5DCKA

Crystal structure of fiv capsid c-terminal domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
71
structure length
71
Chain Sequence
HMVQLRQGAKEDYSSFIDRLFAQIDQEQNTAEVKLYLKQSLSIANANADCKKAMSHLKPESTLEEKLRACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Capsid C-Terminal Domain
publication title Structure of FIV capsid C-terminal domain demonstrates lentiviral evasion of genetic fragility by coevolved substitutions.
pubmed doi rcsb
source organism Feline immunodeficiency virus (isolate petaluma)
total genus 26
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5dckA00
5JPAA 4PH1A 1E6JP 2L6EA 3G29A 5HGMA 4IPYA 3NTEA 3P05A 5DCKA 5HGOA 3DS1A 3DS2A 3DS3A 1BAJA 4WYMA 1EIAA 3DS4A 2JO0A 2XV6A 4U0CA 1QRJA 3G0VA 2XT1A 3H47A 1D1DA 3G21A 4XRQA 2XXMA 2M8PA 4COPA 1AUMA 4COCA 2ONTA 3G1GA 3G28A 3VRLC 4U0DA 4XFXA 3LRYA 3G1IA 2M8LA 5HGLA 1A43A 4U0AA 4QNBA 3DPHA 3DS0A 4M0IA 3MGEA 4XFYA 1A8OA 4XROA 2JYGA 2EIAA 3G26A 4U0BA 5I4TG 2BUOA 3DTJA 3H4EA 4PH0A 2JYLA 5HGNA 4XFZA 3DS5A 4U0EA 2LF4A 2KODA 4U0FA 1EOQA 2M8NA
chains in the Genus database with same CATH superfamily
5KP6B 1Q82Q 3CMAP 2K0XA 1RO0A 2N6YA 3CCQP 3VRLC 1RO2A 2PEKA 2FQ1A 2EIAA 3EJDA 5HGNA 2VLNA 1VQMP 2FHSC 4BPGA 3DS3A 2CGQA 2PEIA 3DPHA 2KGAA 3I56P 3CCSP 4U0BA 5I4TG 2EHSA 2BUOA 4PH0A 3CC7P 2VSQA 2FQ2A 2KGDA 2LPKA 1Q81Q 7CEIA 3GJNA 1VQ5P 1Q7YQ 1MZ8A 2XZ1C 1Z6MA 3LRYA 2M8LA 2N50A 3HZQA 2JYLA 2K0DX 5HV8A 3DS4A 2FAEA 2AVAA 2GZFA 1AF8A 1GPJA 2FVFA 5DCKA 5BS2A 2PEOA 3CD6P 2KOQA 2X2BA 2GZGA 2VLPA 5HVCA 2K5XA 1S72P 3DTJA 2LL8A 1YHQP 1VQNP 2GZIA 1E6JP 2L22A 2N5HA 2GZJA 2JGPA 2XXMA 3G28A 1VKUA 2KG6A 2MR8A 2JQ4A 3Q20A 1NQ4A 3I55P 1YIJP 2DGYA 2GDXA 2N6ZA 1DNYA 2NO8A 2AFEA 2LTEA 3DS5A 2JB0A 1M90Q 2K93A 5HGOA 2KR5A 2JO0A 1QRJA 2ROQA 3EJBA 3HYBA 1YITP 4GR6A 3MGEA 4XROA 1M1KQ 1Q86Q 2WPTA 3GZMA 3H0DA 2KODA 2XZ0D 3NTEA 2P9XA 1FR2A 2PEJA 3G21A 2KG9A 3WBHA 1AUMA 4COCA 3B5IA 3CCMP 3CMEP 4U0AA 4H2YC 2GYKA 5EJDA 2JYGA 1VQOP 1M6EX 4IZ6A 3G6EP 2EG5A 5EW5E 1KD1Q 2L6EA 3DS2A 1EIAA 1BXIA 3LMOA 2OARA 1DV5A 2L0QA 1A43A 2L9FA 4M0IA 4XFYA 1UJZA 1A8OA 3G26A 4HKGA 4NEOA 2FADA 2FVAA 1K30A 2KWLA 4MRTC 1VHNA 2FQ0A 4IPYA 1IMQA 2Z44A 2KORA 2LIWA 2VLQA 2AF8A 3H47A 4H2XC 4XRQA 1HY8A 4COPA 1EMVA 5BS1A 4XFXA 2EFJA 4R0MA 5HGLA 4QKOA 2AFDA 2MY5A 3H4EA 3EJEA 3CPWO 1HQBA 2LF4A 2DNWA 3E2DA 2JAZA 4PH1A 1UNKA 2KOSA 1M6NA 1ACPA 1M74A 3NY7B 3CCJP 2QEXP 2KOOA 4PWVB 1D1DA 2FACA 1VQ8P 2CG5B 3G1IA 1YJ9P 5F2OA 3U43A 3DS0A 1YI2P 3OW2O 5CZDB 1IUQA 1YJWP 4XFZA 3GKLC 4U0DA 2GZEA 2CWOA 2M8NA 1L0HA 1X3OA 2PEMA 1BAJA 4BPFA 5F2KA 3G0VA 2M8PA 2KOPA 2BHVA 2VLOA 4CA3A 2KW2A 1GXHA 2Z45A 1NJIQ 1W2BO 2K92A 5F2NA 5KP8B 1KQSO 3CCUP 2LOLA 2K0YA 1EOQA 1ZMBA 2CQ8A 2KGCA 1K9MQ 1K8AQ 2PY8A 4WYMA 4U0CA 2QNWA 3CCVP 2MF4A 2JU1A 1CEIA 2Z46A 1VQ6P 1KLPA 2GDWA 1KC8Q 2K94A 2PNGA 3P05A 1JJ2O 2ERHA 3CCRP 3CC4P 2LMLA 1VQLP 1VQ4P 3RG6C 4PXHB 4GR2A 4H2WC 1E0HA 2FVEA 2PEQA 2CNRA 4F37A 3CCEP 5HGMA 2PENA 4BPHA 3DS1A 1VQ7P 1QVFO 2M5RA 1L0IA 2N5IA 1GXGA 2MR7A 1OR5A 2L4BA 1N8RQ 3CCLP 1ZNVA 3GZLA 4UHPB 3CXCO 3G29A 2E1MA 1F80D 1RNIA 2MVVA 1AYIA 2XV6A 1VQPP 1VQ9P 2ONTA 3G1GA 3M1MA 3CE7A 3B4QA 2GDYA 4QNBA 2N98A 5KP7B 1T8KA 2OTJP 2EHTA 4U0FA 5JPAA 2OTLP 1QVGO 2KGEA 2LKIA 3RG2A 1IMPA 2LIUA 1K73Q 2MD9A 2XT1A 4DG9A 3G71P 1VQKP 2JU2A 3CC2P 2JBGA 3G4SP 2KG8A 2QA4P 1YJNP 4U0EA 2MVUA 2K2QA
chains in the Genus database with same CATH topology
1E6JP 1Q82Q 4IPYA 3CMAP 3P05A 1JJ2O 2Z44A 1RO0A 3CCRP 3CC4P 3H47A 3CCQP 4XRQA 2XXMA 4COPA 3G28A 1VQLP 3VRLC 5BS1A 4XFXA 2EFJA 1VQ4P 1RO2A 3RG6C 5HGLA 3I55P 3Q20A 4GR2A 2PEKA 1YIJP 2DGYA 2EIAA 3H4EA 3CPWO 2PEQA 3DS5A 2LF4A 5HGNA 3E2DA 1VQMP 1M90Q 4PH1A 3CCEP 5HGMA 2PENA 1M6NA 1M74A 5HGOA 3DS1A 1VQ7P 3DS3A 1QVFO 2JO0A 1QRJA 3CCJP 2QEXP 1D1DA 3HYBA 2PEIA 1VQ8P 3G1IA 1YITP 1YJ9P 5F2OA 4GR6A 3DPHA 3DS0A 3I56P 3MGEA 3CCSP 1YI2P 1N8RQ 4XROA 3OW2O 1M1KQ 3CCLP 1Q86Q 4U0BA 5I4TG 2BUOA 4PH0A 3CC7P 1IUQA 1YJWP 4XFZA 3H0DA 2KODA 4U0DA 2CWOA 2M8NA 3CXCO 3G29A 2E1MA 1RNIA 1Q81Q 3NTEA 2P9XA 2PEMA 1BAJA 5F2KA 1VQ5P 2XV6A 3G0VA 1Q7YQ 1VQPP 2PEJA 3G21A 2M8PA 3WBHA 1AUMA 4COCA 1VQ9P 2ONTA 3B5IA 3G1GA 3M1MA 2BHVA 3LRYA 2M8LA 3CCMP 3CMEP 4U0AA 4QNBA 2Z45A 1NJIQ 3HZQA 1W2BO 2JYGA 5F2NA 1VQOP 1M6EX 1KQSO 2JYLA 3CCUP 2OTJP 3DS4A 4U0FA 1EOQA 3G6EP 1ZMBA 5JPAA 2OTLP 2EG5A 1KD1Q 2L6EA 1QVGO 5DCKA 1K9MQ 1K8AQ 3DS2A 2PY8A 1K73Q 4WYMA 1EIAA 4U0CA 5BS2A 2XT1A 2PEOA 3CCVP 3CD6P 2OARA 3G71P 1VQKP 1A43A 3CC2P 4M0IA 4XFYA 1A8OA 3G26A 3G4SP 1S72P 3DTJA 2Z46A 1VQ6P 1YHQP 2QA4P 1YJNP 1VQNP 4U0EA 1KC8Q 1K30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  4PH1 A;  1E6J P;  2L6E A;  3G29 A;  5HGM A;  4IPY A;  3NTE A;  3P05 A;  5DCK A;  5HGO A;  3DS1 A;  3DS2 A;  3DS3 A;  1BAJ A;  4WYM A;  1EIA A;  3DS4 A;  2JO0 A;  2XV6 A;  4U0C A;  1QRJ A;  3G0V A;  2XT1 A;  3H47 A;  1D1D A;  3G21 A;  4XRQ A;  2XXM A;  2M8P A;  4COP A;  1AUM A;  4COC A;  2ONT A;  3G1G A;  3G28 A;  3VRL C;  4U0D A;  4XFX A;  3LRY A;  3G1I A;  2M8L A;  5HGL A;  1A43 A;  4U0A A;  4QNB A;  3DPH A;  3DS0 A;  4M0I A;  3MGE A;  4XFY A;  1A8O A;  4XRO A;  2JYG A;  2EIA A;  3G26 A;  4U0B A;  5I4T G;  2BUO A;  3DTJ A;  3H4E A;  4PH0 A;  2JYL A;  5HGN A;  4XFZ A;  3DS5 A;  4U0E A;  2LF4 A;  2KOD A;  4U0F A;  1EOQ A;  2M8N A; 
#chains in the Genus database with same CATH topology
 5KP6 B;  1Q82 Q;  3CMA P;  2K0X A;  1RO0 A;  2N6Y A;  3CCQ P;  3VRL C;  1RO2 A;  2PEK A;  2FQ1 A;  2EIA A;  3EJD A;  5HGN A;  2VLN A;  1VQM P;  2FHS C;  4BPG A;  3DS3 A;  2CGQ A;  2PEI A;  3DPH A;  2KGA A;  3I56 P;  3CCS P;  4U0B A;  5I4T G;  2EHS A;  2BUO A;  4PH0 A;  3CC7 P;  2VSQ A;  2FQ2 A;  2KGD A;  2LPK A;  1Q81 Q;  7CEI A;  3GJN A;  1VQ5 P;  1Q7Y Q;  1MZ8 A;  2XZ1 C;  1Z6M A;  3LRY A;  2M8L A;  2N50 A;  3HZQ A;  2JYL A;  2K0D X;  5HV8 A;  3DS4 A;  2FAE A;  2AVA A;  2GZF A;  1AF8 A;  1GPJ A;  2FVF A;  5DCK A;  5BS2 A;  2PEO A;  3CD6 P;  2KOQ A;  2X2B A;  2GZG A;  2VLP A;  5HVC A;  2K5X A;  1S72 P;  3DTJ A;  2LL8 A;  1YHQ P;  1VQN P;  2GZI A;  1E6J P;  2L22 A;  2N5H A;  2GZJ A;  2JGP A;  2XXM A;  3G28 A;  1VKU A;  2KG6 A;  2MR8 A;  2JQ4 A;  3Q20 A;  1NQ4 A;  3I55 P;  1YIJ P;  2DGY A;  2GDX A;  2N6Z A;  1DNY A;  2NO8 A;  2AFE A;  2LTE A;  3DS5 A;  2JB0 A;  1M90 Q;  2K93 A;  5HGO A;  2KR5 A;  2JO0 A;  1QRJ A;  2ROQ A;  3EJB A;  3HYB A;  1YIT P;  4GR6 A;  3MGE A;  4XRO A;  1M1K Q;  1Q86 Q;  2WPT A;  3GZM A;  3H0D A;  2KOD A;  2XZ0 D;  3NTE A;  2P9X A;  1FR2 A;  2PEJ A;  3G21 A;  2KG9 A;  3WBH A;  1AUM A;  4COC A;  3B5I A;  3CCM P;  3CME P;  4U0A A;  4H2Y C;  2GYK A;  5EJD A;  2JYG A;  1VQO P;  1M6E X;  4IZ6 A;  3G6E P;  2EG5 A;  5EW5 E;  1KD1 Q;  2L6E A;  3DS2 A;  1EIA A;  1BXI A;  3LMO A;  2OAR A;  1DV5 A;  2L0Q A;  1A43 A;  2L9F A;  4M0I A;  4XFY A;  1UJZ A;  1A8O A;  3G26 A;  4HKG A;  4NEO A;  2FAD A;  2FVA A;  1K30 A;  2KWL A;  4MRT C;  1VHN A;  2FQ0 A;  4IPY A;  1IMQ A;  2Z44 A;  2KOR A;  2LIW A;  2VLQ A;  2AF8 A;  3H47 A;  4H2X C;  4XRQ A;  1HY8 A;  4COP A;  1EMV A;  5BS1 A;  4XFX A;  2EFJ A;  4R0M A;  5HGL A;  4QKO A;  2AFD A;  2MY5 A;  3H4E A;  3EJE A;  3CPW O;  1HQB A;  2LF4 A;  2DNW A;  3E2D A;  2JAZ A;  4PH1 A;  1UNK A;  2KOS A;  1M6N A;  1ACP A;  1M74 A;  3NY7 B;  3CCJ P;  2QEX P;  2KOO A;  4PWV B;  1D1D A;  2FAC A;  1VQ8 P;  2CG5 B;  3G1I A;  1YJ9 P;  5F2O A;  3U43 A;  3DS0 A;  1YI2 P;  3OW2 O;  5CZD B;  1IUQ A;  1YJW P;  4XFZ A;  3GKL C;  4U0D A;  2GZE A;  2CWO A;  2M8N A;  1L0H A;  1X3O A;  2PEM A;  1BAJ A;  4BPF A;  5F2K A;  3G0V A;  2M8P A;  2KOP A;  2BHV A;  2VLO A;  4CA3 A;  2KW2 A;  1GXH A;  2Z45 A;  1NJI Q;  1W2B O;  2K92 A;  5F2N A;  5KP8 B;  1KQS O;  3CCU P;  2LOL A;  2K0Y A;  1EOQ A;  1ZMB A;  2CQ8 A;  2KGC A;  1K9M Q;  1K8A Q;  2PY8 A;  4WYM A;  4U0C A;  2QNW A;  3CCV P;  2MF4 A;  2JU1 A;  1CEI A;  2Z46 A;  1VQ6 P;  1KLP A;  2GDW A;  1KC8 Q;  2K94 A;  2PNG A;  3P05 A;  1JJ2 O;  2ERH A;  3CCR P;  3CC4 P;  2LML A;  1VQL P;  1VQ4 P;  3RG6 C;  4PXH B;  4GR2 A;  4H2W C;  1E0H A;  2FVE A;  2PEQ A;  2CNR A;  4F37 A;  3CCE P;  5HGM A;  2PEN A;  4BPH A;  3DS1 A;  1VQ7 P;  1QVF O;  2M5R A;  1L0I A;  2N5I A;  1GXG A;  2MR7 A;  1OR5 A;  2L4B A;  1N8R Q;  3CCL P;  1ZNV A;  3GZL A;  4UHP B;  3CXC O;  3G29 A;  2E1M A;  1F80 D;  1RNI A;  2MVV A;  1AYI A;  2XV6 A;  1VQP P;  1VQ9 P;  2ONT A;  3G1G A;  3M1M A;  3CE7 A;  3B4Q A;  2GDY A;  4QNB A;  2N98 A;  5KP7 B;  1T8K A;  2OTJ P;  2EHT A;  4U0F A;  5JPA A;  2OTL P;  1QVG O;  2KGE A;  2LKI A;  3RG2 A;  1IMP A;  2LIU A;  1K73 Q;  2MD9 A;  2XT1 A;  4DG9 A;  3G71 P;  1VQK P;  2JU2 A;  3CC2 P;  2JBG A;  3G4S P;  2KG8 A;  2QA4 P;  1YJN P;  4U0E A;  2MVU A;  2K2Q A; 
#chains in the Genus database with same CATH homology
 1E6J P;  1Q82 Q;  4IPY A;  3CMA P;  3P05 A;  1JJ2 O;  2Z44 A;  1RO0 A;  3CCR P;  3CC4 P;  3H47 A;  3CCQ P;  4XRQ A;  2XXM A;  4COP A;  3G28 A;  1VQL P;  3VRL C;  5BS1 A;  4XFX A;  2EFJ A;  1VQ4 P;  1RO2 A;  3RG6 C;  5HGL A;  3I55 P;  3Q20 A;  4GR2 A;  2PEK A;  1YIJ P;  2DGY A;  2EIA A;  3H4E A;  3CPW O;  2PEQ A;  3DS5 A;  2LF4 A;  5HGN A;  3E2D A;  1VQM P;  1M90 Q;  4PH1 A;  3CCE P;  5HGM A;  2PEN A;  1M6N A;  1M74 A;  5HGO A;  3DS1 A;  1VQ7 P;  3DS3 A;  1QVF O;  2JO0 A;  1QRJ A;  3CCJ P;  2QEX P;  1D1D A;  3HYB A;  2PEI A;  1VQ8 P;  3G1I A;  1YIT P;  1YJ9 P;  5F2O A;  4GR6 A;  3DPH A;  3DS0 A;  3I56 P;  3MGE A;  3CCS P;  1YI2 P;  1N8R Q;  4XRO A;  3OW2 O;  1M1K Q;  3CCL P;  1Q86 Q;  4U0B A;  5I4T G;  2BUO A;  4PH0 A;  3CC7 P;  1IUQ A;  1YJW P;  4XFZ A;  3H0D A;  2KOD A;  4U0D A;  2CWO A;  2M8N A;  3CXC O;  3G29 A;  2E1M A;  1RNI A;  1Q81 Q;  3NTE A;  2P9X A;  2PEM A;  1BAJ A;  5F2K A;  1VQ5 P;  2XV6 A;  3G0V A;  1Q7Y Q;  1VQP P;  2PEJ A;  3G21 A;  2M8P A;  3WBH A;  1AUM A;  4COC A;  1VQ9 P;  2ONT A;  3B5I A;  3G1G A;  3M1M A;  2BHV A;  3LRY A;  2M8L A;  3CCM P;  3CME P;  4U0A A;  4QNB A;  2Z45 A;  1NJI Q;  3HZQ A;  1W2B O;  2JYG A;  5F2N A;  1VQO P;  1M6E X;  1KQS O;  2JYL A;  3CCU P;  2OTJ P;  3DS4 A;  4U0F A;  1EOQ A;  3G6E P;  1ZMB A;  5JPA A;  2OTL P;  2EG5 A;  1KD1 Q;  2L6E A;  1QVG O;  5DCK A;  1K9M Q;  1K8A Q;  3DS2 A;  2PY8 A;  1K73 Q;  4WYM A;  1EIA A;  4U0C A;  5BS2 A;  2XT1 A;  2PEO A;  3CCV P;  3CD6 P;  2OAR A;  3G71 P;  1VQK P;  1A43 A;  3CC2 P;  4M0I A;  4XFY A;  1A8O A;  3G26 A;  3G4S P;  1S72 P;  3DTJ A;  2Z46 A;  1VQ6 P;  1YHQ P;  2QA4 P;  1YJN P;  1VQN P;  4U0E A;  1KC8 Q;  1K30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...