2N6YA

Solution structure of holo arcp from yersiniabactin synthetase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
molecule keywords HMWP2 nonribosomal peptide synthetase
total genus 29
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6yA00
2KG6A 2VSQA 2KW2A 2GDWA 4PWVB 2N6ZA 2MR7A 4PXHB 1VKUA 2AF8A 2MR8A 2N5IA 2LOLA 1T8KA 3GZMA 2KG9A 2LMLA 2FVEA 2QNWA 2K94A 2AFEA 2N5HA 2N50A 1AF8A 1X3OA 2L0QA 3LMOA 2XZ0D 2GDXA 2LPKA 2PNGA 2CG5B 3CE7A 2AVAA 2FVAA 2N98A 1NQ4A 2KGAA 2KGDA 2X2BA 1ACPA 2CNRA 2L22A 2L4BA 2LIUA 2KORA 3RG2A 5KP8B 2LIWA 2K0XA 2GDYA 5KP7B 1L0HA 2CGQA 5EJDA 2FHSC 2N6YA 2KWLA 4R0MA 2JQ4A 2LKIA 2KOPA 2MVVA 4BPHA 2KR5A 5HVCA 2M5RA 2JU2A 2K2QA 1KLPA 4NEOA 2L9FA 2CQ8A 4H2YC 2MF4A 1L0IA 4H2WC 4BPGA 3EJEA 2EHTA 2MY5A 2FQ0A 1OR5A 2K92A 2FQ1A 2LL8A 2FADA 2FAEA 2LTEA 2ROQA 2KG8A 5CZDB 4HKGA 4MRTC 4BPFA 2KOSA 4DG9A 3EJDA 3GZLA 1DNYA 5HV8A 2K93A 1DV5A 2KOOA 2KGEA 2EHSA 2JGPA 3NY7B 1HQBA 2JU1A 1HY8A 2KOQA 4CA3A 2FQ2A 4H2XC 1F80D 2KGCA 2K0YA 2FVFA 3EJBA 2MVUA 2XZ1C 5KP6B 4IZ6A 2AFDA 2DNWA 2FACA 2MD9A
chains in the Genus database with same CATH superfamily
2KW2A 3CCRP 2GDWA 2XXMA 1ZMBA 2N6ZA 2MR7A 1M6EX 2AF8A 1Q7YQ 1K30A 3DS0A 2AFEA 5F2NA 3G1IA 1X3OA 2CWOA 1IMQA 2OTLP 3CE7A 1VQ5P 3G26A 4U0AA 1NQ4A 2KGDA 2EIAA 2CNRA 3CCSP 3G29A 4U0FA 1IMPA 2CGQA 5EJDA 2ERHA 1IUQA 2KOPA 4BPHA 3G28A 1Q82Q 1BAJA 1Z6MA 1YJWP 3CXCO 3VRLC 2BUOA 4U0EA 4IPYA 1M1KQ 1S72P 5F2KA 2VLQA 4BPGA 3WBHA 2K92A 2FQ1A 2FADA 5BS2A 1VQMP 5HGNA 1RO0A 3EJDA 5HV8A 2QA4P 2P9XA 2GZIA 2KGEA 4GR6A 2K0DX 2PENA 2KODA 1VQLP 2KOQA 1KC8Q 2KGCA 1UNKA 3EJBA 3CCEP 1VQOP 2XZ1C 1VQKP 2VSQA 4PXHB 2MR8A 3NTEA 1VHNA 2KG9A 2L6EA 3CC7P 2QNWA 2K94A 2OARA 3DTJA 2L0QA 3LMOA 2XZ0D 2GDXA 1AYIA 2PNGA 2FVAA 2N98A 2M8LA 1YITP 3Q20A 4PH0A 5F2OA 1YHQP 2L4BA 1VQ6P 2KORA 3RG2A 1K8AQ 2GYKA 2GDYA 2JYGA 1N8RQ 3HYBA 2N6YA 2M8PA 2ONTA 4XFYA 1K9MQ 2LKIA 2MVVA 2E1MA 3I55P 1CEIA 2VLPA 3U43A 1M74A 3H47A 2JU2A 2K2QA 3G6EP 4NEOA 2L9FA 2CQ8A 4COCA 3G1GA 2MF4A 3DS4A 4H2WC 1M6NA 3EJEA 5DCKA 7CEIA 3CCJP 1QVFO 2LL8A 4U0CA 5I4TG 2FAEA 2ROQA 1A8OA 3CCLP 4HKGA 5BS1A 2KOSA 3GZLA 3B4QA 1FR2A 1DV5A 3CCQP 4XFZA 2EFJA 4WYMA 2EHSA 3LRYA 2GZJA 2JU1A 2FQ2A 1A43A 3DS1A 5JPAA 3HZQA 3MGEA 2MVUA 3GKLC 1KQSO 3CMEP 2JBGA 2GZFA 2JAZA 2BHVA 2JB0A 3G21A 1VKUA 3DPHA 3CD6P 1GXGA 1UJZA 1QRJA 2LOLA 1T8KA 1MZ8A 2PEIA 2PEQA 3GZMA 5HGMA 3I56P 1NJIQ 1D1DA 2N5HA 1VQ4P 5HGLA 1AF8A 2Z46A 3E2DA 2LPKA 2CG5B 3G71P 4QNBA 2KGAA 1Q86Q 1ACPA 1AUMA 2XT1A 2JO0A 1EMVA 2L22A 4XRQA 2LIUA 5KP8B 1RO2A 2K0XA 5HGOA 1EIAA 1L0HA 2FHSC 2XV6A 2JQ4A 3DS2A 2KR5A 4QKOA 5HVCA 3GJNA 1W2BO 2M8NA 1GXHA 1M90Q 1L0IA 4XROA 2PY8A 2EHTA 2VLOA 3CCUP 1OR5A 5EW5E 2JYLA 3CC2P 1E6JP 2KG8A 5CZDB 3CCVP 4DG9A 3RG6C 2OTJP 1KD1Q 3G0VA 1VQ8P 1Q81Q 1K73Q 2JGPA 4CA3A 4H2XC 3H0DA 2EG5A 2FVFA 2GZGA 2WPTA 1QVGO 2FACA 2KG6A 4PWVB 4UHPB 1VQPP 2N5IA 3CCMP 1RNIA 2LMLA 2FVEA 4F37A 2N50A 1YIJP 1VQ7P 4U0DA 3G4SP 4XFXA 1VQNP 2AVAA 2X2BA 2PEJA 2PEKA 2LF4A 2NO8A 4M0IA 2VLNA 2LIWA 3M1MA 5KP7B 1YI2P 3CMAP 3DS3A 2DGYA 2QEXP 2KWLA 4R0MA 4GR2A 4U0BA 1EOQA 2GZEA 3B5IA 2M5RA 1KLPA 4PH1A 2K5XA 4COPA 1E0HA 3P05A 4H2YC 2PEOA 3CC4P 2MY5A 2Z45A 3OW2O 2FQ0A 1YJ9P 3H4EA 1VQ9P 1JJ2O 2LTEA 1GPJA 4MRTC 4BPFA 2PEMA 1DNYA 2K93A 1BXIA 1ZNVA 2KOOA 3NY7B 1YJNP 1HQBA 1HY8A 3DS5A 3CPWO 1F80D 2K0YA 2Z44A 5KP6B 4IZ6A 2AFDA 2DNWA 2MD9A
chains in the Genus database with same CATH topology
2KG6A 2VSQA 2KW2A 2GDWA 4PWVB 2N6ZA 2MR7A 4PXHB 1VKUA 2AF8A 2MR8A 2N5IA 2LOLA 1T8KA 3GZMA 2KG9A 2LMLA 2FVEA 2QNWA 2K94A 2AFEA 2N5HA 2N50A 1AF8A 1X3OA 2L0QA 3LMOA 2XZ0D 2GDXA 2LPKA 2PNGA 2CG5B 3CE7A 2AVAA 2FVAA 2N98A 1NQ4A 2KGAA 2KGDA 2X2BA 1ACPA 2CNRA 2L22A 2L4BA 2LIUA 2KORA 3RG2A 5KP8B 2LIWA 2K0XA 2GDYA 5KP7B 1L0HA 2CGQA 5EJDA 2FHSC 2N6YA 2KWLA 4R0MA 2JQ4A 2LKIA 2KOPA 2MVVA 4BPHA 2KR5A 5HVCA 2M5RA 2JU2A 2K2QA 1KLPA 4NEOA 2L9FA 2CQ8A 4H2YC 2MF4A 1L0IA 4H2WC 4BPGA 3EJEA 2EHTA 2MY5A 2FQ0A 1OR5A 2K92A 2FQ1A 2LL8A 2FADA 2FAEA 2LTEA 2ROQA 2KG8A 5CZDB 4HKGA 4MRTC 4BPFA 2KOSA 4DG9A 3EJDA 3GZLA 1DNYA 5HV8A 2K93A 1DV5A 2KOOA 2KGEA 2EHSA 2JGPA 3NY7B 1HQBA 2JU1A 1HY8A 2KOQA 4CA3A 2FQ2A 4H2XC 1F80D 2KGCA 2K0YA 2FVFA 3EJBA 2MVUA 2XZ1C 5KP6B 4IZ6A 2AFDA 2DNWA 2FACA 2MD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  2VSQ A;  2KW2 A;  2GDW A;  4PWV B;  2N6Z A;  2MR7 A;  4PXH B;  1VKU A;  2AF8 A;  2MR8 A;  2N5I A;  2LOL A;  1T8K A;  3GZM A;  2KG9 A;  2LML A;  2FVE A;  2QNW A;  2K94 A;  2AFE A;  2N5H A;  2N50 A;  1AF8 A;  1X3O A;  2L0Q A;  3LMO A;  2XZ0 D;  2GDX A;  2LPK A;  2PNG A;  2CG5 B;  3CE7 A;  2AVA A;  2FVA A;  2N98 A;  1NQ4 A;  2KGA A;  2KGD A;  2X2B A;  1ACP A;  2CNR A;  2L22 A;  2L4B A;  2LIU A;  2KOR A;  3RG2 A;  5KP8 B;  2LIW A;  2K0X A;  2GDY A;  5KP7 B;  1L0H A;  2CGQ A;  5EJD A;  2FHS C;  2N6Y A;  2KWL A;  4R0M A;  2JQ4 A;  2LKI A;  2KOP A;  2MVV A;  4BPH A;  2KR5 A;  5HVC A;  2M5R A;  2JU2 A;  2K2Q A;  1KLP A;  4NEO A;  2L9F A;  2CQ8 A;  4H2Y C;  2MF4 A;  1L0I A;  4H2W C;  4BPG A;  3EJE A;  2EHT A;  2MY5 A;  2FQ0 A;  1OR5 A;  2K92 A;  2FQ1 A;  2LL8 A;  2FAD A;  2FAE A;  2LTE A;  2ROQ A;  2KG8 A;  5CZD B;  4HKG A;  4MRT C;  4BPF A;  2KOS A;  4DG9 A;  3EJD A;  3GZL A;  1DNY A;  5HV8 A;  2K93 A;  1DV5 A;  2KOO A;  2KGE A;  2EHS A;  2JGP A;  3NY7 B;  1HQB A;  2JU1 A;  1HY8 A;  2KOQ A;  4CA3 A;  2FQ2 A;  4H2X C;  1F80 D;  2KGC A;  2K0Y A;  2FVF A;  3EJB A;  2MVU A;  2XZ1 C;  5KP6 B;  4IZ6 A;  2AFD A;  2DNW A;  2FAC A;  2MD9 A; 
#chains in the Genus database with same CATH topology
 2KW2 A;  3CCR P;  2GDW A;  2XXM A;  1ZMB A;  2N6Z A;  2MR7 A;  1M6E X;  2AF8 A;  1Q7Y Q;  1K30 A;  3DS0 A;  2AFE A;  5F2N A;  3G1I A;  1X3O A;  2CWO A;  1IMQ A;  2OTL P;  3CE7 A;  1VQ5 P;  3G26 A;  4U0A A;  1NQ4 A;  2KGD A;  2EIA A;  2CNR A;  3CCS P;  3G29 A;  4U0F A;  1IMP A;  2CGQ A;  5EJD A;  2ERH A;  1IUQ A;  2KOP A;  4BPH A;  3G28 A;  1Q82 Q;  1BAJ A;  1Z6M A;  1YJW P;  3CXC O;  3VRL C;  2BUO A;  4U0E A;  4IPY A;  1M1K Q;  1S72 P;  5F2K A;  2VLQ A;  4BPG A;  3WBH A;  2K92 A;  2FQ1 A;  2FAD A;  5BS2 A;  1VQM P;  5HGN A;  1RO0 A;  3EJD A;  5HV8 A;  2QA4 P;  2P9X A;  2GZI A;  2KGE A;  4GR6 A;  2K0D X;  2PEN A;  2KOD A;  1VQL P;  2KOQ A;  1KC8 Q;  2KGC A;  1UNK A;  3EJB A;  3CCE P;  1VQO P;  2XZ1 C;  1VQK P;  2VSQ A;  4PXH B;  2MR8 A;  3NTE A;  1VHN A;  2KG9 A;  2L6E A;  3CC7 P;  2QNW A;  2K94 A;  2OAR A;  3DTJ A;  2L0Q A;  3LMO A;  2XZ0 D;  2GDX A;  1AYI A;  2PNG A;  2FVA A;  2N98 A;  2M8L A;  1YIT P;  3Q20 A;  4PH0 A;  5F2O A;  1YHQ P;  2L4B A;  1VQ6 P;  2KOR A;  3RG2 A;  1K8A Q;  2GYK A;  2GDY A;  2JYG A;  1N8R Q;  3HYB A;  2N6Y A;  2M8P A;  2ONT A;  4XFY A;  1K9M Q;  2LKI A;  2MVV A;  2E1M A;  3I55 P;  1CEI A;  2VLP A;  3U43 A;  1M74 A;  3H47 A;  2JU2 A;  2K2Q A;  3G6E P;  4NEO A;  2L9F A;  2CQ8 A;  4COC A;  3G1G A;  2MF4 A;  3DS4 A;  4H2W C;  1M6N A;  3EJE A;  5DCK A;  7CEI A;  3CCJ P;  1QVF O;  2LL8 A;  4U0C A;  5I4T G;  2FAE A;  2ROQ A;  1A8O A;  3CCL P;  4HKG A;  5BS1 A;  2KOS A;  3GZL A;  3B4Q A;  1FR2 A;  1DV5 A;  3CCQ P;  4XFZ A;  2EFJ A;  4WYM A;  2EHS A;  3LRY A;  2GZJ A;  2JU1 A;  2FQ2 A;  1A43 A;  3DS1 A;  5JPA A;  3HZQ A;  3MGE A;  2MVU A;  3GKL C;  1KQS O;  3CME P;  2JBG A;  2GZF A;  2JAZ A;  2BHV A;  2JB0 A;  3G21 A;  1VKU A;  3DPH A;  3CD6 P;  1GXG A;  1UJZ A;  1QRJ A;  2LOL A;  1T8K A;  1MZ8 A;  2PEI A;  2PEQ A;  3GZM A;  5HGM A;  3I56 P;  1NJI Q;  1D1D A;  2N5H A;  1VQ4 P;  5HGL A;  1AF8 A;  2Z46 A;  3E2D A;  2LPK A;  2CG5 B;  3G71 P;  4QNB A;  2KGA A;  1Q86 Q;  1ACP A;  1AUM A;  2XT1 A;  2JO0 A;  1EMV A;  2L22 A;  4XRQ A;  2LIU A;  5KP8 B;  1RO2 A;  2K0X A;  5HGO A;  1EIA A;  1L0H A;  2FHS C;  2XV6 A;  2JQ4 A;  3DS2 A;  2KR5 A;  4QKO A;  5HVC A;  3GJN A;  1W2B O;  2M8N A;  1GXH A;  1M90 Q;  1L0I A;  4XRO A;  2PY8 A;  2EHT A;  2VLO A;  3CCU P;  1OR5 A;  5EW5 E;  2JYL A;  3CC2 P;  1E6J P;  2KG8 A;  5CZD B;  3CCV P;  4DG9 A;  3RG6 C;  2OTJ P;  1KD1 Q;  3G0V A;  1VQ8 P;  1Q81 Q;  1K73 Q;  2JGP A;  4CA3 A;  4H2X C;  3H0D A;  2EG5 A;  2FVF A;  2GZG A;  2WPT A;  1QVG O;  2FAC A;  2KG6 A;  4PWV B;  4UHP B;  1VQP P;  2N5I A;  3CCM P;  1RNI A;  2LML A;  2FVE A;  4F37 A;  2N50 A;  1YIJ P;  1VQ7 P;  4U0D A;  3G4S P;  4XFX A;  1VQN P;  2AVA A;  2X2B A;  2PEJ A;  2PEK A;  2LF4 A;  2NO8 A;  4M0I A;  2VLN A;  2LIW A;  3M1M A;  5KP7 B;  1YI2 P;  3CMA P;  3DS3 A;  2DGY A;  2QEX P;  2KWL A;  4R0M A;  4GR2 A;  4U0B A;  1EOQ A;  2GZE A;  3B5I A;  2M5R A;  1KLP A;  4PH1 A;  2K5X A;  4COP A;  1E0H A;  3P05 A;  4H2Y C;  2PEO A;  3CC4 P;  2MY5 A;  2Z45 A;  3OW2 O;  2FQ0 A;  1YJ9 P;  3H4E A;  1VQ9 P;  1JJ2 O;  2LTE A;  1GPJ A;  4MRT C;  4BPF A;  2PEM A;  1DNY A;  2K93 A;  1BXI A;  1ZNV A;  2KOO A;  3NY7 B;  1YJN P;  1HQB A;  1HY8 A;  3DS5 A;  3CPW O;  1F80 D;  2K0Y A;  2Z44 A;  5KP6 B;  4IZ6 A;  2AFD A;  2DNW A;  2MD9 A; 
#chains in the Genus database with same CATH homology
 2KG6 A;  2VSQ A;  2KW2 A;  2GDW A;  4PWV B;  2N6Z A;  2MR7 A;  4PXH B;  1VKU A;  2AF8 A;  2MR8 A;  2N5I A;  2LOL A;  1T8K A;  3GZM A;  2KG9 A;  2LML A;  2FVE A;  2QNW A;  2K94 A;  2AFE A;  2N5H A;  2N50 A;  1AF8 A;  1X3O A;  2L0Q A;  3LMO A;  2XZ0 D;  2GDX A;  2LPK A;  2PNG A;  2CG5 B;  3CE7 A;  2AVA A;  2FVA A;  2N98 A;  1NQ4 A;  2KGA A;  2KGD A;  2X2B A;  1ACP A;  2CNR A;  2L22 A;  2L4B A;  2LIU A;  2KOR A;  3RG2 A;  5KP8 B;  2LIW A;  2K0X A;  2GDY A;  5KP7 B;  1L0H A;  2CGQ A;  5EJD A;  2FHS C;  2N6Y A;  2KWL A;  4R0M A;  2JQ4 A;  2LKI A;  2KOP A;  2MVV A;  4BPH A;  2KR5 A;  5HVC A;  2M5R A;  2JU2 A;  2K2Q A;  1KLP A;  4NEO A;  2L9F A;  2CQ8 A;  4H2Y C;  2MF4 A;  1L0I A;  4H2W C;  4BPG A;  3EJE A;  2EHT A;  2MY5 A;  2FQ0 A;  1OR5 A;  2K92 A;  2FQ1 A;  2LL8 A;  2FAD A;  2FAE A;  2LTE A;  2ROQ A;  2KG8 A;  5CZD B;  4HKG A;  4MRT C;  4BPF A;  2KOS A;  4DG9 A;  3EJD A;  3GZL A;  1DNY A;  5HV8 A;  2K93 A;  1DV5 A;  2KOO A;  2KGE A;  2EHS A;  2JGP A;  3NY7 B;  1HQB A;  2JU1 A;  1HY8 A;  2KOQ A;  4CA3 A;  2FQ2 A;  4H2X C;  1F80 D;  2KGC A;  2K0Y A;  2FVF A;  3EJB A;  2MVU A;  2XZ1 C;  5KP6 B;  4IZ6 A;  2AFD A;  2DNW A;  2FAC A;  2MD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...