2N6YA

Solution structure of holo arcp from yersiniabactin synthetase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 29
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6yA00
2K0XA 3LMOA 2LMLA 4HKGA 5KP6B 2KGDA 1KLPA 2JU2A 2VSQA 1ACPA 2KOOA 2L0QA 2CG5B 1OR5A 2KOPA 2KORA 4H2YC 5HV8A 2K94A 2N6YA 2LOLA 4BPFA 2MVUA 2FHSC 2N50A 2KGCA 2AFDA 2EHSA 5KP7B 4CA3A 2FQ0A 2LIUA 2QNWA 4H2WC 2LL8A 2N5HA 2KOSA 1NQ4A 2K92A 3GZLA 2CNRA 2MVVA 2K0YA 1HQBA 1T8KA 2XZ0D 4PWVB 2K2QA 2MR8A 2KG8A 2MD9A 2AFEA 2KG6A 2DNWA 2XZ1C 4BPHA 5CZDB 1AF8A 3RG2A 1DNYA 5EJDA 4R0MA 2JQ4A 2M5RA 2JGPA 2K93A 2KR5A 1L0IA 2L4BA 2EHTA 3NY7B 3CE7A 2KW2A 2CGQA 1F80D 2FAEA 2FACA 2FADA 2JU1A 2KGEA 2MR7A 2MF4A 2FVFA 2N6ZA 2FVAA 3GZMA 3EJBA 2LIWA 2GDYA 2LTEA 2AF8A 4MRTC 1L0HA 2GDWA 2ROQA 1X3OA 5HVCA 4NEOA 2FVEA 2FQ1A 2X2BA 3EJEA 2AVAA 2LKIA 2FQ2A 2MY5A 1HY8A 5KP8B 1DV5A 2L9FA 4DG9A 2GDXA 2PNGA 1VKUA 2LPKA 4IZ6A 2KWLA 2KG9A 2CQ8A 2L22A 2N98A 4BPGA 2KOQA 2N5IA 3EJDA 4H2XC 2KGAA 4PXHB
chains in the Genus database with same CATH superfamily
1VQLP 3LMOA 5KP6B 3B4QA 1ACPA 2KOOA 3CPWO 2CG5B 4H2YC 3DTJA 3H4EA 3I55P 3H47A 3CCJP 1KQSO 3G1IA 3U43A 4COCA 3CCVP 3RG6C 2GZFA 4CA3A 1GPJA 3P05A 4XFZA 2VLPA 3CMAP 2LL8A 2N5HA 2PEQA 1VQ7P 2K0YA 3G28A 1T8KA 1BXIA 4QNBA 4PWVB 2KG8A 3GKLC 3CC2P 2KG6A 2M8PA 1VHNA 2XZ1C 3RG2A 3NTEA 1DNYA 1YHQP 1M6NA 5DCKA 2JGPA 3G26A 1MZ8A 3NY7B 3CE7A 2CGQA 1YI2P 1Q82Q 1F80D 1K73Q 1VQOP 1Q81Q 1Q86Q 3GZMA 2LTEA 1VQNP 3WBHA 1UNKA 2JYLA 1L0HA 4COPA 2PEKA 4IPYA 2QA4P 2X2BA 2FQ2A 1DV5A 1ZMBA 2LPKA 4QKOA 1VQ6P 7CEIA 3G71P 2N98A 4BPGA 2N5IA 1M6EX 4H2XC 3DS5A 3MGEA 3H0DA 1VQ4P 1EOQA 5HGMA 2LMLA 3G0VA 2M8NA 3E2DA 2KGDA 1Q7YQ 2JU2A 1Z6MA 1GXGA 1OR5A 1RNIA 2KOPA 4PH1A 2OARA 2N6YA 5HGNA 3CCEP 4U0BA 1YJNP 4BPFA 5JPAA 4WYMA 1VQMP 1IMPA 1E0HA 2K0DX 1FR2A 5KP7B 2E1MA 3DS4A 1AUMA 2LIUA 3CCMP 2CNRA 2MR8A 1K8AQ 1QVFO 3Q20A 2DNWA 5HGLA 2JB0A 5EJDA 1K9MQ 2PEOA 4U0DA 3G6EP 1L0IA 2L4BA 5EW5E 2EHTA 2NO8A 2KW2A 1IUQA 2FACA 3DS3A 2FADA 1NJIQ 3CMEP 2KGEA 5BS2A 2MF4A 2EFJA 1YIJP 2GDYA 2ERHA 3G1GA 2GZEA 2PEIA 1X3OA 1RO0A 5I4TG 2FQ1A 3DS1A 3DS0A 4XFYA 2AVAA 2LKIA 2MY5A 2Z45A 2VLNA 3G4SP 1ZNVA 4IZ6A 3CXCO 1KC8Q 2KOQA 1QVGO 3GJNA 4XRQA 5BS1A 2KGAA 1VQ9P 1M1KQ 1D1DA 4U0CA 1KLPA 2L0QA 5HV8A 3G21A 3CCQP 2Z44A 2FHSC 2GYKA 4U0FA 3CC7P 2ONTA 3DPHA 2KODA 2FQ0A 3LRYA 2OTJP 1QRJA 1UJZA 2KOSA 2Z46A 4UHPB 3M1MA 2K5XA 2AFEA 2GZGA 2L6EA 1YITP 5HGOA 2M5RA 2JBGA 1CEIA 2JU1A 1S72P 4U0EA 2N6ZA 3OW2O 2FVAA 1KD1Q 3CCRP 1AYIA 2EIAA 3CC4P 1IMQA 2PY8A 2WPTA 5HVCA 4NEOA 1VQ8P 2FVEA 2PEMA 3G29A 1HY8A 5KP8B 2GDXA 1VKUA 2KWLA 2L22A 4XFXA 4PXHB 2K0XA 2M8LA 5F2KA 3CCSP 1M74A 4HKGA 2VSQA 4U0AA 2BHVA 2KORA 2K94A 2LOLA 2XT1A 1RO2A 1BAJA 2QEXP 2MVUA 1W2BO 2N50A 2JAZA 2KGCA 2AFDA 2EHSA 2PENA 2GZJA 2QNWA 3CD6P 4H2WC 3VRLC 1NQ4A 2K92A 3GZLA 2GZIA 2MVVA 4GR2A 1HQBA 2XV6A 5F2NA 2XZ0D 3CCLP 2LF4A 2K2QA 2MD9A 4BPHA 2XXMA 5CZDB 1AF8A 4R0MA 2OTLP 2PEJA 2JQ4A 5F2OA 2K93A 4XROA 4F37A 2KR5A 1YJWP 1K30A 2JO0A 1A8OA 1YJ9P 2FAEA 4PH0A 2P9XA 2VLQA 2MR7A 1VQPP 2FVFA 1A43A 3EJBA 2LIWA 1EIAA 1VQ5P 2AF8A 1E6JP 4MRTC 1JJ2O 2GDWA 2ROQA 3I56P 3CCUP 1VQKP 3EJEA 4M0IA 3B5IA 1GXHA 3HYBA 2L9FA 4DG9A 2PNGA 3DS2A 2CWOA 2BUOA 2VLOA 2KG9A 4GR6A 1N8RQ 2CQ8A 1M90Q 2EG5A 2JYGA 3EJDA 2DGYA 1EMVA 3HZQA
chains in the Genus database with same CATH topology
2K0XA 3LMOA 2LMLA 4HKGA 5KP6B 2KGDA 1KLPA 2JU2A 2VSQA 1ACPA 2KOOA 2L0QA 2CG5B 1OR5A 2KOPA 2KORA 4H2YC 5HV8A 2K94A 2N6YA 2LOLA 4BPFA 2MVUA 2FHSC 2N50A 2KGCA 2AFDA 2EHSA 5KP7B 4CA3A 2FQ0A 2LIUA 2QNWA 4H2WC 2LL8A 2N5HA 2KOSA 1NQ4A 2K92A 3GZLA 2CNRA 2MVVA 2K0YA 1HQBA 1T8KA 2XZ0D 4PWVB 2K2QA 2MR8A 2KG8A 2MD9A 2AFEA 2KG6A 2DNWA 2XZ1C 4BPHA 5CZDB 1AF8A 3RG2A 1DNYA 5EJDA 4R0MA 2JQ4A 2M5RA 2JGPA 2K93A 2KR5A 1L0IA 2L4BA 2EHTA 3NY7B 3CE7A 2KW2A 2CGQA 1F80D 2FAEA 2FACA 2FADA 2JU1A 2KGEA 2MR7A 2MF4A 2FVFA 2N6ZA 2FVAA 3GZMA 3EJBA 2LIWA 2GDYA 2LTEA 2AF8A 4MRTC 1L0HA 2GDWA 2ROQA 1X3OA 5HVCA 4NEOA 2FVEA 2FQ1A 2X2BA 3EJEA 2AVAA 2LKIA 2FQ2A 2MY5A 1HY8A 5KP8B 1DV5A 2L9FA 4DG9A 2GDXA 2PNGA 1VKUA 2LPKA 4IZ6A 2KWLA 2KG9A 2CQ8A 2L22A 2N98A 4BPGA 2KOQA 2N5IA 3EJDA 4H2XC 2KGAA 4PXHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0X A;  3LMO A;  2LML A;  4HKG A;  5KP6 B;  2KGD A;  1KLP A;  2JU2 A;  2VSQ A;  1ACP A;  2KOO A;  2L0Q A;  2CG5 B;  1OR5 A;  2KOP A;  2KOR A;  4H2Y C;  5HV8 A;  2K94 A;  2N6Y A;  2LOL A;  4BPF A;  2MVU A;  2FHS C;  2N50 A;  2KGC A;  2AFD A;  2EHS A;  5KP7 B;  4CA3 A;  2FQ0 A;  2LIU A;  2QNW A;  4H2W C;  2LL8 A;  2N5H A;  2KOS A;  1NQ4 A;  2K92 A;  3GZL A;  2CNR A;  2MVV A;  2K0Y A;  1HQB A;  1T8K A;  2XZ0 D;  4PWV B;  2K2Q A;  2MR8 A;  2KG8 A;  2MD9 A;  2AFE A;  2KG6 A;  2DNW A;  2XZ1 C;  4BPH A;  5CZD B;  1AF8 A;  3RG2 A;  1DNY A;  5EJD A;  4R0M A;  2JQ4 A;  2M5R A;  2JGP A;  2K93 A;  2KR5 A;  1L0I A;  2L4B A;  2EHT A;  3NY7 B;  3CE7 A;  2KW2 A;  2CGQ A;  1F80 D;  2FAE A;  2FAC A;  2FAD A;  2JU1 A;  2KGE A;  2MR7 A;  2MF4 A;  2FVF A;  2N6Z A;  2FVA A;  3GZM A;  3EJB A;  2LIW A;  2GDY A;  2LTE A;  2AF8 A;  4MRT C;  1L0H A;  2GDW A;  2ROQ A;  1X3O A;  5HVC A;  4NEO A;  2FVE A;  2FQ1 A;  2X2B A;  3EJE A;  2AVA A;  2LKI A;  2FQ2 A;  2MY5 A;  1HY8 A;  5KP8 B;  1DV5 A;  2L9F A;  4DG9 A;  2GDX A;  2PNG A;  1VKU A;  2LPK A;  4IZ6 A;  2KWL A;  2KG9 A;  2CQ8 A;  2L22 A;  2N98 A;  4BPG A;  2KOQ A;  2N5I A;  3EJD A;  4H2X C;  2KGA A;  4PXH B; 
#chains in the Genus database with same CATH topology
 1VQL P;  3LMO A;  5KP6 B;  3B4Q A;  1ACP A;  2KOO A;  3CPW O;  2CG5 B;  4H2Y C;  3DTJ A;  3H4E A;  3I55 P;  3H47 A;  3CCJ P;  1KQS O;  3G1I A;  3U43 A;  4COC A;  3CCV P;  3RG6 C;  2GZF A;  4CA3 A;  1GPJ A;  3P05 A;  4XFZ A;  2VLP A;  3CMA P;  2LL8 A;  2N5H A;  2PEQ A;  1VQ7 P;  2K0Y A;  3G28 A;  1T8K A;  1BXI A;  4QNB A;  4PWV B;  2KG8 A;  3GKL C;  3CC2 P;  2KG6 A;  2M8P A;  1VHN A;  2XZ1 C;  3RG2 A;  3NTE A;  1DNY A;  1YHQ P;  1M6N A;  5DCK A;  2JGP A;  3G26 A;  1MZ8 A;  3NY7 B;  3CE7 A;  2CGQ A;  1YI2 P;  1Q82 Q;  1F80 D;  1K73 Q;  1VQO P;  1Q81 Q;  1Q86 Q;  3GZM A;  2LTE A;  1VQN P;  3WBH A;  1UNK A;  2JYL A;  1L0H A;  4COP A;  2PEK A;  4IPY A;  2QA4 P;  2X2B A;  2FQ2 A;  1DV5 A;  1ZMB A;  2LPK A;  4QKO A;  1VQ6 P;  7CEI A;  3G71 P;  2N98 A;  4BPG A;  2N5I A;  1M6E X;  4H2X C;  3DS5 A;  3MGE A;  3H0D A;  1VQ4 P;  1EOQ A;  5HGM A;  2LML A;  3G0V A;  2M8N A;  3E2D A;  2KGD A;  1Q7Y Q;  2JU2 A;  1Z6M A;  1GXG A;  1OR5 A;  1RNI A;  2KOP A;  4PH1 A;  2OAR A;  2N6Y A;  5HGN A;  3CCE P;  4U0B A;  1YJN P;  4BPF A;  5JPA A;  4WYM A;  1VQM P;  1IMP A;  1E0H A;  2K0D X;  1FR2 A;  5KP7 B;  2E1M A;  3DS4 A;  1AUM A;  2LIU A;  3CCM P;  2CNR A;  2MR8 A;  1K8A Q;  1QVF O;  3Q20 A;  2DNW A;  5HGL A;  2JB0 A;  5EJD A;  1K9M Q;  2PEO A;  4U0D A;  3G6E P;  1L0I A;  2L4B A;  5EW5 E;  2EHT A;  2NO8 A;  2KW2 A;  1IUQ A;  2FAC A;  3DS3 A;  2FAD A;  1NJI Q;  3CME P;  2KGE A;  5BS2 A;  2MF4 A;  2EFJ A;  1YIJ P;  2GDY A;  2ERH A;  3G1G A;  2GZE A;  2PEI A;  1X3O A;  1RO0 A;  5I4T G;  2FQ1 A;  3DS1 A;  3DS0 A;  4XFY A;  2AVA A;  2LKI A;  2MY5 A;  2Z45 A;  2VLN A;  3G4S P;  1ZNV A;  4IZ6 A;  3CXC O;  1KC8 Q;  2KOQ A;  1QVG O;  3GJN A;  4XRQ A;  5BS1 A;  2KGA A;  1VQ9 P;  1M1K Q;  1D1D A;  4U0C A;  1KLP A;  2L0Q A;  5HV8 A;  3G21 A;  3CCQ P;  2Z44 A;  2FHS C;  2GYK A;  4U0F A;  3CC7 P;  2ONT A;  3DPH A;  2KOD A;  2FQ0 A;  3LRY A;  2OTJ P;  1QRJ A;  1UJZ A;  2KOS A;  2Z46 A;  4UHP B;  3M1M A;  2K5X A;  2AFE A;  2GZG A;  2L6E A;  1YIT P;  5HGO A;  2M5R A;  2JBG A;  1CEI A;  2JU1 A;  1S72 P;  4U0E A;  2N6Z A;  3OW2 O;  2FVA A;  1KD1 Q;  3CCR P;  1AYI A;  2EIA A;  3CC4 P;  1IMQ A;  2PY8 A;  2WPT A;  5HVC A;  4NEO A;  1VQ8 P;  2FVE A;  2PEM A;  3G29 A;  1HY8 A;  5KP8 B;  2GDX A;  1VKU A;  2KWL A;  2L22 A;  4XFX A;  4PXH B;  2K0X A;  2M8L A;  5F2K A;  3CCS P;  1M74 A;  4HKG A;  2VSQ A;  4U0A A;  2BHV A;  2KOR A;  2K94 A;  2LOL A;  2XT1 A;  1RO2 A;  1BAJ A;  2QEX P;  2MVU A;  1W2B O;  2N50 A;  2JAZ A;  2KGC A;  2AFD A;  2EHS A;  2PEN A;  2GZJ A;  2QNW A;  3CD6 P;  4H2W C;  3VRL C;  1NQ4 A;  2K92 A;  3GZL A;  2GZI A;  2MVV A;  4GR2 A;  1HQB A;  2XV6 A;  5F2N A;  2XZ0 D;  3CCL P;  2LF4 A;  2K2Q A;  2MD9 A;  4BPH A;  2XXM A;  5CZD B;  1AF8 A;  4R0M A;  2OTL P;  2PEJ A;  2JQ4 A;  5F2O A;  2K93 A;  4XRO A;  4F37 A;  2KR5 A;  1YJW P;  1K30 A;  2JO0 A;  1A8O A;  1YJ9 P;  2FAE A;  4PH0 A;  2P9X A;  2VLQ A;  2MR7 A;  1VQP P;  2FVF A;  1A43 A;  3EJB A;  2LIW A;  1EIA A;  1VQ5 P;  2AF8 A;  1E6J P;  4MRT C;  1JJ2 O;  2GDW A;  2ROQ A;  3I56 P;  3CCU P;  1VQK P;  3EJE A;  4M0I A;  3B5I A;  1GXH A;  3HYB A;  2L9F A;  4DG9 A;  2PNG A;  3DS2 A;  2CWO A;  2BUO A;  2VLO A;  2KG9 A;  4GR6 A;  1N8R Q;  2CQ8 A;  1M90 Q;  2EG5 A;  2JYG A;  3EJD A;  2DGY A;  1EMV A;  3HZQ A; 
#chains in the Genus database with same CATH homology
 2K0X A;  3LMO A;  2LML A;  4HKG A;  5KP6 B;  2KGD A;  1KLP A;  2JU2 A;  2VSQ A;  1ACP A;  2KOO A;  2L0Q A;  2CG5 B;  1OR5 A;  2KOP A;  2KOR A;  4H2Y C;  5HV8 A;  2K94 A;  2N6Y A;  2LOL A;  4BPF A;  2MVU A;  2FHS C;  2N50 A;  2KGC A;  2AFD A;  2EHS A;  5KP7 B;  4CA3 A;  2FQ0 A;  2LIU A;  2QNW A;  4H2W C;  2LL8 A;  2N5H A;  2KOS A;  1NQ4 A;  2K92 A;  3GZL A;  2CNR A;  2MVV A;  2K0Y A;  1HQB A;  1T8K A;  2XZ0 D;  4PWV B;  2K2Q A;  2MR8 A;  2KG8 A;  2MD9 A;  2AFE A;  2KG6 A;  2DNW A;  2XZ1 C;  4BPH A;  5CZD B;  1AF8 A;  3RG2 A;  1DNY A;  5EJD A;  4R0M A;  2JQ4 A;  2M5R A;  2JGP A;  2K93 A;  2KR5 A;  1L0I A;  2L4B A;  2EHT A;  3NY7 B;  3CE7 A;  2KW2 A;  2CGQ A;  1F80 D;  2FAE A;  2FAC A;  2FAD A;  2JU1 A;  2KGE A;  2MR7 A;  2MF4 A;  2FVF A;  2N6Z A;  2FVA A;  3GZM A;  3EJB A;  2LIW A;  2GDY A;  2LTE A;  2AF8 A;  4MRT C;  1L0H A;  2GDW A;  2ROQ A;  1X3O A;  5HVC A;  4NEO A;  2FVE A;  2FQ1 A;  2X2B A;  3EJE A;  2AVA A;  2LKI A;  2FQ2 A;  2MY5 A;  1HY8 A;  5KP8 B;  1DV5 A;  2L9F A;  4DG9 A;  2GDX A;  2PNG A;  1VKU A;  2LPK A;  4IZ6 A;  2KWL A;  2KG9 A;  2CQ8 A;  2L22 A;  2N98 A;  4BPG A;  2KOQ A;  2N5I A;  3EJD A;  4H2X C;  2KGA A;  4PXH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...