXMA 2K0YA 1F80D 1D1DA 1VQ9P 1M1KQ 3HYBA 2KODA 2ONTA 5HGNA 4PH1A 3U43A 2AF8A 2EHSA 7CEIA 2WPTA 1K8AQ 2M5RA 1VQOP 1AYIA 1S72P 2LMLA 2KOPA 1BXIA 4CA3A 2KW2A 3CCSP 4U0EA 2L22A 3RG2A 1Q82Q 1Z6MA 2KWLA 2FQ2A 1A8OA 1N8RQ 2N5HA 1BAJA 2KGEA 2XZ0D 5HGMA 1K9MQ 2M8PA 4GR6A 2VSQA 1EMVA 3CMAP 1YI2P 5KP8B 5HVCA 2GDYA 4PH0A 4U0CA 5KP6B 1M90Q 2CWOA 3G71P 2PEOA 2GZEA 3CE7A 2VLNA 2KG6A 3DS0A 2N98A 1VKUA 4U0DA 1CEIA 2GZJA 1VQNP 1W2BO 1E0HA 2M8LA 1VQ6P 4M0IA 2OTLP 3DS3A 2DGYA 5I4TG 1HY8A 1K30A 2GZGA 1EIAA 4U0FA 2PEIA 2DNWA 2LOLA 3G1IA 3P05A 3I56P 1KC8Q 1VQLP 1VQ7P 2LTEA 1DNYA 2JYGA 1MZ8A 2JYLA 1YJ9P 1YHQP 4UHPB 3G0VA 1IMQA 2CG5B 1UJZA 2CGQA 4DG9A 5DCKA 4XFXA 3G29A 2K2QA 2Z45A 3CCVP 2N50A 2N6ZA 4H2WC 1NJIQ 3G4SP 3GKLC 1T8KA 2ROQA 2FVAA 2PEMA 5BS1A 1HQBA 2E1MA 1X3OA 2K0DX 2FADA 4NEOA 2KG9A 1QVFO 2VLPA 2JGPA 1K73Q 5F2OA 2Z44A 2LF4A 3MGEA 4XROA 1YIJP 2AVAA 1VQPP 1M6NA 1OR5A 3CC2P 3NY7B 2NO8A 1Q7YQ 2L9FA 2KOQA 3H4EA 2MR8A 4BPFA 3H0DA 3CMEP 2JQ4A 4H2YC 3CD6P 1ACPA 4GR2A 1RO2A 2P9XA 1Q81Q 4MRTC 5HGOA 2MR7A 2PY8A 1VQKP 2L4BA 1IUQA 1KD1Q 3CC7P 3CXCO 2PEKA 2QNWA 2MY5A 2M8NA 1FR2A 3DS1A 2EG5A 2PNGA 1VQ8P 1RO0A 1VQ4P 3GZLA 3DTJA 1IMPA 2K94A 3HZQA 2BUOA 3CPWO 2KOOA 2ERHA 3G21A 2GZFA 2MD9A 4XRQA 3EJDA 1EOQA 3M1MA 4IZ6A 1AF8A 3GJNA 2FQ0A 3CCEP 2KG8A 2LPKA 3RG6C 4F37A 1ZNVA 2L0QA 2GYKA 1VQMP 4R0MA 4COPA 2FHSC 2GDXA 1L0IA 2MVVA 3CCLP 2FAEA 2XV6A 3DS5A 2KOSA 1VQ5P 2FQ1A 1UNKA 2QEXP 1RNIA 3DS4A 1KLPA 2OARA 5KP7B 1VHNA 3Q20A 1KQSO 1YJNP
chains in the Genus database with same CATH topology
4U0DA 1E6JP 1ZMBA 3WBHA 3CCMP 3CD6P 5HGLA 2JO0A 4GR2A 1RO2A 2OTJP 1YITP 2P9XA 1Q81Q 1AUMA 1VQNP 1W2BO 4XFZA 2M8LA 5HGOA 1VQ6P 2PY8A 5BS2A 4M0IA 1VQKP 2OTLP 3DS3A 2DGYA 5I4TG 1K30A 1EIAA 4U0FA 2PEIA 1IUQA 1KD1Q 3G1IA 2PEQA 3P05A 5F2KA 3I56P 3CC7P 1KC8Q 2XT1A 1VQ7P 1VQLP 3I55P 3CXCO 4WYMA 3CCUP 2PEKA 2EFJA 2M8NA 5JPAA 2JYGA 2PEJA 4U0BA 4XFYA 3CCRP 2JYLA 1M6EX 2Z46A 4COCA 3DS1A 2EG5A 1YJ9P 1YHQP 2XXMA 1VQ8P 1RO0A 1VQ4P 3DTJA 3G0VA 1VQ9P 1D1DA 1M1KQ 3HYBA 2KODA 2ONTA 5HGNA 3NTEA 4PH1A 4U0AA 1YJWP 3HZQA 2BUOA 5DCKA 3CPWO 3G21A 4XFXA 4XRQA 1EOQA 3M1MA 3G29A 2QA4P 3CCEP 1K8AQ 1JJ2O 1VQOP 3E2DA 1S72P 2Z45A 3DPHA 3CCVP 3RG6C 1NJIQ 3G4SP 3CCSP 1VQMP 4U0EA 4COPA 2L6EA 2PEMA 3G26A 5BS1A 1Q82Q 3DS2A 5F2NA 2E1MA 1A8OA 3VRLC 1Q86Q 1N8RQ 1KQSO 3B5IA 3CC4P 1BAJA 1M74A 2BHVA 2M8PA 4GR6A 5HGMA 1K9MQ 1QVFO 3CMAP 2EIAA 1K73Q 3CCLP 1YI2P 5F2OA 2XV6A 4PH0A 2Z44A 2LF4A 3MGEA 3DS5A 4XROA 4U0CA 1YIJP 3CCQP 1M90Q 3LRYA 1QVGO 4QNBA 1VQPP 2CWOA 1VQ5P 1M6NA 3H47A 3G71P 3CC2P 2PENA 1A43A 2QEXP 1Q7YQ 4IPYA 3OW2O 2PEOA 1RNIA 3H4EA 3DS4A 3G1GA 1QRJA 3H0DA 2OARA 3DS0A 3CCJP 3G6EP 3CMEP 3Q20A 3G28A 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  1E6J P;  4U0D A;  2M8N A;  5HGL A;  2JO0 A;  5JPA A;  2JYG A;  3DPH A;  4U0B A;  2XV6 A;  4XFY A;  2JYL A;  4PH0 A;  1AUM A;  2LF4 A;  3MGE A;  4COC A;  3DS1 A;  3DS5 A;  4XFZ A;  4XRO A;  2M8L A;  4U0C A;  5HGO A;  2XXM A;  4M0I A;  3LRY A;  4QNB A;  3DTJ A;  3G0V A;  3DS3 A;  4U0E A;  3H47 A;  4COP A;  2L6E A;  3G26 A;  1D1D A;  5I4T G;  2KOD A;  2ONT A;  5HGN A;  3NTE A;  3DS2 A;  1A43 A;  4PH1 A;  4U0A A;  2BUO A;  4IPY A;  5DCK A;  1EIA A;  3G21 A;  1A8O A;  4U0F A;  3H4E A;  4XFX A;  3DS4 A;  3G1G A;  3VRL C;  1QRJ A;  4XRQ A;  3G1I A;  1EOQ A;  3P05 A;  3G29 A;  1BAJ A;  3DS0 A;  2XT1 A;  5HGM A;  2M8P A;  4WYM A;  3G28 A; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  1ZMB A;  3CCM P;  2K92 A;  2CNR A;  2JO0 A;  2KGA A;  5HGL A;  2MF4 A;  5CZD B;  1YIT P;  1AUM A;  4XFZ A;  2LIU A;  2GZI A;  1GXH A;  3I55 P;  2JB0 A;  4WYM A;  5JPA A;  1DV5 A;  2Z46 A;  4H2X C;  5EW5 E;  1GXG A;  2X2B A;  2AFE A;  3NTE A;  2EHT A;  2KR5 A;  4U0A A;  1YJW P;  2K0X A;  4PXH B;  4QKO A;  2KGC A;  2JU1 A;  2QA4 P;  3GZM A;  1JJ2 O;  4PWV B;  3E2D A;  3DPH A;  2K5X A;  3EJB A;  4HKG A;  2FVF A;  2JBG A;  2GDW A;  4BPG A;  2L6E A;  3G26 A;  3DS2 A;  5F2N A;  3VRL C;  1Q86 Q;  3EJE A;  3B4Q A;  4BPH A;  3CC4 P;  3B5I A;  1M74 A;  2BHV A;  2EIA A;  2JU2 A;  1NQ4 A;  2KGD A;  2JAZ A;  2N6Y A;  3CCQ P;  2VLO A;  3LRY A;  1QVG O;  4QNB A;  3H47 A;  2PEN A;  1A43 A;  4IPY A;  3OW2 O;  3G1G A;  5HV8 A;  2MVU A;  1L0H A;  1QRJ A;  2FAC A;  3LMO A;  3CCJ P;  3G6E P;  3G28 A;  1E6J P;  3WBH A;  2LIW A;  2OTJ P;  1GPJ A;  2FVE A;  2LKI A;  5BS2 A;  2K93 A;  2AFD A;  2PEQ A;  5F2K A;  2CQ8 A;  2XT1 A;  2N5I A;  3CCU P;  2EFJ A;  5EJD A;  2LL8 A;  2PEJ A;  4U0B A;  2VLQ A;  4XFY A;  3CCR P;  1M6E X;  4COC A;  2KOR A;  2XXM A;  2K0Y A;  1F80 D;  1D1D A;  1VQ9 P;  1M1K Q;  3HYB A;  2KOD A;  2ONT A;  5HGN A;  4PH1 A;  3U43 A;  2AF8 A;  2EHS A;  7CEI A;  2WPT A;  1K8A Q;  2M5R A;  1VQO P;  1AYI A;  1S72 P;  2LML A;  2KOP A;  1BXI A;  4CA3 A;  2KW2 A;  3CCS P;  4U0E A;  2L22 A;  3RG2 A;  1Q82 Q;  1Z6M A;  2KWL A;  2FQ2 A;  1A8O A;  1N8R Q;  2N5H A;  1BAJ A;  2KGE A;  2XZ0 D;  5HGM A;  1K9M Q;  2M8P A;  4GR6 A;  2VSQ A;  1EMV A;  3CMA P;  1YI2 P;  5KP8 B;  5HVC A;  2GDY A;  4PH0 A;  4U0C A;  5KP6 B;  1M90 Q;  2CWO A;  3G71 P;  2PEO A;  2GZE A;  3CE7 A;  2VLN A;  2KG6 A;  3DS0 A;  2N98 A;  1VKU A;  4U0D A;  1CEI A;  2GZJ A;  1VQN P;  1W2B O;  1E0H A;  2M8L A;  1VQ6 P;  4M0I A;  2OTL P;  3DS3 A;  2DGY A;  5I4T G;  1HY8 A;  1K30 A;  2GZG A;  1EIA A;  4U0F A;  2PEI A;  2DNW A;  2LOL A;  3G1I A;  3P05 A;  3I56 P;  1KC8 Q;  1VQL P;  1VQ7 P;  2LTE A;  1DNY A;  2JYG A;  1MZ8 A;  2JYL A;  1YJ9 P;  1YHQ P;  4UHP B;  3G0V A;  1IMQ A;  2CG5 B;  1UJZ A;  2CGQ A;  4DG9 A;  5DCK A;  4XFX A;  3G29 A;  2K2Q A;  2Z45 A;  3CCV P;  2N50 A;  2N6Z A;  4H2W C;  1NJI Q;  3G4S P;  3GKL C;  1T8K A;  2ROQ A;  2FVA A;  2PEM A;  5BS1 A;  1HQB A;  2E1M A;  1X3O A;  2K0D X;  2FAD A;  4NEO A;  2KG9 A;  1QVF O;  2VLP A;  2JGP A;  1K73 Q;  5F2O A;  2Z44 A;  2LF4 A;  3MGE A;  4XRO A;  1YIJ P;  2AVA A;  1VQP P;  1M6N A;  1OR5 A;  3CC2 P;  3NY7 B;  2NO8 A;  1Q7Y Q;  2L9F A;  2KOQ A;  3H4E A;  2MR8 A;  4BPF A;  3H0D A;  3CME P;  2JQ4 A;  4H2Y C;  3CD6 P;  1ACP A;  4GR2 A;  1RO2 A;  2P9X A;  1Q81 Q;  4MRT C;  5HGO A;  2MR7 A;  2PY8 A;  1VQK P;  2L4B A;  1IUQ A;  1KD1 Q;  3CC7 P;  3CXC O;  2PEK A;  2QNW A;  2MY5 A;  2M8N A;  1FR2 A;  3DS1 A;  2EG5 A;  2PNG A;  1VQ8 P;  1RO0 A;  1VQ4 P;  3GZL A;  3DTJ A;  1IMP A;  2K94 A;  3HZQ A;  2BUO A;  3CPW O;  2KOO A;  2ERH A;  3G21 A;  2GZF A;  2MD9 A;  4XRQ A;  3EJD A;  1EOQ A;  3M1M A;  4IZ6 A;  1AF8 A;  3GJN A;  2FQ0 A;  3CCE P;  2KG8 A;  2LPK A;  3RG6 C;  4F37 A;  1ZNV A;  2L0Q A;  2GYK A;  1VQM P;  4R0M A;  4COP A;  2FHS C;  2GDX A;  1L0I A;  2MVV A;  3CCL P;  2FAE A;  2XV6 A;  3DS5 A;  2KOS A;  1VQ5 P;  2FQ1 A;  1UNK A;  2QEX P;  1RNI A;  3DS4 A;  1KLP A;  2OAR A;  5KP7 B;  1VHN A;  3Q20 A;  1KQS O;  1YJN P; 
#chains in the Genus database with same CATH homology
 4U0D A;  1E6J P;  1ZMB A;  3WBH A;  3CCM P;  3CD6 P;  5HGL A;  2JO0 A;  4GR2 A;  1RO2 A;  2OTJ P;  1YIT P;  2P9X A;  1Q81 Q;  1AUM A;  1VQN P;  1W2B O;  4XFZ A;  2M8L A;  5HGO A;  1VQ6 P;  2PY8 A;  5BS2 A;  4M0I A;  1VQK P;  2OTL P;  3DS3 A;  2DGY A;  5I4T G;  1K30 A;  1EIA A;  4U0F A;  2PEI A;  1IUQ A;  1KD1 Q;  3G1I A;  2PEQ A;  3P05 A;  5F2K A;  3I56 P;  3CC7 P;  1KC8 Q;  2XT1 A;  1VQ7 P;  1VQL P;  3I55 P;  3CXC O;  4WYM A;  3CCU P;  2PEK A;  2EFJ A;  2M8N A;  5JPA A;  2JYG A;  2PEJ A;  4U0B A;  4XFY A;  3CCR P;  2JYL A;  1M6E X;  2Z46 A;  4COC A;  3DS1 A;  2EG5 A;  1YJ9 P;  1YHQ P;  2XXM A;  1VQ8 P;  1RO0 A;  1VQ4 P;  3DTJ A;  3G0V A;  1VQ9 P;  1D1D A;  1M1K Q;  3HYB A;  2KOD A;  2ONT A;  5HGN A;  3NTE A;  4PH1 A;  4U0A A;  1YJW P;  3HZQ A;  2BUO A;  5DCK A;  3CPW O;  3G21 A;  4XFX A;  4XRQ A;  1EOQ A;  3M1M A;  3G29 A;  2QA4 P;  3CCE P;  1K8A Q;  1JJ2 O;  1VQO P;  3E2D A;  1S72 P;  2Z45 A;  3DPH A;  3CCV P;  3RG6 C;  1NJI Q;  3G4S P;  3CCS P;  1VQM P;  4U0E A;  4COP A;  2L6E A;  2PEM A;  3G26 A;  5BS1 A;  1Q82 Q;  3DS2 A;  5F2N A;  2E1M A;  1A8O A;  3VRL C;  1Q86 Q;  1N8R Q;  1KQS O;  3B5I A;  3CC4 P;  1BAJ A;  1M74 A;  2BHV A;  2M8P A;  4GR6 A;  5HGM A;  1K9M Q;  1QVF O;  3CMA P;  2EIA A;  1K73 Q;  3CCL P;  1YI2 P;  5F2O A;  2XV6 A;  4PH0 A;  2Z44 A;  2LF4 A;  3MGE A;  3DS5 A;  4XRO A;  4U0C A;  1YIJ P;  3CCQ P;  1M90 Q;  3LRY A;  1QVG O;  4QNB A;  1VQP P;  2CWO A;  1VQ5 P;  1M6N A;  3H47 A;  3G71 P;  3CC2 P;  2PEN A;  1A43 A;  2QEX P;  1Q7Y Q;  4IPY A;  3OW2 O;  2PEO A;  1RNI A;  3H4E A;  3DS4 A;  3G1G A;  1QRJ A;  3H0D A;  2OAR A;  3DS0 A;  3CCJ P;  3G6E P;  3CME P;  3Q20 A;  3G28 A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...