4COPA

Hiv-1 capsid c-terminal domain mutant (y169s)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFSKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords CAPSID PROTEIN P24
publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 24
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4copA00
4PH0A 5JPAA 1BAJA 1QRJA 1A8OA 3G28A 3H47A 2XXMA 4IPYA 4U0EA 5I4TG 1D1DA 4XFXA 5DCKA 2LF4A 3DTJA 3NTEA 5HGOA 5HGLA 2BUOA 2JO0A 4QNBA 2L6EA 4XROA 4COCA 2EIAA 1EOQA 1EIAA 3DS1A 1AUMA 4XFYA 4U0BA 3G1IA 2M8NA 3DPHA 3MGEA 3G26A 3G29A 4M0IA 4U0CA 2JYGA 3VRLC 3LRYA 4U0FA 4U0DA 3H4EA 4WYMA 2XV6A 2XT1A 3DS5A 3DS2A 3DS4A 4U0AA 4XFZA 3DS3A 3DS0A 4XRQA 2M8LA 2M8PA 4COPA 3G1GA 4PH1A 5HGMA 5HGNA 3G21A 2JYLA 2KODA 2ONTA 1E6JP 1A43A 3P05A 3G0VA
chains in the Genus database with same CATH superfamily
5JPAA 2LKIA 2JU1A 3B5IA 1KQSO 1L0HA 2KGCA 1AUMA 2MF4A 1Q7YQ 2EFJA 2OARA 4U0FA 1X3OA 3GZLA 1HY8A 3CCUP 2L9FA 1QVFO 1D1DA 4GR6A 2K2QA 2LF4A 4QNBA 3CE7A 4COCA 2KOSA 4XFYA 2M8NA 3DPHA 1E0HA 1YJWP 4U0DA 3DS0A 4BPHA 2P9XA 5BS2A 1ACPA 5HV8A 2LTEA 1QRJA 4DG9A 5HVCA 5F2OA 2PNGA 1GXGA 1VQ7P 2VLNA 4GR2A 2MD9A 3G26A 2LIWA 4M0IA 2JBGA 1VQMP 2M8LA 1K8AQ 1M74A 5I4TG 2K94A 2FVAA 2KOPA 1UNKA 1QVGO 1DV5A 2XZ0D 3G29A 1DNYA 2AFDA 3EJEA 1YITP 1MZ8A 4WYMA 4XFZA 2KGDA 1EMVA 2E1MA 1AYIA 1M6EX 2FVEA 3CCLP 2L6EA 2GDYA 1EIAA 2PEIA 1Z6MA 2EG5A 1M6NA 2M8PA 2K5XA 2FAEA 2PEQA 3E2DA 3G28A 1Q86Q 2N5HA 5HGOA 2NO8A 1UJZA 2OTLP 3WBHA 3G1IA 1N8RQ 2CG5B 3MGEA 3CCJP 1VQ4P 3CCMP 1VKUA 2XZ1C 2GZGA 2ERHA 4H2XC 1KD1Q 2JYLA 5F2KA 1E6JP 2GZFA 4PWVB 2FACA 1YJ9P 1T8KA 2K0XA 2XXMA 3CMEP 2M5RA 2KGAA 2LOLA 2N98A 2QEXP 2VSQA 2N6ZA 2KG9A 2JYGA 2MR8A 2PEKA 3VRLC 5KP8B 3CCVP 1JJ2O 3DS4A 2GDXA 2ONTA 1VQ8P 1IUQA 2GYKA 3H47A 1Q81Q 1AF8A 2X2BA 1CEIA 2PENA 2L0QA 3CC7P 2K0DX 1IMPA 1ZNVA 3LMOA 3GKLC 2AF8A 3RG2A 2MR7A 4U0AA 2KG8A 3G4SP 5F2NA 3G0VA 1VQLP 1A8OA 3HYBA 2JO0A 3CCEP 1EOQA 2KGEA 3CXCO 3H0DA 4CA3A 4R0MA 5EW5E 5KP7B 3I56P 2KWLA 2VLPA 2GZEA 3I55P 2BHVA 1VQ9P 2JU2A 2LMLA 4PH0A 1BAJA 1Q82Q 2K0YA 2FHSC 5HGLA 1YJNP 2JAZA 2XT1A 3RG6C 4XRQA 2GZIA 2KW2A 5HGMA 3G21A 2Z46A 2PEMA 2QA4P 1L0IA 3EJBA 2CWOA 2MVUA 1RO0A 4U0EA 1S72P 3DTJA 1YIJP 3NTEA 3Q20A 1IMQA 1RO2A 2EIAA 1VQPP 3DS1A 2FQ2A 2AFEA 2FQ1A 2KOOA 2MY5A 3DS5A 3DS2A 3EJDA 3G1GA 3U43A 2KODA 4QKOA 3P05A 2FQ0A 3B4QA 4PXHB 3CPWO 2N50A 5CZDB 1K9MQ 2LIUA 1KLPA 1VQKP 2MVVA 2DGYA 2CNRA 2WPTA 1GPJA 1BXIA 3H4EA 2XV6A 1FR2A 2EHTA 2DNWA 3GJNA 1A43A 3HZQA 2OTJP 3G6EP 4H2YC 1GXHA 2KR5A 2LPKA 1VQOP 1M1KQ 3M1MA 2VLOA 3GZMA 2CQ8A 4U0CA 2PEJA 2JB0A 1YHQP 1HQBA 1RNIA 2AVAA 5HGNA 4F37A 4BPGA 1K73Q 2EHSA 1K30A 1F80D 2PEOA 3CCQP 2L4BA 4UHPB 4IZ6A 1W2BO 3CCSP 2FADA 3LRYA 2KG6A 1NQ4A 2GDWA 2L22A 5KP6B 2N5IA 3DS3A 3CD6P 4PH1A 1VQ5P 2K93A 1VHNA 1OR5A 2Z44A 7CEIA 3CCRP 2KOQA 2BUOA 1M90Q 3CC4P 4U0BA 2KORA 4H2WC 1NJIQ 3OW2O 5BS1A 2ROQA 2PY8A 5EJDA 4IPYA 1KC8Q 2JGPA 2K92A 2VLQA 4BPFA 4XFXA 2N6YA 2GZJA 5DCKA 1VQNP 1ZMBA 2FVFA 4MRTC 4XROA 2LL8A 4NEOA 3NY7B 2CGQA 2Z45A 1VQ6P 3G71P 3CC2P 2JQ4A 3CMAP 4HKGA 2QNWA 4COPA 1YI2P
chains in the Genus database with same CATH topology
1VQLP 5JPAA 2OTJP 1A8OA 3G6EP 2E1MA 3HYBA 1M6EX 1VQOP 1M1KQ 3B5IA 3M1MA 2JO0A 1KQSO 3CCLP 3CCEP 2L6EA 1EOQA 1EIAA 1AUMA 3CXCO 3H0DA 2PEIA 4U0CA 1Q7YQ 2EFJA 2PEJA 2OARA 4U0FA 2EG5A 3I56P 1YHQP 1M6NA 1RNIA 3I55P 2BHVA 2M8PA 1VQ9P 5HGNA 1K73Q 1K30A 3CCUP 2PEOA 4PH0A 1BAJA 2PEQA 1Q82Q 3E2DA 3G28A 1QVFO 3CCQP 1D1DA 4GR6A 1Q86Q 2LF4A 5HGOA 5HGLA 2OTLP 4QNBA 1YJNP 3WBHA 4COCA 4XFYA 3G1IA 2M8NA 3DPHA 3MGEA 1N8RQ 1W2BO 3CCJP 3CCSP 1VQ4P 3LRYA 4U0DA 3CCMP 1YJWP 2XT1A 3RG6C 4XRQA 3CD6P 3DS3A 3DS0A 1KD1Q 4PH1A 2P9XA 5HGMA 5BS2A 3G21A 2Z46A 2JYLA 1VQ5P 2PEMA 1E6JP 5F2KA 2QA4P 1YJ9P 1QRJA 2Z44A 2CWOA 2XXMA 1RO0A 5F2OA 4U0EA 1S72P 3CMEP 3CCRP 3DTJA 1YIJP 3NTEA 3Q20A 2BUOA 2QEXP 1VQ7P 1M90Q 1RO2A 4GR2A 2EIAA 1VQPP 3DS1A 3CC4P 4U0BA 3G26A 1NJIQ 4M0IA 2JYGA 3CCVP 2PEKA 3VRLC 3OW2O 5BS1A 3DS5A 3DS2A 3DS4A 1VQMP 1JJ2O 3G1GA 2PY8A 2KODA 2ONTA 4IPYA 2M8LA 3P05A 1VQ8P 1IUQA 1KC8Q 3CPWO 1K8AQ 3H47A 1M74A 1Q81Q 5I4TG 1K9MQ 4XFXA 5DCKA 1VQNP 1VQKP 1ZMBA 2PENA 3CC7P 1QVGO 4XROA 2DGYA 3G29A 1YITP 3H4EA 2Z45A 4WYMA 2XV6A 1VQ6P 4XFZA 4U0AA 3G71P 3CC2P 3CMAP 3G4SP 4COPA 5F2NA 1A43A 3G0VA 3HZQA 1YI2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH0 A;  5JPA A;  1BAJ A;  1QRJ A;  1A8O A;  3G28 A;  3H47 A;  2XXM A;  4IPY A;  4U0E A;  5I4T G;  1D1D A;  4XFX A;  5DCK A;  2LF4 A;  3DTJ A;  3NTE A;  5HGO A;  5HGL A;  2BUO A;  2JO0 A;  4QNB A;  2L6E A;  4XRO A;  4COC A;  2EIA A;  1EOQ A;  1EIA A;  3DS1 A;  1AUM A;  4XFY A;  4U0B A;  3G1I A;  2M8N A;  3DPH A;  3MGE A;  3G26 A;  3G29 A;  4M0I A;  4U0C A;  2JYG A;  3VRL C;  3LRY A;  4U0F A;  4U0D A;  3H4E A;  4WYM A;  2XV6 A;  2XT1 A;  3DS5 A;  3DS2 A;  3DS4 A;  4U0A A;  4XFZ A;  3DS3 A;  3DS0 A;  4XRQ A;  2M8L A;  2M8P A;  4COP A;  3G1G A;  4PH1 A;  5HGM A;  5HGN A;  3G21 A;  2JYL A;  2KOD A;  2ONT A;  1E6J P;  1A43 A;  3P05 A;  3G0V A; 
#chains in the Genus database with same CATH topology
 5JPA A;  2LKI A;  2JU1 A;  3B5I A;  1KQS O;  1L0H A;  2KGC A;  1AUM A;  2MF4 A;  1Q7Y Q;  2EFJ A;  2OAR A;  4U0F A;  1X3O A;  3GZL A;  1HY8 A;  3CCU P;  2L9F A;  1QVF O;  1D1D A;  4GR6 A;  2K2Q A;  2LF4 A;  4QNB A;  3CE7 A;  4COC A;  2KOS A;  4XFY A;  2M8N A;  3DPH A;  1E0H A;  1YJW P;  4U0D A;  3DS0 A;  4BPH A;  2P9X A;  5BS2 A;  1ACP A;  5HV8 A;  2LTE A;  1QRJ A;  4DG9 A;  5HVC A;  5F2O A;  2PNG A;  1GXG A;  1VQ7 P;  2VLN A;  4GR2 A;  2MD9 A;  3G26 A;  2LIW A;  4M0I A;  2JBG A;  1VQM P;  2M8L A;  1K8A Q;  1M74 A;  5I4T G;  2K94 A;  2FVA A;  2KOP A;  1UNK A;  1QVG O;  1DV5 A;  2XZ0 D;  3G29 A;  1DNY A;  2AFD A;  3EJE A;  1YIT P;  1MZ8 A;  4WYM A;  4XFZ A;  2KGD A;  1EMV A;  2E1M A;  1AYI A;  1M6E X;  2FVE A;  3CCL P;  2L6E A;  2GDY A;  1EIA A;  2PEI A;  1Z6M A;  2EG5 A;  1M6N A;  2M8P A;  2K5X A;  2FAE A;  2PEQ A;  3E2D A;  3G28 A;  1Q86 Q;  2N5H A;  5HGO A;  2NO8 A;  1UJZ A;  2OTL P;  3WBH A;  3G1I A;  1N8R Q;  2CG5 B;  3MGE A;  3CCJ P;  1VQ4 P;  3CCM P;  1VKU A;  2XZ1 C;  2GZG A;  2ERH A;  4H2X C;  1KD1 Q;  2JYL A;  5F2K A;  1E6J P;  2GZF A;  4PWV B;  2FAC A;  1YJ9 P;  1T8K A;  2K0X A;  2XXM A;  3CME P;  2M5R A;  2KGA A;  2LOL A;  2N98 A;  2QEX P;  2VSQ A;  2N6Z A;  2KG9 A;  2JYG A;  2MR8 A;  2PEK A;  3VRL C;  5KP8 B;  3CCV P;  1JJ2 O;  3DS4 A;  2GDX A;  2ONT A;  1VQ8 P;  1IUQ A;  2GYK A;  3H47 A;  1Q81 Q;  1AF8 A;  2X2B A;  1CEI A;  2PEN A;  2L0Q A;  3CC7 P;  2K0D X;  1IMP A;  1ZNV A;  3LMO A;  3GKL C;  2AF8 A;  3RG2 A;  2MR7 A;  4U0A A;  2KG8 A;  3G4S P;  5F2N A;  3G0V A;  1VQL P;  1A8O A;  3HYB A;  2JO0 A;  3CCE P;  1EOQ A;  2KGE A;  3CXC O;  3H0D A;  4CA3 A;  4R0M A;  5EW5 E;  5KP7 B;  3I56 P;  2KWL A;  2VLP A;  2GZE A;  3I55 P;  2BHV A;  1VQ9 P;  2JU2 A;  2LML A;  4PH0 A;  1BAJ A;  1Q82 Q;  2K0Y A;  2FHS C;  5HGL A;  1YJN P;  2JAZ A;  2XT1 A;  3RG6 C;  4XRQ A;  2GZI A;  2KW2 A;  5HGM A;  3G21 A;  2Z46 A;  2PEM A;  2QA4 P;  1L0I A;  3EJB A;  2CWO A;  2MVU A;  1RO0 A;  4U0E A;  1S72 P;  3DTJ A;  1YIJ P;  3NTE A;  3Q20 A;  1IMQ A;  1RO2 A;  2EIA A;  1VQP P;  3DS1 A;  2FQ2 A;  2AFE A;  2FQ1 A;  2KOO A;  2MY5 A;  3DS5 A;  3DS2 A;  3EJD A;  3G1G A;  3U43 A;  2KOD A;  4QKO A;  3P05 A;  2FQ0 A;  3B4Q A;  4PXH B;  3CPW O;  2N50 A;  5CZD B;  1K9M Q;  2LIU A;  1KLP A;  1VQK P;  2MVV A;  2DGY A;  2CNR A;  2WPT A;  1GPJ A;  1BXI A;  3H4E A;  2XV6 A;  1FR2 A;  2EHT A;  2DNW A;  3GJN A;  1A43 A;  3HZQ A;  2OTJ P;  3G6E P;  4H2Y C;  1GXH A;  2KR5 A;  2LPK A;  1VQO P;  1M1K Q;  3M1M A;  2VLO A;  3GZM A;  2CQ8 A;  4U0C A;  2PEJ A;  2JB0 A;  1YHQ P;  1HQB A;  1RNI A;  2AVA A;  5HGN A;  4F37 A;  4BPG A;  1K73 Q;  2EHS A;  1K30 A;  1F80 D;  2PEO A;  3CCQ P;  2L4B A;  4UHP B;  4IZ6 A;  1W2B O;  3CCS P;  2FAD A;  3LRY A;  2KG6 A;  1NQ4 A;  2GDW A;  2L22 A;  5KP6 B;  2N5I A;  3DS3 A;  3CD6 P;  4PH1 A;  1VQ5 P;  2K93 A;  1VHN A;  1OR5 A;  2Z44 A;  7CEI A;  3CCR P;  2KOQ A;  2BUO A;  1M90 Q;  3CC4 P;  4U0B A;  2KOR A;  4H2W C;  1NJI Q;  3OW2 O;  5BS1 A;  2ROQ A;  2PY8 A;  5EJD A;  4IPY A;  1KC8 Q;  2JGP A;  2K92 A;  2VLQ A;  4BPF A;  4XFX A;  2N6Y A;  2GZJ A;  5DCK A;  1VQN P;  1ZMB A;  2FVF A;  4MRT C;  4XRO A;  2LL8 A;  4NEO A;  3NY7 B;  2CGQ A;  2Z45 A;  1VQ6 P;  3G71 P;  3CC2 P;  2JQ4 A;  3CMA P;  4HKG A;  2QNW A;  4COP A;  1YI2 P; 
#chains in the Genus database with same CATH homology
 1VQL P;  5JPA A;  2OTJ P;  1A8O A;  3G6E P;  2E1M A;  3HYB A;  1M6E X;  1VQO P;  1M1K Q;  3B5I A;  3M1M A;  2JO0 A;  1KQS O;  3CCL P;  3CCE P;  2L6E A;  1EOQ A;  1EIA A;  1AUM A;  3CXC O;  3H0D A;  2PEI A;  4U0C A;  1Q7Y Q;  2EFJ A;  2PEJ A;  2OAR A;  4U0F A;  2EG5 A;  3I56 P;  1YHQ P;  1M6N A;  1RNI A;  3I55 P;  2BHV A;  2M8P A;  1VQ9 P;  5HGN A;  1K73 Q;  1K30 A;  3CCU P;  2PEO A;  4PH0 A;  1BAJ A;  2PEQ A;  1Q82 Q;  3E2D A;  3G28 A;  1QVF O;  3CCQ P;  1D1D A;  4GR6 A;  1Q86 Q;  2LF4 A;  5HGO A;  5HGL A;  2OTL P;  4QNB A;  1YJN P;  3WBH A;  4COC A;  4XFY A;  3G1I A;  2M8N A;  3DPH A;  3MGE A;  1N8R Q;  1W2B O;  3CCJ P;  3CCS P;  1VQ4 P;  3LRY A;  4U0D A;  3CCM P;  1YJW P;  2XT1 A;  3RG6 C;  4XRQ A;  3CD6 P;  3DS3 A;  3DS0 A;  1KD1 Q;  4PH1 A;  2P9X A;  5HGM A;  5BS2 A;  3G21 A;  2Z46 A;  2JYL A;  1VQ5 P;  2PEM A;  1E6J P;  5F2K A;  2QA4 P;  1YJ9 P;  1QRJ A;  2Z44 A;  2CWO A;  2XXM A;  1RO0 A;  5F2O A;  4U0E A;  1S72 P;  3CME P;  3CCR P;  3DTJ A;  1YIJ P;  3NTE A;  3Q20 A;  2BUO A;  2QEX P;  1VQ7 P;  1M90 Q;  1RO2 A;  4GR2 A;  2EIA A;  1VQP P;  3DS1 A;  3CC4 P;  4U0B A;  3G26 A;  1NJI Q;  4M0I A;  2JYG A;  3CCV P;  2PEK A;  3VRL C;  3OW2 O;  5BS1 A;  3DS5 A;  3DS2 A;  3DS4 A;  1VQM P;  1JJ2 O;  3G1G A;  2PY8 A;  2KOD A;  2ONT A;  4IPY A;  2M8L A;  3P05 A;  1VQ8 P;  1IUQ A;  1KC8 Q;  3CPW O;  1K8A Q;  3H47 A;  1M74 A;  1Q81 Q;  5I4T G;  1K9M Q;  4XFX A;  5DCK A;  1VQN P;  1VQK P;  1ZMB A;  2PEN A;  3CC7 P;  1QVG O;  4XRO A;  2DGY A;  3G29 A;  1YIT P;  3H4E A;  2Z45 A;  4WYM A;  2XV6 A;  1VQ6 P;  4XFZ A;  4U0A A;  3G71 P;  3CC2 P;  3CMA P;  3G4S P;  4COP A;  5F2N A;  1A43 A;  3G0V A;  3HZQ A;  1YI2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...