2LKIA

Solution nmr structure of holo acyl carrier protein ne2163 from nitrosomonas europaea. northeast structural genomics consortium target net1.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
MQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVDDDEISAQTFETLGSLALFVEHKLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Putative uncharacterized protein
publication title Solution structure of acyl carrier protein from Nitrosomonas Europaea
pubmed rcsb
source organism Nitrosomonas europaea
total genus 29
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lkiA00
1DV5A 2CNRA 2KG8A 2N6YA 2MR7A 2N98A 2MD9A 2FQ2A 3RG2A 2LIWA 5EJDA 1AF8A 3GZLA 2KG9A 2XZ1C 1L0HA 2KW2A 1NQ4A 2KOPA 2MR8A 2JU1A 2JGPA 2KGAA 2EHTA 2AF8A 2N5HA 5HV8A 2K92A 2AFEA 2DNWA 2N6ZA 2FVEA 2EHSA 2N50A 2LIUA 2KG6A 2MVUA 2GDWA 4DG9A 4CA3A 2AVAA 5KP6B 2FADA 2FHSC 2KOOA 4BPGA 2L9FA 2QNWA 3CE7A 2M5RA 2MF4A 3GZMA 2JU2A 2KR5A 2FVAA 3EJDA 2KOQA 4BPFA 2N5IA 2PNGA 2KOSA 2FQ1A 2K0YA 2L4BA 4H2YC 2K93A 2FAEA 2K2QA 1T8KA 2CGQA 2FVFA 2VSQA 5KP7B 1X3OA 2ROQA 2K94A 2KWLA 2LL8A 3LMOA 2GDYA 1ACPA 1OR5A 4R0MA 2FACA 2AFDA 3EJBA 1HY8A 1VKUA 2LMLA 3NY7B 2KORA 4NEOA 2MVVA 2CG5B 2KGDA 2X2BA 4BPHA 4HKGA 2FQ0A 5CZDB 2LPKA 2KGEA 5HVCA 4PXHB 2LOLA 2LKIA 2K0XA 4H2WC 2KGCA 2MY5A 3EJEA 2XZ0D 2LTEA 4MRTC 2CQ8A 2L22A 1HQBA 2JQ4A 2L0QA 1L0IA 4IZ6A 4PWVB 5KP8B 1KLPA 4H2XC 2GDXA 1DNYA 1F80D
chains in the Genus database with same CATH superfamily
1RO0A 1DV5A 1VQMP 4XRQA 1UJZA 5F2KA 3RG2A 1ZNVA 2PY8A 3DS4A 2EHTA 2PEIA 1K73Q 2L6EA 2K92A 1E0HA 2K5XA 3HZQA 3CCLP 3CMEP 1VQ9P 1AUMA 2M8PA 2FADA 3DS5A 2QA4P 3LRYA 5HGNA 3WBHA 3G4SP 3U43A 3CE7A 4COPA 2FVAA 1GXHA 3EJDA 4PH1A 4H2YC 1VQ4P 4GR2A 4M0IA 2FVFA 2VSQA 3H4EA 2K94A 2JBGA 2GDYA 1GXGA 1YJWP 2K0DX 3EJBA 2EFJA 2E1MA 5JPAA 3OW2O 2JYGA 2X2BA 3CCRP 2FQ0A 3G28A 5HVCA 1ZMBA 2LOLA 1Q81Q 2MY5A 1Q7YQ 1VQ8P 1YJ9P 3EJEA 3DTJA 3CCVP 4XFYA 2JAZA 1HQBA 2L0QA 4IZ6A 1M6NA 4H2XC 5F2NA 4COCA 4U0AA 3CC4P 1F80D 2KG8A 2N6YA 2N98A 5HGLA 2FQ2A 3CC2P 2EIAA 1D1DA 3GZLA 1NQ4A 2KOPA 1EMVA 2AF8A 2N5HA 4XFXA 5HV8A 2AFEA 1EOQA 3CC7P 4QNBA 5HGOA 3GKLC 3H47A 1YI2P 2MVUA 1M6EX 2PEJA 4DG9A 5KP6B 5I4TG 2JB0A 2M8NA 2FHSC 1YHQP 4BPGA 2QNWA 3Q20A 3G1IA 1QRJA 2OTJP 5EW5E 1Z6MA 2JU2A 1VQOP 4BPFA 3MGEA 2FQ1A 2K93A 3CPWO 2CWOA 3NTEA 3CCUP 1AYIA 4U0DA 3DS2A 2LL8A 2PENA 1A8OA 1RNIA 2EG5A 1ACPA 1OR5A 4R0MA 1M1KQ 3CCSP 3I55P 1HY8A 2WPTA 3CCEP 2KGDA 3CMAP 3DS0A 2M8LA 2KGCA 2NO8A 1E6JP 2LTEA 2CQ8A 5DCKA 2JQ4A 1GPJA 1IUQA 1BXIA 2BUOA 2MR7A 2MD9A 2ONTA 1AF8A 2PEKA 1N8RQ 4XROA 2MR8A 2JU1A 2PEOA 3CXCO 2PEQA 3G21A 1KQSO 2DNWA 3G6EP 1BAJA 2N6ZA 1KD1Q 2N50A 2LF4A 2KG6A 2LIUA 2GYKA 3P05A 4U0EA 2GDWA 2AVAA 1VQLP 1IMPA 2KOOA 2L9FA 4QKOA 1S72P 1M90Q 2XV6A 2MF4A 3GZMA 5BS2A 2KOQA 3CD6P 2L4BA 1RO2A 3B5IA 1EIAA 4XFZA 1Q86Q 2CGQA 2JO0A 1X3OA 2KWLA 1K8AQ 2P9XA 1MZ8A 2KODA 2Z46A 1W2BO 1VQPP 2ERHA 1VQKP 1VQ7P 4GR6A 3G29A 3DS1A 3G71P 2LMLA 2KORA 4HKGA 2LPKA 4F37A 2KGEA 4H2WC 2K0XA 2Z44A 1JJ2O 1VQ5P 1VHNA 2XZ0D 3B4QA 1M74A 2VLQA 1VQNP 2GZFA 1L0IA 1KLPA 5KP8B 2GDXA 2JYLA 2DGYA 2CNRA 1K9MQ 1KC8Q 4U0FA 2LIWA 5EJDA 3H0DA 2KG9A 2XZ1C 2XXMA 1L0HA 4PH0A 2KW2A 3G1GA 2OTLP 1UNKA 2JGPA 2KGAA 3I56P 2Z45A 1IMQA 2BHVA 3G26A 1YJNP 3CCQP 2FVEA 2EHSA 4CA3A 3E2DA 2GZEA 3DS3A 2VLNA 1YIJP 1NJIQ 1VQ6P 5F2OA 2PEMA 5HGMA 2M5RA 5BS1A 2KR5A 2N5IA 3RG6C 2PNGA 2KOSA 1K30A 2K0YA 3GJNA 3G0VA 2FAEA 2K2QA 1T8KA 4WYMA 5KP7B 1QVFO 2ROQA 2XT1A 3LMOA 2FACA 2AFDA 4U0CA 2GZJA 1VKUA 4UHPB 3NY7B 1A43A 3M1MA 2OARA 4NEOA 2MVVA 2CG5B 4BPHA 2GZGA 3DPHA 5CZDB 3CCMP 1Q82Q 4PXHB 4IPYA 1QVGO 2LKIA 2VLPA 2VLOA 1YITP 4MRTC 2L22A 1FR2A 4U0BA 3CCJP 4PWVB 7CEIA 1CEIA 1DNYA 3VRLC 2QEXP 3HYBA 2GZIA
chains in the Genus database with same CATH topology
1DV5A 2CNRA 2KG8A 2N6YA 2MR7A 2N98A 2MD9A 2FQ2A 3RG2A 2LIWA 5EJDA 1AF8A 3GZLA 2KG9A 2XZ1C 1L0HA 2KW2A 1NQ4A 2KOPA 2MR8A 2JU1A 2JGPA 2KGAA 2EHTA 2AF8A 2N5HA 5HV8A 2K92A 2AFEA 2DNWA 2N6ZA 2FVEA 2EHSA 2N50A 2LIUA 2KG6A 2MVUA 2GDWA 4DG9A 4CA3A 2AVAA 5KP6B 2FADA 2FHSC 2KOOA 4BPGA 2L9FA 2QNWA 3CE7A 2M5RA 2MF4A 3GZMA 2JU2A 2KR5A 2FVAA 3EJDA 2KOQA 4BPFA 2N5IA 2PNGA 2KOSA 2FQ1A 2K0YA 2L4BA 4H2YC 2K93A 2FAEA 2K2QA 1T8KA 2CGQA 2FVFA 2VSQA 5KP7B 1X3OA 2ROQA 2K94A 2KWLA 2LL8A 3LMOA 2GDYA 1ACPA 1OR5A 4R0MA 2FACA 2AFDA 3EJBA 1HY8A 1VKUA 2LMLA 3NY7B 2KORA 4NEOA 2MVVA 2CG5B 2KGDA 2X2BA 4BPHA 4HKGA 2FQ0A 5CZDB 2LPKA 2KGEA 5HVCA 4PXHB 2LOLA 2LKIA 2K0XA 4H2WC 2KGCA 2MY5A 3EJEA 2XZ0D 2LTEA 4MRTC 2CQ8A 2L22A 1HQBA 2JQ4A 2L0QA 1L0IA 4IZ6A 4PWVB 5KP8B 1KLPA 4H2XC 2GDXA 1DNYA 1F80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DV5 A;  2CNR A;  2KG8 A;  2N6Y A;  2MR7 A;  2N98 A;  2MD9 A;  2FQ2 A;  3RG2 A;  2LIW A;  5EJD A;  1AF8 A;  3GZL A;  2KG9 A;  2XZ1 C;  1L0H A;  2KW2 A;  1NQ4 A;  2KOP A;  2MR8 A;  2JU1 A;  2JGP A;  2KGA A;  2EHT A;  2AF8 A;  2N5H A;  5HV8 A;  2K92 A;  2AFE A;  2DNW A;  2N6Z A;  2FVE A;  2EHS A;  2N50 A;  2LIU A;  2KG6 A;  2MVU A;  2GDW A;  4DG9 A;  4CA3 A;  2AVA A;  5KP6 B;  2FAD A;  2FHS C;  2KOO A;  4BPG A;  2L9F A;  2QNW A;  3CE7 A;  2M5R A;  2MF4 A;  3GZM A;  2JU2 A;  2KR5 A;  2FVA A;  3EJD A;  2KOQ A;  4BPF A;  2N5I A;  2PNG A;  2KOS A;  2FQ1 A;  2K0Y A;  2L4B A;  4H2Y C;  2K93 A;  2FAE A;  2K2Q A;  1T8K A;  2CGQ A;  2FVF A;  2VSQ A;  5KP7 B;  1X3O A;  2ROQ A;  2K94 A;  2KWL A;  2LL8 A;  3LMO A;  2GDY A;  1ACP A;  1OR5 A;  4R0M A;  2FAC A;  2AFD A;  3EJB A;  1HY8 A;  1VKU A;  2LML A;  3NY7 B;  2KOR A;  4NEO A;  2MVV A;  2CG5 B;  2KGD A;  2X2B A;  4BPH A;  4HKG A;  2FQ0 A;  5CZD B;  2LPK A;  2KGE A;  5HVC A;  4PXH B;  2LOL A;  2LKI A;  2K0X A;  4H2W C;  2KGC A;  2MY5 A;  3EJE A;  2XZ0 D;  2LTE A;  4MRT C;  2CQ8 A;  2L22 A;  1HQB A;  2JQ4 A;  2L0Q A;  1L0I A;  4IZ6 A;  4PWV B;  5KP8 B;  1KLP A;  4H2X C;  2GDX A;  1DNY A;  1F80 D; 
#chains in the Genus database with same CATH topology
 1RO0 A;  1DV5 A;  1VQM P;  4XRQ A;  1UJZ A;  5F2K A;  3RG2 A;  1ZNV A;  2PY8 A;  3DS4 A;  2EHT A;  2PEI A;  1K73 Q;  2L6E A;  2K92 A;  1E0H A;  2K5X A;  3HZQ A;  3CCL P;  3CME P;  1VQ9 P;  1AUM A;  2M8P A;  2FAD A;  3DS5 A;  2QA4 P;  3LRY A;  5HGN A;  3WBH A;  3G4S P;  3U43 A;  3CE7 A;  4COP A;  2FVA A;  1GXH A;  3EJD A;  4PH1 A;  4H2Y C;  1VQ4 P;  4GR2 A;  4M0I A;  2FVF A;  2VSQ A;  3H4E A;  2K94 A;  2JBG A;  2GDY A;  1GXG A;  1YJW P;  2K0D X;  3EJB A;  2EFJ A;  2E1M A;  5JPA A;  3OW2 O;  2JYG A;  2X2B A;  3CCR P;  2FQ0 A;  3G28 A;  5HVC A;  1ZMB A;  2LOL A;  1Q81 Q;  2MY5 A;  1Q7Y Q;  1VQ8 P;  1YJ9 P;  3EJE A;  3DTJ A;  3CCV P;  4XFY A;  2JAZ A;  1HQB A;  2L0Q A;  4IZ6 A;  1M6N A;  4H2X C;  5F2N A;  4COC A;  4U0A A;  3CC4 P;  1F80 D;  2KG8 A;  2N6Y A;  2N98 A;  5HGL A;  2FQ2 A;  3CC2 P;  2EIA A;  1D1D A;  3GZL A;  1NQ4 A;  2KOP A;  1EMV A;  2AF8 A;  2N5H A;  4XFX A;  5HV8 A;  2AFE A;  1EOQ A;  3CC7 P;  4QNB A;  5HGO A;  3GKL C;  3H47 A;  1YI2 P;  2MVU A;  1M6E X;  2PEJ A;  4DG9 A;  5KP6 B;  5I4T G;  2JB0 A;  2M8N A;  2FHS C;  1YHQ P;  4BPG A;  2QNW A;  3Q20 A;  3G1I A;  1QRJ A;  2OTJ P;  5EW5 E;  1Z6M A;  2JU2 A;  1VQO P;  4BPF A;  3MGE A;  2FQ1 A;  2K93 A;  3CPW O;  2CWO A;  3NTE A;  3CCU P;  1AYI A;  4U0D A;  3DS2 A;  2LL8 A;  2PEN A;  1A8O A;  1RNI A;  2EG5 A;  1ACP A;  1OR5 A;  4R0M A;  1M1K Q;  3CCS P;  3I55 P;  1HY8 A;  2WPT A;  3CCE P;  2KGD A;  3CMA P;  3DS0 A;  2M8L A;  2KGC A;  2NO8 A;  1E6J P;  2LTE A;  2CQ8 A;  5DCK A;  2JQ4 A;  1GPJ A;  1IUQ A;  1BXI A;  2BUO A;  2MR7 A;  2MD9 A;  2ONT A;  1AF8 A;  2PEK A;  1N8R Q;  4XRO A;  2MR8 A;  2JU1 A;  2PEO A;  3CXC O;  2PEQ A;  3G21 A;  1KQS O;  2DNW A;  3G6E P;  1BAJ A;  2N6Z A;  1KD1 Q;  2N50 A;  2LF4 A;  2KG6 A;  2LIU A;  2GYK A;  3P05 A;  4U0E A;  2GDW A;  2AVA A;  1VQL P;  1IMP A;  2KOO A;  2L9F A;  4QKO A;  1S72 P;  1M90 Q;  2XV6 A;  2MF4 A;  3GZM A;  5BS2 A;  2KOQ A;  3CD6 P;  2L4B A;  1RO2 A;  3B5I A;  1EIA A;  4XFZ A;  1Q86 Q;  2CGQ A;  2JO0 A;  1X3O A;  2KWL A;  1K8A Q;  2P9X A;  1MZ8 A;  2KOD A;  2Z46 A;  1W2B O;  1VQP P;  2ERH A;  1VQK P;  1VQ7 P;  4GR6 A;  3G29 A;  3DS1 A;  3G71 P;  2LML A;  2KOR A;  4HKG A;  2LPK A;  4F37 A;  2KGE A;  4H2W C;  2K0X A;  2Z44 A;  1JJ2 O;  1VQ5 P;  1VHN A;  2XZ0 D;  3B4Q A;  1M74 A;  2VLQ A;  1VQN P;  2GZF A;  1L0I A;  1KLP A;  5KP8 B;  2GDX A;  2JYL A;  2DGY A;  2CNR A;  1K9M Q;  1KC8 Q;  4U0F A;  2LIW A;  5EJD A;  3H0D A;  2KG9 A;  2XZ1 C;  2XXM A;  1L0H A;  4PH0 A;  2KW2 A;  3G1G A;  2OTL P;  1UNK A;  2JGP A;  2KGA A;  3I56 P;  2Z45 A;  1IMQ A;  2BHV A;  3G26 A;  1YJN P;  3CCQ P;  2FVE A;  2EHS A;  4CA3 A;  3E2D A;  2GZE A;  3DS3 A;  2VLN A;  1YIJ P;  1NJI Q;  1VQ6 P;  5F2O A;  2PEM A;  5HGM A;  2M5R A;  5BS1 A;  2KR5 A;  2N5I A;  3RG6 C;  2PNG A;  2KOS A;  1K30 A;  2K0Y A;  3GJN A;  3G0V A;  2FAE A;  2K2Q A;  1T8K A;  4WYM A;  5KP7 B;  1QVF O;  2ROQ A;  2XT1 A;  3LMO A;  2FAC A;  2AFD A;  4U0C A;  2GZJ A;  1VKU A;  4UHP B;  3NY7 B;  1A43 A;  3M1M A;  2OAR A;  4NEO A;  2MVV A;  2CG5 B;  4BPH A;  2GZG A;  3DPH A;  5CZD B;  3CCM P;  1Q82 Q;  4PXH B;  4IPY A;  1QVG O;  2LKI A;  2VLP A;  2VLO A;  1YIT P;  4MRT C;  2L22 A;  1FR2 A;  4U0B A;  3CCJ P;  4PWV B;  7CEI A;  1CEI A;  1DNY A;  3VRL C;  2QEX P;  3HYB A;  2GZI A; 
#chains in the Genus database with same CATH homology
 1DV5 A;  2CNR A;  2KG8 A;  2N6Y A;  2MR7 A;  2N98 A;  2MD9 A;  2FQ2 A;  3RG2 A;  2LIW A;  5EJD A;  1AF8 A;  3GZL A;  2KG9 A;  2XZ1 C;  1L0H A;  2KW2 A;  1NQ4 A;  2KOP A;  2MR8 A;  2JU1 A;  2JGP A;  2KGA A;  2EHT A;  2AF8 A;  2N5H A;  5HV8 A;  2K92 A;  2AFE A;  2DNW A;  2N6Z A;  2FVE A;  2EHS A;  2N50 A;  2LIU A;  2KG6 A;  2MVU A;  2GDW A;  4DG9 A;  4CA3 A;  2AVA A;  5KP6 B;  2FAD A;  2FHS C;  2KOO A;  4BPG A;  2L9F A;  2QNW A;  3CE7 A;  2M5R A;  2MF4 A;  3GZM A;  2JU2 A;  2KR5 A;  2FVA A;  3EJD A;  2KOQ A;  4BPF A;  2N5I A;  2PNG A;  2KOS A;  2FQ1 A;  2K0Y A;  2L4B A;  4H2Y C;  2K93 A;  2FAE A;  2K2Q A;  1T8K A;  2CGQ A;  2FVF A;  2VSQ A;  5KP7 B;  1X3O A;  2ROQ A;  2K94 A;  2KWL A;  2LL8 A;  3LMO A;  2GDY A;  1ACP A;  1OR5 A;  4R0M A;  2FAC A;  2AFD A;  3EJB A;  1HY8 A;  1VKU A;  2LML A;  3NY7 B;  2KOR A;  4NEO A;  2MVV A;  2CG5 B;  2KGD A;  2X2B A;  4BPH A;  4HKG A;  2FQ0 A;  5CZD B;  2LPK A;  2KGE A;  5HVC A;  4PXH B;  2LOL A;  2LKI A;  2K0X A;  4H2W C;  2KGC A;  2MY5 A;  3EJE A;  2XZ0 D;  2LTE A;  4MRT C;  2CQ8 A;  2L22 A;  1HQB A;  2JQ4 A;  2L0Q A;  1L0I A;  4IZ6 A;  4PWV B;  5KP8 B;  1KLP A;  4H2X C;  2GDX A;  1DNY A;  1F80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...