2LKIA

Solution nmr structure of holo acyl carrier protein ne2163 from nitrosomonas europaea. northeast structural genomics consortium target net1.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
MQHLEAVRNILGDVLNLGERKHTLTASSVLLGNIPELDSMAVVNVITALEEYFDFSVDDDEISAQTFETLGSLALFVEHKLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Solution structure of acyl carrier protein from Nitrosomonas Europaea
pubmed rcsb
source organism Nitrosomonas europaea
molecule tags Lipid transport
total genus 29
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lkiA00
2K94A 4CA3A 2CNRA 5KP6B 2CQ8A 2XZ1C 2KG9A 3EJDA 5KP7B 2KW2A 2FVFA 2KGDA 1ACPA 4H2YC 2AVAA 4BPHA 2JU2A 2N6YA 2KGEA 4R0MA 2MF4A 2PNGA 1HY8A 4H2XC 4HKGA 2QNWA 3LMOA 3CE7A 2KORA 3RG2A 2K93A 2GDWA 2K0XA 5KP8B 2L22A 1F80D 2FHSC 2DNWA 2VSQA 2XZ0D 2M5RA 2AFEA 2LIUA 2X2BA 4NEOA 5EJDA 5CZDB 2KGCA 2AFDA 1L0IA 2FQ2A 2ROQA 2LL8A 5HV8A 2FVAA 2N50A 2FACA 4MRTC 3EJBA 1T8KA 4PXHB 2FADA 2CGQA 2KG6A 4BPFA 2KGAA 2MR8A 2L0QA 2GDXA 2N5HA 2LIWA 3NY7B 1OR5A 1DNYA 2MD9A 2CG5B 2K2QA 2JU1A 5HVCA 2LTEA 2FQ1A 2GDYA 4DG9A 2KOOA 2FQ0A 2L9FA 1VKUA 2FAEA 2N5IA 4PWVB 1X3OA 2N98A 4H2WC 3GZMA 2JQ4A 2JGPA 3EJEA 1HQBA 4IZ6A 4BPGA 1NQ4A 2MVUA 2KOQA 2KOSA 2L4BA 2EHTA 2LKIA 2EHSA 2FVEA 2KG8A 2K92A 1DV5A 1KLPA 1L0HA 2LPKA 1AF8A 2MR7A 2MY5A 2K0YA 2LMLA 2AF8A 3GZLA 2KOPA 2KR5A 2MVVA 2KWLA 2LOLA 2N6ZA
chains in the Genus database with same CATH superfamily
4CA3A 2XZ1C 1RO2A 4R0MA 2EIAA 1AUMA 3H47A 4HKGA 2M8LA 2DGYA 3CCVP 2GDWA 3CCEP 1EMVA 1F80D 3G71P 5HGLA 3DS4A 2GZJA 3HZQA 1M74A 1VQKP 5F2NA 1RNIA 2P9XA 3G21A 2XZ0D 1Q86Q 2XV6A 5HGNA 2M5RA 5CZDB 1BAJA 3CCSP 2LL8A 5HV8A 1GPJA 2CWOA 2PEMA 2FACA 4MRTC 2NO8A 4PXHB 4BPFA 2L0QA 4U0EA 2QEXP 1ZNVA 4QKOA 1DNYA 2CG5B 1A43A 3G1GA 5HVCA 2GDYA 3G1IA 2FQ0A 3MGEA 2L9FA 1VKUA 3CD6P 4XFXA 4COPA 1HQBA 3DS0A 3B4QA 3CCUP 2L4BA 2EHTA 1YHQP 3CCMP 3M1MA 1VQPP 1QVFO 1Q81Q 3GZLA 1BXIA 2KOPA 1IUQA 3H4EA 2KR5A 1W2BO 2VLNA 5BS2A 3G28A 1Z6MA 2CNRA 5KP6B 2K5XA 3U43A 3Q20A 2KG9A 2KODA 3G26A 2FVFA 1ACPA 1YJ9P 2JU2A 1KQSO 2PNGA 1VQOP 2XXMA 1QVGO 1HY8A 4H2XC 4GR2A 2K0XA 3VRLC 2OARA 1ZMBA 2L22A 2ERHA 1K30A 3CPWO 1YI2P 1N8RQ 2VLQA 3DS5A 1VQ8P 2PEQA 2VSQA 3NTEA 2AFEA 2LIUA 1UNKA 4NEOA 2KGCA 2AFDA 1L0IA 4U0DA 2ROQA 3DS3A 2XT1A 1K9MQ 1T8KA 2FADA 3WBHA 2KG6A 2KGAA 2K0DX 2E1MA 2OTJP 1UJZA 2VLOA 1KD1Q 4DG9A 1IMQA 2JBGA 4PWVB 4H2WC 2N98A 4BPGA 1NQ4A 2MVUA 2LF4A 3DTJA 2LKIA 3CMAP 2EHSA 3E2DA 1M6NA 4XFYA 3I56P 2K92A 2M8NA 2QA4P 2LPKA 2MR7A 3DPHA 2LMLA 3DS2A 2JO0A 2MVVA 2KWLA 2JYGA 3CC2P 1K8AQ 3CCQP 2K94A 4U0BA 3EJDA 3CCRP 5KP7B 1E6JP 2KW2A 1VQ4P 4H2YC 2AVAA 1M1KQ 2N6YA 5EW5E 4QNBA 2MF4A 3H0DA 2BUOA 4COCA 2QNWA 3CE7A 2KORA 3P05A 2PY8A 3CCLP 2K93A 2Z45A 1VHNA 2PEJA 4XFZA 1YIJP 2FHSC 2GZFA 1Q82Q 2DNWA 3RG6C 2M8PA 2X2BA 5EJDA 1VQ7P 2FVAA 5HGOA 3EJBA 1M90Q 2CGQA 2JB0A 2MR8A 2GDXA 1MZ8A 3CC4P 1VQLP 2WPTA 3G4SP 2LTEA 2FQ1A 2Z44A 2FAEA 2N5IA 3GZMA 3I55P 2JQ4A 2JGPA 4IZ6A 4UHPB 2KOQA 2KOSA 4U0AA 3GKLC 5I4TG 1YJWP 1A8OA 1KLPA 1AYIA 1L0HA 3HYBA 3DS1A 4WYMA 5HGMA 2AF8A 1VQ9P 1NJIQ 4PH1A 1VQNP 1E0HA 4F37A 4U0FA 2CQ8A 1IMPA 2KGDA 4BPHA 1K73Q 2KGEA 3CCJP 4M0IA 3G6EP 1YJNP 2EG5A 3LMOA 1VQ6P 3CXCO 3CMEP 4IPYA 3RG2A 1GXGA 2OTLP 1D1DA 5KP8B 1VQ5P 3CC7P 4U0CA 4XRQA 5DCKA 3G29A 2GYKA 2L6EA 1GXHA 3G0VA 5BS1A 5F2OA 1RO0A 5F2KA 2FQ2A 2GZIA 2N50A 1VQMP 7CEIA 2PEIA 2BHVA 3B5IA 3LRYA 2PENA 2N5HA 2GZEA 2LIWA 1S72P 3NY7B 1FR2A 1OR5A 1EIAA 3OW2O 2MD9A 1Q7YQ 2K2QA 2JU1A 2JAZA 1M6EX 1QRJA 5JPAA 2KOOA 4GR6A 1JJ2O 1X3OA 3EJEA 1YITP 2FVEA 2KG8A 2ONTA 1DV5A 2EFJA 4PH0A 1AF8A 2MY5A 2K0YA 2PEOA 2VLPA 1EOQA 1KC8Q 3GJNA 2JYLA 4XROA 2GZGA 1CEIA 2PEKA 2LOLA 2Z46A 2N6ZA
chains in the Genus database with same CATH topology
2K94A 4CA3A 2CNRA 5KP6B 2CQ8A 2XZ1C 2KG9A 3EJDA 5KP7B 2KW2A 2FVFA 2KGDA 1ACPA 4H2YC 2AVAA 4BPHA 2JU2A 2N6YA 2KGEA 4R0MA 2MF4A 2PNGA 1HY8A 4H2XC 4HKGA 2QNWA 3LMOA 3CE7A 2KORA 3RG2A 2K93A 2GDWA 2K0XA 5KP8B 2L22A 1F80D 2FHSC 2DNWA 2VSQA 2XZ0D 2M5RA 2AFEA 2LIUA 2X2BA 4NEOA 5EJDA 5CZDB 2KGCA 2AFDA 1L0IA 2FQ2A 2ROQA 2LL8A 5HV8A 2FVAA 2N50A 2FACA 4MRTC 3EJBA 1T8KA 4PXHB 2FADA 2CGQA 2KG6A 4BPFA 2KGAA 2MR8A 2L0QA 2GDXA 2N5HA 2LIWA 3NY7B 1OR5A 1DNYA 2MD9A 2CG5B 2K2QA 2JU1A 5HVCA 2LTEA 2FQ1A 2GDYA 4DG9A 2KOOA 2FQ0A 2L9FA 1VKUA 2FAEA 2N5IA 4PWVB 1X3OA 2N98A 4H2WC 3GZMA 2JQ4A 2JGPA 3EJEA 1HQBA 4IZ6A 4BPGA 1NQ4A 2MVUA 2KOQA 2KOSA 2L4BA 2EHTA 2LKIA 2EHSA 2FVEA 2KG8A 2K92A 1DV5A 1KLPA 1L0HA 2LPKA 1AF8A 2MR7A 2MY5A 2K0YA 2LMLA 2AF8A 3GZLA 2KOPA 2KR5A 2MVVA 2KWLA 2LOLA 2N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K94 A;  4CA3 A;  2CNR A;  5KP6 B;  2CQ8 A;  2XZ1 C;  2KG9 A;  3EJD A;  5KP7 B;  2KW2 A;  2FVF A;  2KGD A;  1ACP A;  4H2Y C;  2AVA A;  4BPH A;  2JU2 A;  2N6Y A;  2KGE A;  4R0M A;  2MF4 A;  2PNG A;  1HY8 A;  4H2X C;  4HKG A;  2QNW A;  3LMO A;  3CE7 A;  2KOR A;  3RG2 A;  2K93 A;  2GDW A;  2K0X A;  5KP8 B;  2L22 A;  1F80 D;  2FHS C;  2DNW A;  2VSQ A;  2XZ0 D;  2M5R A;  2AFE A;  2LIU A;  2X2B A;  4NEO A;  5EJD A;  5CZD B;  2KGC A;  2AFD A;  1L0I A;  2FQ2 A;  2ROQ A;  2LL8 A;  5HV8 A;  2FVA A;  2N50 A;  2FAC A;  4MRT C;  3EJB A;  1T8K A;  4PXH B;  2FAD A;  2CGQ A;  2KG6 A;  4BPF A;  2KGA A;  2MR8 A;  2L0Q A;  2GDX A;  2N5H A;  2LIW A;  3NY7 B;  1OR5 A;  1DNY A;  2MD9 A;  2CG5 B;  2K2Q A;  2JU1 A;  5HVC A;  2LTE A;  2FQ1 A;  2GDY A;  4DG9 A;  2KOO A;  2FQ0 A;  2L9F A;  1VKU A;  2FAE A;  2N5I A;  4PWV B;  1X3O A;  2N98 A;  4H2W C;  3GZM A;  2JQ4 A;  2JGP A;  3EJE A;  1HQB A;  4IZ6 A;  4BPG A;  1NQ4 A;  2MVU A;  2KOQ A;  2KOS A;  2L4B A;  2EHT A;  2LKI A;  2EHS A;  2FVE A;  2KG8 A;  2K92 A;  1DV5 A;  1KLP A;  1L0H A;  2LPK A;  1AF8 A;  2MR7 A;  2MY5 A;  2K0Y A;  2LML A;  2AF8 A;  3GZL A;  2KOP A;  2KR5 A;  2MVV A;  2KWL A;  2LOL A;  2N6Z A; 
#chains in the Genus database with same CATH topology
 4CA3 A;  2XZ1 C;  1RO2 A;  4R0M A;  2EIA A;  1AUM A;  3H47 A;  4HKG A;  2M8L A;  2DGY A;  3CCV P;  2GDW A;  3CCE P;  1EMV A;  1F80 D;  3G71 P;  5HGL A;  3DS4 A;  2GZJ A;  3HZQ A;  1M74 A;  1VQK P;  5F2N A;  1RNI A;  2P9X A;  3G21 A;  2XZ0 D;  1Q86 Q;  2XV6 A;  5HGN A;  2M5R A;  5CZD B;  1BAJ A;  3CCS P;  2LL8 A;  5HV8 A;  1GPJ A;  2CWO A;  2PEM A;  2FAC A;  4MRT C;  2NO8 A;  4PXH B;  4BPF A;  2L0Q A;  4U0E A;  2QEX P;  1ZNV A;  4QKO A;  1DNY A;  2CG5 B;  1A43 A;  3G1G A;  5HVC A;  2GDY A;  3G1I A;  2FQ0 A;  3MGE A;  2L9F A;  1VKU A;  3CD6 P;  4XFX A;  4COP A;  1HQB A;  3DS0 A;  3B4Q A;  3CCU P;  2L4B A;  2EHT A;  1YHQ P;  3CCM P;  3M1M A;  1VQP P;  1QVF O;  1Q81 Q;  3GZL A;  1BXI A;  2KOP A;  1IUQ A;  3H4E A;  2KR5 A;  1W2B O;  2VLN A;  5BS2 A;  3G28 A;  1Z6M A;  2CNR A;  5KP6 B;  2K5X A;  3U43 A;  3Q20 A;  2KG9 A;  2KOD A;  3G26 A;  2FVF A;  1ACP A;  1YJ9 P;  2JU2 A;  1KQS O;  2PNG A;  1VQO P;  2XXM A;  1QVG O;  1HY8 A;  4H2X C;  4GR2 A;  2K0X A;  3VRL C;  2OAR A;  1ZMB A;  2L22 A;  2ERH A;  1K30 A;  3CPW O;  1YI2 P;  1N8R Q;  2VLQ A;  3DS5 A;  1VQ8 P;  2PEQ A;  2VSQ A;  3NTE A;  2AFE A;  2LIU A;  1UNK A;  4NEO A;  2KGC A;  2AFD A;  1L0I A;  4U0D A;  2ROQ A;  3DS3 A;  2XT1 A;  1K9M Q;  1T8K A;  2FAD A;  3WBH A;  2KG6 A;  2KGA A;  2K0D X;  2E1M A;  2OTJ P;  1UJZ A;  2VLO A;  1KD1 Q;  4DG9 A;  1IMQ A;  2JBG A;  4PWV B;  4H2W C;  2N98 A;  4BPG A;  1NQ4 A;  2MVU A;  2LF4 A;  3DTJ A;  2LKI A;  3CMA P;  2EHS A;  3E2D A;  1M6N A;  4XFY A;  3I56 P;  2K92 A;  2M8N A;  2QA4 P;  2LPK A;  2MR7 A;  3DPH A;  2LML A;  3DS2 A;  2JO0 A;  2MVV A;  2KWL A;  2JYG A;  3CC2 P;  1K8A Q;  3CCQ P;  2K94 A;  4U0B A;  3EJD A;  3CCR P;  5KP7 B;  1E6J P;  2KW2 A;  1VQ4 P;  4H2Y C;  2AVA A;  1M1K Q;  2N6Y A;  5EW5 E;  4QNB A;  2MF4 A;  3H0D A;  2BUO A;  4COC A;  2QNW A;  3CE7 A;  2KOR A;  3P05 A;  2PY8 A;  3CCL P;  2K93 A;  2Z45 A;  1VHN A;  2PEJ A;  4XFZ A;  1YIJ P;  2FHS C;  2GZF A;  1Q82 Q;  2DNW A;  3RG6 C;  2M8P A;  2X2B A;  5EJD A;  1VQ7 P;  2FVA A;  5HGO A;  3EJB A;  1M90 Q;  2CGQ A;  2JB0 A;  2MR8 A;  2GDX A;  1MZ8 A;  3CC4 P;  1VQL P;  2WPT A;  3G4S P;  2LTE A;  2FQ1 A;  2Z44 A;  2FAE A;  2N5I A;  3GZM A;  3I55 P;  2JQ4 A;  2JGP A;  4IZ6 A;  4UHP B;  2KOQ A;  2KOS A;  4U0A A;  3GKL C;  5I4T G;  1YJW P;  1A8O A;  1KLP A;  1AYI A;  1L0H A;  3HYB A;  3DS1 A;  4WYM A;  5HGM A;  2AF8 A;  1VQ9 P;  1NJI Q;  4PH1 A;  1VQN P;  1E0H A;  4F37 A;  4U0F A;  2CQ8 A;  1IMP A;  2KGD A;  4BPH A;  1K73 Q;  2KGE A;  3CCJ P;  4M0I A;  3G6E P;  1YJN P;  2EG5 A;  3LMO A;  1VQ6 P;  3CXC O;  3CME P;  4IPY A;  3RG2 A;  1GXG A;  2OTL P;  1D1D A;  5KP8 B;  1VQ5 P;  3CC7 P;  4U0C A;  4XRQ A;  5DCK A;  3G29 A;  2GYK A;  2L6E A;  1GXH A;  3G0V A;  5BS1 A;  5F2O A;  1RO0 A;  5F2K A;  2FQ2 A;  2GZI A;  2N50 A;  1VQM P;  7CEI A;  2PEI A;  2BHV A;  3B5I A;  3LRY A;  2PEN A;  2N5H A;  2GZE A;  2LIW A;  1S72 P;  3NY7 B;  1FR2 A;  1OR5 A;  1EIA A;  3OW2 O;  2MD9 A;  1Q7Y Q;  2K2Q A;  2JU1 A;  2JAZ A;  1M6E X;  1QRJ A;  5JPA A;  2KOO A;  4GR6 A;  1JJ2 O;  1X3O A;  3EJE A;  1YIT P;  2FVE A;  2KG8 A;  2ONT A;  1DV5 A;  2EFJ A;  4PH0 A;  1AF8 A;  2MY5 A;  2K0Y A;  2PEO A;  2VLP A;  1EOQ A;  1KC8 Q;  3GJN A;  2JYL A;  4XRO A;  2GZG A;  1CEI A;  2PEK A;  2LOL A;  2Z46 A;  2N6Z A; 
#chains in the Genus database with same CATH homology
 2K94 A;  4CA3 A;  2CNR A;  5KP6 B;  2CQ8 A;  2XZ1 C;  2KG9 A;  3EJD A;  5KP7 B;  2KW2 A;  2FVF A;  2KGD A;  1ACP A;  4H2Y C;  2AVA A;  4BPH A;  2JU2 A;  2N6Y A;  2KGE A;  4R0M A;  2MF4 A;  2PNG A;  1HY8 A;  4H2X C;  4HKG A;  2QNW A;  3LMO A;  3CE7 A;  2KOR A;  3RG2 A;  2K93 A;  2GDW A;  2K0X A;  5KP8 B;  2L22 A;  1F80 D;  2FHS C;  2DNW A;  2VSQ A;  2XZ0 D;  2M5R A;  2AFE A;  2LIU A;  2X2B A;  4NEO A;  5EJD A;  5CZD B;  2KGC A;  2AFD A;  1L0I A;  2FQ2 A;  2ROQ A;  2LL8 A;  5HV8 A;  2FVA A;  2N50 A;  2FAC A;  4MRT C;  3EJB A;  1T8K A;  4PXH B;  2FAD A;  2CGQ A;  2KG6 A;  4BPF A;  2KGA A;  2MR8 A;  2L0Q A;  2GDX A;  2N5H A;  2LIW A;  3NY7 B;  1OR5 A;  1DNY A;  2MD9 A;  2CG5 B;  2K2Q A;  2JU1 A;  5HVC A;  2LTE A;  2FQ1 A;  2GDY A;  4DG9 A;  2KOO A;  2FQ0 A;  2L9F A;  1VKU A;  2FAE A;  2N5I A;  4PWV B;  1X3O A;  2N98 A;  4H2W C;  3GZM A;  2JQ4 A;  2JGP A;  3EJE A;  1HQB A;  4IZ6 A;  4BPG A;  1NQ4 A;  2MVU A;  2KOQ A;  2KOS A;  2L4B A;  2EHT A;  2LKI A;  2EHS A;  2FVE A;  2KG8 A;  2K92 A;  1DV5 A;  1KLP A;  1L0H A;  2LPK A;  1AF8 A;  2MR7 A;  2MY5 A;  2K0Y A;  2LML A;  2AF8 A;  3GZL A;  2KOP A;  2KR5 A;  2MVV A;  2KWL A;  2LOL A;  2N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...