4COPA

Hiv-1 capsid c-terminal domain mutant (y169s)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
84
structure length
84
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFSKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Structural protein
molecule keywords CAPSID PROTEIN P24
total genus 24
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4copA00
4COPA 2LF4A 1D1DA 3G1IA 1QRJA 4M0IA 5JPAA 3VRLC 3G0VA 2M8PA 2XV6A 3G29A 3DS3A 1E6JP 4PH0A 2BUOA 2JO0A 3H47A 2M8LA 3DPHA 2JYLA 3G1GA 4XROA 2XXMA 3DS2A 1A8OA 3DS5A 3DS0A 4U0DA 4WYMA 3LRYA 5HGLA 5HGMA 5I4TG 2ONTA 4XRQA 2JYGA 2L6EA 2KODA 2M8NA 3P05A 4QNBA 4U0AA 4U0CA 4XFXA 3DS1A 4XFYA 5HGNA 5HGOA 1EOQA 4XFZA 3MGEA 4PH1A 3DS4A 1AUMA 1A43A 3G26A 2EIAA 4U0FA 1EIAA 3DTJA 3H4EA 4U0BA 3G21A 1BAJA 4COCA 5DCKA 3NTEA 2XT1A 4U0EA 3G28A 4IPYA
chains in the Genus database with same CATH superfamily
2L9FA 2WPTA 2FVEA 3I55P 2OTJP 2GDWA 3DS3A 2N50A 2GZEA 1CEIA 3CCEP 2DNWA 1N8RQ 1BXIA 3HYBA 4PXHB 1E0HA 1M74A 5KP7B 3NTEA 1DV5A 3E2DA 1RO2A 1VQPP 1QRJA 2LTEA 1VHNA 4PH0A 3CE7A 1KD1Q 2CNRA 1VQMP 3P05A 5F2NA 3B5IA 3CD6P 2GZFA 2LL8A 1M6NA 3EJDA 2KGDA 4U0FA 1VQNP 3GZLA 3Q20A 2M8LA 5BS1A 4BPGA 3H0DA 1VQ4P 5JPAA 3U43A 2K92A 2DGYA 3DS2A 1HQBA 2FQ1A 2MVVA 4UHPB 2LMLA 3CCJP 3EJEA 1VQ5P 3G26A 1K73Q 3H4EA 3CCUP 1ACPA 1M1KQ 2K94A 1KC8Q 4H2XC 2GZIA 7CEIA 3CCMP 2M8PA 4BPFA 3DPHA 2PEOA 1UNKA 2PEJA 1K8AQ 2K5XA 3CCQP 3MGEA 2K93A 1YJ9P 1RO0A 3CC4P 3WBHA 1EIAA 2PEIA 1VQ6P 3B4QA 1Z6MA 1YJNP 1IUQA 5F2OA 3LRYA 2PNGA 4U0CA 1VQ7P 4PWVB 1AF8A 2FHSC 4NEOA 2N98A 2QEXP 3G28A 2P9XA 1QVFO 3I56P 1E6JP 4XROA 4WYMA 2GYKA 2K0YA 2L6EA 3G6EP 2CG5B 1EOQA 2N5HA 5KP8B 2MVUA 4QKOA 1UJZA 1W2BO 3G1IA 2KG6A 2MR8A 1X3OA 2JU2A 2VSQA 3G29A 2PEKA 1MZ8A 2FADA 3DS0A 5I4TG 2ONTA 1S72P 2E1MA 2KODA 2KOQA 2PEMA 1Q81Q 4BPHA 2LKIA 4IZ6A 1KLPA 2MY5A 1YHQP 2Z46A 4U0EA 2LIUA 2EHSA 3CPWO 2CWOA 1F80D 2CGQA 4F37A 2KW2A 1QVGO 3DS5A 1YIJP 3GKLC 1EMVA 2L4BA 1GXGA 2JB0A 3CCSP 3DTJA 3G21A 5F2KA 4DG9A 3LMOA 5HVCA 4IPYA 2AFEA 2LF4A 3OW2O 3CC2P 2PENA 1YI2P 1IMQA 2KOSA 2PEQA 1ZMBA 3CCRP 2Z44A 2KG9A 2VLOA 2VLQA 4XFXA 2LPKA 2VLNA 2GDXA 4XFZA 2CQ8A 2KGAA 2EFJA 2K0DX 1NQ4A 5HGOA 3HZQA 2ROQA 4M0IA 1KQSO 2FAEA 2N5IA 5HGMA 3G71P 4XRQA 1NJIQ 3CCVP 2FQ0A 2JU1A 2K2QA 1Q82Q 2N6ZA 2FQ2A 4COPA 1VQ8P 5HV8A 2JAZA 2XV6A 2JO0A 2XXMA 3RG6C 1A8OA 2M5RA 2JYGA 4H2YC 1M90Q 2BHVA 2PY8A 2GZJA 2L0QA 2MR7A 5CZDB 3RG2A 2XT1A 2FVFA 2KG8A 2KWLA 1YJWP 1L0HA 1RNIA 2N6YA 2KOOA 3CMAP 4QNBA 2L22A 2AFDA 1IMPA 1VQOP 4MRTC 4GR2A 1ZNVA 5EW5E 2JQ4A 3CMEP 5KP6B 2LIWA 2KGEA 2KOPA 2M8NA 2JBGA 1AYIA 2ERHA 1M6EX 1AUMA 2LOLA 2KR5A 1VKUA 1BAJA 5BS2A 4COCA 1Q86Q 2FACA 3NY7B 1D1DA 3GZMA 2NO8A 3CXCO 3VRLC 3G0VA 2BUOA 3H47A 2XZ1C 2MF4A 1T8KA 4U0DA 3EJBA 2EHTA 1YITP 4U0AA 4XFYA 5HGNA 2OTLP 2GZGA 2AF8A 3DS4A 2OARA 1A43A 3CC7P 2QA4P 2KORA 2FVAA 5EJDA 1VQKP 4CA3A 2X2BA 2VLPA 4H2WC 4GR6A 2JYLA 1VQLP 3G4SP 1Q7YQ 2XZ0D 3DS1A 1GPJA 2QNWA 2AVAA 2EIAA 2MD9A 4U0BA 5DCKA 1FR2A 4PH1A 2K0XA 2JGPA 1JJ2O 4HKGA 1K30A 3G1GA 3M1MA 3GJNA 1L0IA 2GDYA 5HGLA 1K9MQ 4R0MA 1DNYA 1GXHA 3CCLP 1VQ9P 2KGCA 2EG5A 1HY8A 2Z45A 1OR5A
chains in the Genus database with same CATH topology
4GR2A 2LF4A 3OW2O 3CC2P 2PENA 3I55P 2OTJP 3CMEP 1YI2P 1YJNP 2PEQA 3DS3A 1ZMBA 1IUQA 3CCRP 2Z44A 5F2OA 3CCEP 3LRYA 2M8NA 4U0CA 1VQ7P 4XFXA 4XFZA 1N8RQ 1M6EX 1AUMA 3HYBA 2EFJA 1M74A 1BAJA 5BS2A 4COCA 1Q86Q 2QEXP 3NTEA 5HGOA 3G28A 2P9XA 1D1DA 3HZQA 3E2DA 1RO2A 3CXCO 3I56P 1QRJA 4M0IA 1VQPP 1QVFO 3VRLC 3G0VA 1E6JP 4PH0A 2BUOA 3H47A 1KQSO 1KD1Q 4XROA 1VQMP 4U0DA 4WYMA 5HGMA 3G71P 4XRQA 1YITP 2L6EA 3G6EP 3P05A 4U0AA 4XFYA 3B5IA 5F2NA 5HGNA 3CD6P 2OTLP 1EOQA 1NJIQ 1M6NA 3CCVP 3DS4A 2OARA 1A43A 4U0FA 3CC7P 2QA4P 1VQNP 3Q20A 1Q82Q 2M8LA 5BS1A 1VQKP 3H0DA 4COPA 1VQ4P 1W2BO 1VQ8P 3G1IA 5JPAA 2XV6A 3G29A 2PEKA 4GR6A 2JO0A 2JYLA 2DGYA 2XXMA 3DS2A 3RG6C 1A8OA 3DS0A 5I4TG 1VQLP 3G4SP 2ONTA 1S72P 1Q7YQ 2E1MA 2JYGA 2KODA 3DS1A 3CCJP 2PEMA 1Q81Q 1M90Q 2BHVA 2PY8A 1VQ5P 3G26A 1K73Q 2EIAA 4U0BA 3H4EA 3CCUP 1M1KQ 5DCKA 1YHQP 2Z46A 4PH1A 2XT1A 4U0EA 1KC8Q 1JJ2O 3CPWO 3CCMP 2CWOA 2M8PA 1YJWP 1K30A 3DPHA 1RNIA 3G1GA 3M1MA 1QVGO 2PEOA 3DS5A 5HGLA 1K9MQ 3CMAP 1YIJP 2PEJA 4QNBA 3CCLP 1VQ9P 1K8AQ 3CCQP 3MGEA 1YJ9P 1RO0A 2EG5A 3CC4P 3WBHA 1EIAA 2PEIA 2Z45A 3DTJA 3CCSP 3G21A 1VQ6P 1VQOP 5F2KA 4IPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COP A;  2LF4 A;  1D1D A;  3G1I A;  1QRJ A;  4M0I A;  5JPA A;  3VRL C;  3G0V A;  2M8P A;  2XV6 A;  3G29 A;  3DS3 A;  1E6J P;  4PH0 A;  2BUO A;  2JO0 A;  3H47 A;  2M8L A;  3DPH A;  2JYL A;  3G1G A;  4XRO A;  2XXM A;  3DS2 A;  1A8O A;  3DS5 A;  3DS0 A;  4U0D A;  4WYM A;  3LRY A;  5HGL A;  5HGM A;  5I4T G;  2ONT A;  4XRQ A;  2JYG A;  2L6E A;  2KOD A;  2M8N A;  3P05 A;  4QNB A;  4U0A A;  4U0C A;  4XFX A;  3DS1 A;  4XFY A;  5HGN A;  5HGO A;  1EOQ A;  4XFZ A;  3MGE A;  4PH1 A;  3DS4 A;  1AUM A;  1A43 A;  3G26 A;  2EIA A;  4U0F A;  1EIA A;  3DTJ A;  3H4E A;  4U0B A;  3G21 A;  1BAJ A;  4COC A;  5DCK A;  3NTE A;  2XT1 A;  4U0E A;  3G28 A;  4IPY A; 
#chains in the Genus database with same CATH topology
 2L9F A;  2WPT A;  2FVE A;  3I55 P;  2OTJ P;  2GDW A;  3DS3 A;  2N50 A;  2GZE A;  1CEI A;  3CCE P;  2DNW A;  1N8R Q;  1BXI A;  3HYB A;  4PXH B;  1E0H A;  1M74 A;  5KP7 B;  3NTE A;  1DV5 A;  3E2D A;  1RO2 A;  1VQP P;  1QRJ A;  2LTE A;  1VHN A;  4PH0 A;  3CE7 A;  1KD1 Q;  2CNR A;  1VQM P;  3P05 A;  5F2N A;  3B5I A;  3CD6 P;  2GZF A;  2LL8 A;  1M6N A;  3EJD A;  2KGD A;  4U0F A;  1VQN P;  3GZL A;  3Q20 A;  2M8L A;  5BS1 A;  4BPG A;  3H0D A;  1VQ4 P;  5JPA A;  3U43 A;  2K92 A;  2DGY A;  3DS2 A;  1HQB A;  2FQ1 A;  2MVV A;  4UHP B;  2LML A;  3CCJ P;  3EJE A;  1VQ5 P;  3G26 A;  1K73 Q;  3H4E A;  3CCU P;  1ACP A;  1M1K Q;  2K94 A;  1KC8 Q;  4H2X C;  2GZI A;  7CEI A;  3CCM P;  2M8P A;  4BPF A;  3DPH A;  2PEO A;  1UNK A;  2PEJ A;  1K8A Q;  2K5X A;  3CCQ P;  3MGE A;  2K93 A;  1YJ9 P;  1RO0 A;  3CC4 P;  3WBH A;  1EIA A;  2PEI A;  1VQ6 P;  3B4Q A;  1Z6M A;  1YJN P;  1IUQ A;  5F2O A;  3LRY A;  2PNG A;  4U0C A;  1VQ7 P;  4PWV B;  1AF8 A;  2FHS C;  4NEO A;  2N98 A;  2QEX P;  3G28 A;  2P9X A;  1QVF O;  3I56 P;  1E6J P;  4XRO A;  4WYM A;  2GYK A;  2K0Y A;  2L6E A;  3G6E P;  2CG5 B;  1EOQ A;  2N5H A;  5KP8 B;  2MVU A;  4QKO A;  1UJZ A;  1W2B O;  3G1I A;  2KG6 A;  2MR8 A;  1X3O A;  2JU2 A;  2VSQ A;  3G29 A;  2PEK A;  1MZ8 A;  2FAD A;  3DS0 A;  5I4T G;  2ONT A;  1S72 P;  2E1M A;  2KOD A;  2KOQ A;  2PEM A;  1Q81 Q;  4BPH A;  2LKI A;  4IZ6 A;  1KLP A;  2MY5 A;  1YHQ P;  2Z46 A;  4U0E A;  2LIU A;  2EHS A;  3CPW O;  2CWO A;  1F80 D;  2CGQ A;  4F37 A;  2KW2 A;  1QVG O;  3DS5 A;  1YIJ P;  3GKL C;  1EMV A;  2L4B A;  1GXG A;  2JB0 A;  3CCS P;  3DTJ A;  3G21 A;  5F2K A;  4DG9 A;  3LMO A;  5HVC A;  4IPY A;  2AFE A;  2LF4 A;  3OW2 O;  3CC2 P;  2PEN A;  1YI2 P;  1IMQ A;  2KOS A;  2PEQ A;  1ZMB A;  3CCR P;  2Z44 A;  2KG9 A;  2VLO A;  2VLQ A;  4XFX A;  2LPK A;  2VLN A;  2GDX A;  4XFZ A;  2CQ8 A;  2KGA A;  2EFJ A;  2K0D X;  1NQ4 A;  5HGO A;  3HZQ A;  2ROQ A;  4M0I A;  1KQS O;  2FAE A;  2N5I A;  5HGM A;  3G71 P;  4XRQ A;  1NJI Q;  3CCV P;  2FQ0 A;  2JU1 A;  2K2Q A;  1Q82 Q;  2N6Z A;  2FQ2 A;  4COP A;  1VQ8 P;  5HV8 A;  2JAZ A;  2XV6 A;  2JO0 A;  2XXM A;  3RG6 C;  1A8O A;  2M5R A;  2JYG A;  4H2Y C;  1M90 Q;  2BHV A;  2PY8 A;  2GZJ A;  2L0Q A;  2MR7 A;  5CZD B;  3RG2 A;  2XT1 A;  2FVF A;  2KG8 A;  2KWL A;  1YJW P;  1L0H A;  1RNI A;  2N6Y A;  2KOO A;  3CMA P;  4QNB A;  2L22 A;  2AFD A;  1IMP A;  1VQO P;  4MRT C;  4GR2 A;  1ZNV A;  5EW5 E;  2JQ4 A;  3CME P;  5KP6 B;  2LIW A;  2KGE A;  2KOP A;  2M8N A;  2JBG A;  1AYI A;  2ERH A;  1M6E X;  1AUM A;  2LOL A;  2KR5 A;  1VKU A;  1BAJ A;  5BS2 A;  4COC A;  1Q86 Q;  2FAC A;  3NY7 B;  1D1D A;  3GZM A;  2NO8 A;  3CXC O;  3VRL C;  3G0V A;  2BUO A;  3H47 A;  2XZ1 C;  2MF4 A;  1T8K A;  4U0D A;  3EJB A;  2EHT A;  1YIT P;  4U0A A;  4XFY A;  5HGN A;  2OTL P;  2GZG A;  2AF8 A;  3DS4 A;  2OAR A;  1A43 A;  3CC7 P;  2QA4 P;  2KOR A;  2FVA A;  5EJD A;  1VQK P;  4CA3 A;  2X2B A;  2VLP A;  4H2W C;  4GR6 A;  2JYL A;  1VQL P;  3G4S P;  1Q7Y Q;  2XZ0 D;  3DS1 A;  1GPJ A;  2QNW A;  2AVA A;  2EIA A;  2MD9 A;  4U0B A;  5DCK A;  1FR2 A;  4PH1 A;  2K0X A;  2JGP A;  1JJ2 O;  4HKG A;  1K30 A;  3G1G A;  3M1M A;  3GJN A;  1L0I A;  2GDY A;  5HGL A;  1K9M Q;  4R0M A;  1DNY A;  1GXH A;  3CCL P;  1VQ9 P;  2KGC A;  2EG5 A;  1HY8 A;  2Z45 A;  1OR5 A; 
#chains in the Genus database with same CATH homology
 4GR2 A;  2LF4 A;  3OW2 O;  3CC2 P;  2PEN A;  3I55 P;  2OTJ P;  3CME P;  1YI2 P;  1YJN P;  2PEQ A;  3DS3 A;  1ZMB A;  1IUQ A;  3CCR P;  2Z44 A;  5F2O A;  3CCE P;  3LRY A;  2M8N A;  4U0C A;  1VQ7 P;  4XFX A;  4XFZ A;  1N8R Q;  1M6E X;  1AUM A;  3HYB A;  2EFJ A;  1M74 A;  1BAJ A;  5BS2 A;  4COC A;  1Q86 Q;  2QEX P;  3NTE A;  5HGO A;  3G28 A;  2P9X A;  1D1D A;  3HZQ A;  3E2D A;  1RO2 A;  3CXC O;  3I56 P;  1QRJ A;  4M0I A;  1VQP P;  1QVF O;  3VRL C;  3G0V A;  1E6J P;  4PH0 A;  2BUO A;  3H47 A;  1KQS O;  1KD1 Q;  4XRO A;  1VQM P;  4U0D A;  4WYM A;  5HGM A;  3G71 P;  4XRQ A;  1YIT P;  2L6E A;  3G6E P;  3P05 A;  4U0A A;  4XFY A;  3B5I A;  5F2N A;  5HGN A;  3CD6 P;  2OTL P;  1EOQ A;  1NJI Q;  1M6N A;  3CCV P;  3DS4 A;  2OAR A;  1A43 A;  4U0F A;  3CC7 P;  2QA4 P;  1VQN P;  3Q20 A;  1Q82 Q;  2M8L A;  5BS1 A;  1VQK P;  3H0D A;  4COP A;  1VQ4 P;  1W2B O;  1VQ8 P;  3G1I A;  5JPA A;  2XV6 A;  3G29 A;  2PEK A;  4GR6 A;  2JO0 A;  2JYL A;  2DGY A;  2XXM A;  3DS2 A;  3RG6 C;  1A8O A;  3DS0 A;  5I4T G;  1VQL P;  3G4S P;  2ONT A;  1S72 P;  1Q7Y Q;  2E1M A;  2JYG A;  2KOD A;  3DS1 A;  3CCJ P;  2PEM A;  1Q81 Q;  1M90 Q;  2BHV A;  2PY8 A;  1VQ5 P;  3G26 A;  1K73 Q;  2EIA A;  4U0B A;  3H4E A;  3CCU P;  1M1K Q;  5DCK A;  1YHQ P;  2Z46 A;  4PH1 A;  2XT1 A;  4U0E A;  1KC8 Q;  1JJ2 O;  3CPW O;  3CCM P;  2CWO A;  2M8P A;  1YJW P;  1K30 A;  3DPH A;  1RNI A;  3G1G A;  3M1M A;  1QVG O;  2PEO A;  3DS5 A;  5HGL A;  1K9M Q;  3CMA P;  1YIJ P;  2PEJ A;  4QNB A;  3CCL P;  1VQ9 P;  1K8A Q;  3CCQ P;  3MGE A;  1YJ9 P;  1RO0 A;  2EG5 A;  3CC4 P;  3WBH A;  1EIA A;  2PEI A;  2Z45 A;  3DTJ A;  3CCS P;  3G21 A;  1VQ6 P;  1VQO P;  5F2K A;  4IPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...