2LKIA

Solution nmr structure of holo acyl carrier protein ne2163 from nitrosomonas europaea. northeast structural genomics consortium target net1.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
MQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVDDDEISAQTFETLGSLALFVEHKLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of acyl carrier protein from Nitrosomonas Europaea
pubmed rcsb
source organism Nitrosomonas europaea
molecule tags Lipid transport
molecule keywords Putative uncharacterized protein
total genus 29
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lkiA00
2ROQA 3NY7B 4IZ6A 2XZ1C 5HVCA 2L4BA 2N5HA 4R0MA 2LIWA 2AFDA 1L0IA 2L9FA 1AF8A 4CA3A 2L0QA 2GDYA 2KG8A 3EJDA 4PXHB 2FQ1A 2KWLA 2KOSA 5EJDA 2N50A 3CE7A 2N5IA 2CG5B 2LL8A 1DV5A 2JU2A 2KOOA 1OR5A 4BPGA 4H2YC 1KLPA 4H2WC 2N98A 2KGEA 2MF4A 2KGDA 2FVAA 3GZMA 2K93A 2PNGA 1L0HA 2FVEA 2LMLA 1F80D 2GDXA 2MR8A 2JGPA 2K2QA 2KOPA 2GDWA 2N6ZA 2FACA 2AVAA 5HV8A 2MR7A 2KG9A 3LMOA 1HQBA 1X3OA 2JU1A 2FQ2A 2KW2A 4HKGA 1ACPA 2KR5A 2MY5A 2LIUA 4MRTC 5CZDB 3EJEA 2AFEA 5KP8B 2LTEA 2KOQA 4BPHA 1NQ4A 4H2XC 2KGCA 2FHSC 5KP6B 2DNWA 2MVUA 2VSQA 2K94A 4BPFA 2K0XA 2FVFA 5KP7B 2KGAA 2QNWA 2CQ8A 2MVVA 2KORA 2CNRA 2FQ0A 2XZ0D 4DG9A 2FAEA 2K92A 1VKUA 2MD9A 2LOLA 3GZLA 2K0YA 2EHTA 2L22A 2N6YA 2KG6A 2FADA 2JQ4A 4NEOA 2LKIA 4PWVB 3RG2A 2M5RA 2CGQA 1T8KA 2EHSA 2X2BA 1HY8A 3EJBA 1DNYA 2AF8A 2LPKA
chains in the Genus database with same CATH superfamily
4IZ6A 2PEIA 3DS3A 1UNKA 2PEQA 2BUOA 1L0IA 2GZGA 2L9FA 2XV6A 4GR2A 2L0QA 1IMQA 4F37A 4UHPB 1Q86Q 2CG5B 4PH1A 5BS1A 2JU2A 1OR5A 4XFZA 4BPGA 4H2YC 1KLPA 2ERHA 2KGEA 2GZEA 2PNGA 3G29A 2PEOA 2KODA 3G1GA 3H47A 3DS4A 1F80D 2GDXA 2MR8A 2K2QA 3H4EA 2GDWA 2N6ZA 1YJ9P 2FACA 1ZMBA 1CEIA 3CCUP 1VQPP 2JAZA 3LMOA 1HQBA 2JU1A 1EMVA 3I55P 2GYKA 5HGLA 5CZDB 2LIUA 2CWOA 1Q7YQ 4MRTC 5I4TG 5KP8B 1VQNP 1GXHA 2JYLA 2KOQA 1VQ6P 2M8LA 1YHQP 3G4SP 5KP6B 1YIJP 1VQ4P 3DTJA 3E2DA 1VQ5P 2KGAA 3LRYA 2MVVA 2KORA 3MGEA 1NJIQ 4DG9A 2MD9A 1D1DA 1A43A 2N6YA 1A8OA 2FADA 2JQ4A 1YJWP 1M6EX 1Z6MA 3CCVP 4U0CA 1T8KA 2EFJA 1W2BO 1N8RQ 2EG5A 1DNYA 3CXCO 4XFXA 3NY7B 1EIAA 2XZ1C 4IPYA 1RO0A 2KG8A 1ZNVA 3CC2P 3CE7A 2KOOA 2EIAA 1VQ8P 2Z45A 1AUMA 1VQKP 3I56P 2AVAA 1VQMP 2MR7A 1M74A 3DS2A 1VQLP 2LF4A 3CMEP 2KW2A 1K73Q 1K8AQ 1ACPA 3VRLC 3EJEA 5HGOA 5F2KA 3B4QA 3DS0A 4BPHA 2QA4P 1UJZA 2K0DX 2VLNA 2JYGA 2MVUA 2K0XA 5KP7B 4PH0A 2CQ8A 3HYBA 2CNRA 4U0AA 2FQ0A 2XZ0D 4U0DA 2FAEA 1E6JP 4U0FA 2LOLA 3GZLA 2M8PA 2K0YA 2EHTA 2L22A 2BHVA 4PWVB 3G21A 5EW5E 1JJ2O 5HGMA 2M5RA 5F2OA 2OARA 2NO8A 2CGQA 3H0DA 2DGYA 3CCLP 1HY8A 1FR2A 1GXGA 1BAJA 3CMAP 4XRQA 1M6NA 5HVCA 3G28A 1AYIA 4R0MA 3CC4P 2WPTA 1AF8A 4CA3A 3P05A 3M1MA 5EJDA 2N50A 2N5IA 2P9XA 2LL8A 3CCEP 3U43A 4H2WC 2FVAA 2K93A 2LMLA 3WBHA 3DS5A 2KOPA 1IMPA 1MZ8A 4QNBA 2OTJP 5HV8A 4XFYA 3DPHA 2FQ2A 1YI2P 4HKGA 1QRJA 3CC7P 2GZFA 2JBGA 2PEJA 1YJNP 1GPJA 1VHNA 4COPA 2XXMA 2KGCA 2FHSC 1EOQA 2DNWA 5BS2A 2GZIA 1KQSO 2QEXP 5DCKA 4M0IA 1YITP 5F2NA 2K92A 2Z44A 1M1KQ 1E0HA 2KG6A 4GR6A 4NEOA 2LKIA 3CCJP 2VLQA 5HGNA 3RG2A 3G6EP 2VLOA 3G26A 1BXIA 1M90Q 2XT1A 3DS1A 2Z46A 3EJBA 2AF8A 2PY8A 3OW2O 1QVGO 2K5XA 2ROQA 2L4BA 2N5HA 2PEKA 2LIWA 5JPAA 2AFDA 3EJDA 2GDYA 4PXHB 2FQ1A 2KWLA 2KOSA 2JB0A 2VLPA 1DV5A 2L6EA 1RNIA 2GZJA 2N98A 3Q20A 2MF4A 2KGDA 1K30A 3GZMA 4WYMA 1L0HA 2FVEA 3CPWO 4U0EA 2JGPA 3RG6C 1KD1Q 4XROA 4QKOA 2KG9A 7CEIA 3CD6P 2PEMA 1X3OA 2M8NA 2KR5A 2MY5A 2AFEA 1VQ9P 2LTEA 1NQ4A 3CCMP 1K9MQ 4H2XC 1VQOP 2ONTA 3G0VA 2VSQA 2K94A 4BPFA 2FVFA 1KC8Q 3CCRP 1IUQA 2PENA 3CCSP 3G71P 2QNWA 3B5IA 2E1MA 3CCQP 4COCA 4U0BA 1Q81Q 1VKUA 2JO0A 1RO2A 3GKLC 1VQ7P 1QVFO 1Q82Q 3NTEA 3HZQA 1S72P 3GJNA 3G1IA 2EHSA 2X2BA 2OTLP 2LPKA
chains in the Genus database with same CATH topology
2ROQA 3NY7B 4IZ6A 2XZ1C 5HVCA 2L4BA 2N5HA 4R0MA 2LIWA 2AFDA 1L0IA 2L9FA 1AF8A 4CA3A 2L0QA 2GDYA 2KG8A 3EJDA 4PXHB 2FQ1A 2KWLA 2KOSA 5EJDA 2N50A 3CE7A 2N5IA 2CG5B 2LL8A 1DV5A 2JU2A 2KOOA 1OR5A 4BPGA 4H2YC 1KLPA 4H2WC 2N98A 2KGEA 2MF4A 2KGDA 2FVAA 3GZMA 2K93A 2PNGA 1L0HA 2FVEA 2LMLA 1F80D 2GDXA 2MR8A 2JGPA 2K2QA 2KOPA 2GDWA 2N6ZA 2FACA 2AVAA 5HV8A 2MR7A 2KG9A 3LMOA 1HQBA 1X3OA 2JU1A 2FQ2A 2KW2A 4HKGA 1ACPA 2KR5A 2MY5A 2LIUA 4MRTC 5CZDB 3EJEA 2AFEA 5KP8B 2LTEA 2KOQA 4BPHA 1NQ4A 4H2XC 2KGCA 2FHSC 5KP6B 2DNWA 2MVUA 2VSQA 2K94A 4BPFA 2K0XA 2FVFA 5KP7B 2KGAA 2QNWA 2CQ8A 2MVVA 2KORA 2CNRA 2FQ0A 2XZ0D 4DG9A 2FAEA 2K92A 1VKUA 2MD9A 2LOLA 3GZLA 2K0YA 2EHTA 2L22A 2N6YA 2KG6A 2FADA 2JQ4A 4NEOA 2LKIA 4PWVB 3RG2A 2M5RA 2CGQA 1T8KA 2EHSA 2X2BA 1HY8A 3EJBA 1DNYA 2AF8A 2LPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROQ A;  3NY7 B;  4IZ6 A;  2XZ1 C;  5HVC A;  2L4B A;  2N5H A;  4R0M A;  2LIW A;  2AFD A;  1L0I A;  2L9F A;  1AF8 A;  4CA3 A;  2L0Q A;  2GDY A;  2KG8 A;  3EJD A;  4PXH B;  2FQ1 A;  2KWL A;  2KOS A;  5EJD A;  2N50 A;  3CE7 A;  2N5I A;  2CG5 B;  2LL8 A;  1DV5 A;  2JU2 A;  2KOO A;  1OR5 A;  4BPG A;  4H2Y C;  1KLP A;  4H2W C;  2N98 A;  2KGE A;  2MF4 A;  2KGD A;  2FVA A;  3GZM A;  2K93 A;  2PNG A;  1L0H A;  2FVE A;  2LML A;  1F80 D;  2GDX A;  2MR8 A;  2JGP A;  2K2Q A;  2KOP A;  2GDW A;  2N6Z A;  2FAC A;  2AVA A;  5HV8 A;  2MR7 A;  2KG9 A;  3LMO A;  1HQB A;  1X3O A;  2JU1 A;  2FQ2 A;  2KW2 A;  4HKG A;  1ACP A;  2KR5 A;  2MY5 A;  2LIU A;  4MRT C;  5CZD B;  3EJE A;  2AFE A;  5KP8 B;  2LTE A;  2KOQ A;  4BPH A;  1NQ4 A;  4H2X C;  2KGC A;  2FHS C;  5KP6 B;  2DNW A;  2MVU A;  2VSQ A;  2K94 A;  4BPF A;  2K0X A;  2FVF A;  5KP7 B;  2KGA A;  2QNW A;  2CQ8 A;  2MVV A;  2KOR A;  2CNR A;  2FQ0 A;  2XZ0 D;  4DG9 A;  2FAE A;  2K92 A;  1VKU A;  2MD9 A;  2LOL A;  3GZL A;  2K0Y A;  2EHT A;  2L22 A;  2N6Y A;  2KG6 A;  2FAD A;  2JQ4 A;  4NEO A;  2LKI A;  4PWV B;  3RG2 A;  2M5R A;  2CGQ A;  1T8K A;  2EHS A;  2X2B A;  1HY8 A;  3EJB A;  1DNY A;  2AF8 A;  2LPK A; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  2PEI A;  3DS3 A;  1UNK A;  2PEQ A;  2BUO A;  1L0I A;  2GZG A;  2L9F A;  2XV6 A;  4GR2 A;  2L0Q A;  1IMQ A;  4F37 A;  4UHP B;  1Q86 Q;  2CG5 B;  4PH1 A;  5BS1 A;  2JU2 A;  1OR5 A;  4XFZ A;  4BPG A;  4H2Y C;  1KLP A;  2ERH A;  2KGE A;  2GZE A;  2PNG A;  3G29 A;  2PEO A;  2KOD A;  3G1G A;  3H47 A;  3DS4 A;  1F80 D;  2GDX A;  2MR8 A;  2K2Q A;  3H4E A;  2GDW A;  2N6Z A;  1YJ9 P;  2FAC A;  1ZMB A;  1CEI A;  3CCU P;  1VQP P;  2JAZ A;  3LMO A;  1HQB A;  2JU1 A;  1EMV A;  3I55 P;  2GYK A;  5HGL A;  5CZD B;  2LIU A;  2CWO A;  1Q7Y Q;  4MRT C;  5I4T G;  5KP8 B;  1VQN P;  1GXH A;  2JYL A;  2KOQ A;  1VQ6 P;  2M8L A;  1YHQ P;  3G4S P;  5KP6 B;  1YIJ P;  1VQ4 P;  3DTJ A;  3E2D A;  1VQ5 P;  2KGA A;  3LRY A;  2MVV A;  2KOR A;  3MGE A;  1NJI Q;  4DG9 A;  2MD9 A;  1D1D A;  1A43 A;  2N6Y A;  1A8O A;  2FAD A;  2JQ4 A;  1YJW P;  1M6E X;  1Z6M A;  3CCV P;  4U0C A;  1T8K A;  2EFJ A;  1W2B O;  1N8R Q;  2EG5 A;  1DNY A;  3CXC O;  4XFX A;  3NY7 B;  1EIA A;  2XZ1 C;  4IPY A;  1RO0 A;  2KG8 A;  1ZNV A;  3CC2 P;  3CE7 A;  2KOO A;  2EIA A;  1VQ8 P;  2Z45 A;  1AUM A;  1VQK P;  3I56 P;  2AVA A;  1VQM P;  2MR7 A;  1M74 A;  3DS2 A;  1VQL P;  2LF4 A;  3CME P;  2KW2 A;  1K73 Q;  1K8A Q;  1ACP A;  3VRL C;  3EJE A;  5HGO A;  5F2K A;  3B4Q A;  3DS0 A;  4BPH A;  2QA4 P;  1UJZ A;  2K0D X;  2VLN A;  2JYG A;  2MVU A;  2K0X A;  5KP7 B;  4PH0 A;  2CQ8 A;  3HYB A;  2CNR A;  4U0A A;  2FQ0 A;  2XZ0 D;  4U0D A;  2FAE A;  1E6J P;  4U0F A;  2LOL A;  3GZL A;  2M8P A;  2K0Y A;  2EHT A;  2L22 A;  2BHV A;  4PWV B;  3G21 A;  5EW5 E;  1JJ2 O;  5HGM A;  2M5R A;  5F2O A;  2OAR A;  2NO8 A;  2CGQ A;  3H0D A;  2DGY A;  3CCL P;  1HY8 A;  1FR2 A;  1GXG A;  1BAJ A;  3CMA P;  4XRQ A;  1M6N A;  5HVC A;  3G28 A;  1AYI A;  4R0M A;  3CC4 P;  2WPT A;  1AF8 A;  4CA3 A;  3P05 A;  3M1M A;  5EJD A;  2N50 A;  2N5I A;  2P9X A;  2LL8 A;  3CCE P;  3U43 A;  4H2W C;  2FVA A;  2K93 A;  2LML A;  3WBH A;  3DS5 A;  2KOP A;  1IMP A;  1MZ8 A;  4QNB A;  2OTJ P;  5HV8 A;  4XFY A;  3DPH A;  2FQ2 A;  1YI2 P;  4HKG A;  1QRJ A;  3CC7 P;  2GZF A;  2JBG A;  2PEJ A;  1YJN P;  1GPJ A;  1VHN A;  4COP A;  2XXM A;  2KGC A;  2FHS C;  1EOQ A;  2DNW A;  5BS2 A;  2GZI A;  1KQS O;  2QEX P;  5DCK A;  4M0I A;  1YIT P;  5F2N A;  2K92 A;  2Z44 A;  1M1K Q;  1E0H A;  2KG6 A;  4GR6 A;  4NEO A;  2LKI A;  3CCJ P;  2VLQ A;  5HGN A;  3RG2 A;  3G6E P;  2VLO A;  3G26 A;  1BXI A;  1M90 Q;  2XT1 A;  3DS1 A;  2Z46 A;  3EJB A;  2AF8 A;  2PY8 A;  3OW2 O;  1QVG O;  2K5X A;  2ROQ A;  2L4B A;  2N5H A;  2PEK A;  2LIW A;  5JPA A;  2AFD A;  3EJD A;  2GDY A;  4PXH B;  2FQ1 A;  2KWL A;  2KOS A;  2JB0 A;  2VLP A;  1DV5 A;  2L6E A;  1RNI A;  2GZJ A;  2N98 A;  3Q20 A;  2MF4 A;  2KGD A;  1K30 A;  3GZM A;  4WYM A;  1L0H A;  2FVE A;  3CPW O;  4U0E A;  2JGP A;  3RG6 C;  1KD1 Q;  4XRO A;  4QKO A;  2KG9 A;  7CEI A;  3CD6 P;  2PEM A;  1X3O A;  2M8N A;  2KR5 A;  2MY5 A;  2AFE A;  1VQ9 P;  2LTE A;  1NQ4 A;  3CCM P;  1K9M Q;  4H2X C;  1VQO P;  2ONT A;  3G0V A;  2VSQ A;  2K94 A;  4BPF A;  2FVF A;  1KC8 Q;  3CCR P;  1IUQ A;  2PEN A;  3CCS P;  3G71 P;  2QNW A;  3B5I A;  2E1M A;  3CCQ P;  4COC A;  4U0B A;  1Q81 Q;  1VKU A;  2JO0 A;  1RO2 A;  3GKL C;  1VQ7 P;  1QVF O;  1Q82 Q;  3NTE A;  3HZQ A;  1S72 P;  3GJN A;  3G1I A;  2EHS A;  2X2B A;  2OTL P;  2LPK A; 
#chains in the Genus database with same CATH homology
 2ROQ A;  3NY7 B;  4IZ6 A;  2XZ1 C;  5HVC A;  2L4B A;  2N5H A;  4R0M A;  2LIW A;  2AFD A;  1L0I A;  2L9F A;  1AF8 A;  4CA3 A;  2L0Q A;  2GDY A;  2KG8 A;  3EJD A;  4PXH B;  2FQ1 A;  2KWL A;  2KOS A;  5EJD A;  2N50 A;  3CE7 A;  2N5I A;  2CG5 B;  2LL8 A;  1DV5 A;  2JU2 A;  2KOO A;  1OR5 A;  4BPG A;  4H2Y C;  1KLP A;  4H2W C;  2N98 A;  2KGE A;  2MF4 A;  2KGD A;  2FVA A;  3GZM A;  2K93 A;  2PNG A;  1L0H A;  2FVE A;  2LML A;  1F80 D;  2GDX A;  2MR8 A;  2JGP A;  2K2Q A;  2KOP A;  2GDW A;  2N6Z A;  2FAC A;  2AVA A;  5HV8 A;  2MR7 A;  2KG9 A;  3LMO A;  1HQB A;  1X3O A;  2JU1 A;  2FQ2 A;  2KW2 A;  4HKG A;  1ACP A;  2KR5 A;  2MY5 A;  2LIU A;  4MRT C;  5CZD B;  3EJE A;  2AFE A;  5KP8 B;  2LTE A;  2KOQ A;  4BPH A;  1NQ4 A;  4H2X C;  2KGC A;  2FHS C;  5KP6 B;  2DNW A;  2MVU A;  2VSQ A;  2K94 A;  4BPF A;  2K0X A;  2FVF A;  5KP7 B;  2KGA A;  2QNW A;  2CQ8 A;  2MVV A;  2KOR A;  2CNR A;  2FQ0 A;  2XZ0 D;  4DG9 A;  2FAE A;  2K92 A;  1VKU A;  2MD9 A;  2LOL A;  3GZL A;  2K0Y A;  2EHT A;  2L22 A;  2N6Y A;  2KG6 A;  2FAD A;  2JQ4 A;  4NEO A;  2LKI A;  4PWV B;  3RG2 A;  2M5R A;  2CGQ A;  1T8K A;  2EHS A;  2X2B A;  1HY8 A;  3EJB A;  1DNY A;  2AF8 A;  2LPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...