2N6YA

Solution structure of holo arcp from yersiniabactin synthetase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
total genus 29
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6yA00
2KOOA 3LMOA 2JU2A 2CQ8A 4PWVB 2LL8A 2LPKA 2FVFA 1T8KA 2LTEA 2KG6A 2ROQA 2XZ1C 4H2XC 4IZ6A 2KGDA 2KR5A 5KP6B 2K0XA 2KORA 2FAEA 2X2BA 2K93A 3EJDA 5HV8A 4BPHA 2L0QA 1X3OA 2KGCA 5HVCA 4R0MA 1L0HA 2N98A 2N5IA 2KWLA 2AF8A 4HKGA 2LIWA 2L4BA 2KGEA 2K0YA 5CZDB 4MRTC 4BPGA 2CG5B 4CA3A 2KOQA 2KW2A 2N6YA 4H2WC 2AVAA 2MR7A 3EJBA 2FACA 2GDWA 2N5HA 2XZ0D 2FQ0A 2AFDA 4H2YC 1HY8A 3NY7B 1NQ4A 2KOPA 1OR5A 2EHSA 2QNWA 2GDXA 1ACPA 1AF8A 1DV5A 4DG9A 2FVEA 1KLPA 2KGAA 2L9FA 2CNRA 2FQ2A 2LIUA 2KOSA 2FQ1A 1DNYA 3GZLA 2M5RA 2L22A 2N6ZA 2JGPA 2VSQA 3GZMA 3EJEA 2K94A 3RG2A 2EHTA 2LMLA 2FVAA 2DNWA 1VKUA 5KP7B 1L0IA 2FHSC 4BPFA 2MF4A 5KP8B 2FADA 5EJDA 2N50A 4PXHB 2AFEA 2KG9A 2K92A 2JU1A 2MVUA 2K2QA 2PNGA 2LKIA 2MVVA 1F80D 1HQBA 2MR8A 2JQ4A 2MY5A 2CGQA 2MD9A 4NEOA 2GDYA 2KG8A 3CE7A 2LOLA
chains in the Genus database with same CATH superfamily
2XXMA 3LMOA 4QNBA 1YIJP 2CQ8A 4COCA 4UHPB 2LPKA 4H2XC 2KGDA 4U0DA 2K0XA 2KORA 2QEXP 2XV6A 1K73Q 2M8NA 1YJWP 3CCRP 1X3OA 5HVCA 2PEJA 2N98A 2AF8A 2EFJA 2CWOA 2K0YA 1VQOP 4COPA 1QRJA 1VQ5P 1ZMBA 2CG5B 1VQPP 2VLPA 1VQKP 2PEQA 2XZ0D 2JAZA 2EHSA 1IUQA 2OARA 1ACPA 1AF8A 3DS3A 4DG9A 3CCLP 3CC7P 2BUOA 3HYBA 2JYLA 1Q82Q 2KOSA 2FQ1A 1DNYA 1M6EX 3CMAP 1AYIA 1VQMP 3P05A 3GZMA 3EJEA 1EIAA 2K94A 2EHTA 1KC8Q 5KP7B 1D1DA 3OW2O 5KP8B 3M1MA 3CCMP 5F2KA 2E1MA 4PXHB 2ERHA 3G1GA 2AFEA 2KG9A 2K92A 1NJIQ 1VQ6P 1QVFO 2L6EA 3H0DA 2JU1A 4U0EA 5EW5E 1F80D 2MY5A 2XT1A 2GDYA 2EG5A 1K30A 2JU2A 2LL8A 1T8KA 2LTEA 3G28A 1Q81Q 3WBHA 2ROQA 3CCQP 5KP6B 7CEIA 2X2BA 1Z6MA 3EJDA 4GR6A 1Q86Q 1UNKA 2N5IA 3U43A 2EIAA 1BAJA 3DTJA 1KD1Q 1BXIA 1CEIA 1YHQP 4BPGA 3G71P 5HGNA 2PEOA 2P9XA 2KW2A 2JYGA 2AVAA 3HZQA 2GDWA 1M1KQ 1JJ2O 1YITP 4WYMA 3NY7B 3RG6C 3DS4A 3G29A 2GDXA 4XFXA 5HGOA 1M90Q 1K9MQ 2FVEA 1KLPA 4XRQA 1VQ8P 1EOQA 2VLOA 2FQ2A 3CMEP 3GZLA 2K0DX 3DPHA 1E6JP 3RG2A 2PEKA 3DS1A 1QVGO 2FVAA 2OTLP 2DNWA 3CCUP 4BPFA 2GZJA 1GPJA 2K2QA 3DS2A 2MVVA 3GKLC 1AUMA 4GR2A 5I4TG 2CGQA 4PH0A 4NEOA 1VKUA 1YI2P 3GJNA 2KOOA 3MGEA 3DS5A 4PWVB 3Q20A 3E2DA 2FVFA 3H47A 2KG6A 2BHVA 4F37A 3CPWO 2OTJP 3G26A 2L0QA 3CCEP 2KGCA 3I55P 2WPTA 1L0HA 3NTEA 4HKGA 2DGYA 1RO2A 1M74A 5CZDB 3LRYA 4XROA 3G0VA 1FR2A 2GYKA 1Q7YQ 4CA3A 2GZFA 2KOQA 2N6YA 4H2WC 1VHNA 3EJBA 2JB0A 2GZIA 2AFDA 4H2YC 1HY8A 1IMPA 2KOPA 1OR5A 4U0FA 5F2NA 4U0CA 3DS0A 1DV5A 3CD6P 3G6EP 1W2BO 3CCVP 4QKOA 1IMQA 1GXGA 3CC2P 2JO0A 4IPYA 2N6ZA 2JGPA 1MZ8A 3B4QA 2M8PA 4M0IA 5JPAA 4U0AA 2FHSC 2Z46A 1VQ4P 5BS1A 2N50A 2K5XA 3VRLC 2PEMA 1VQ7P 2KODA 2PNGA 2LKIA 1VQNP 1S72P 2MD9A 1YJNP 2Z45A 2GZGA 2LOLA 2PY8A 4U0BA 2ONTA 2XZ1C 3G21A 4IZ6A 5DCKA 2KR5A 2FAEA 2K93A 2VLNA 5HV8A 4BPHA 1VQLP 4R0MA 4PH1A 2KWLA 1N8RQ 2GZEA 2L4BA 2KGEA 2LIWA 1ZNVA 3H4EA 3B5IA 4MRTC 5F2OA 1E0HA 2VLQA 2NO8A 1KQSO 2MR7A 3G4SP 2FACA 2N5HA 4XFZA 5HGLA 3CCJP 2FQ0A 3I56P 1M6NA 2PENA 1VQ9P 1K8AQ 1NQ4A 2QNWA 2QA4P 3G1IA 3CCSP 2KGAA 2L9FA 1GXHA 2JBGA 2CNRA 2LIUA 1YJ9P 2M5RA 2L22A 2VSQA 5HGMA 2Z44A 1A43A 2LMLA 2M8LA 1EMVA 1RNIA 1L0IA 3CC4P 1RO0A 2MF4A 2FADA 5EJDA 4XFYA 2LF4A 2MVUA 1A8OA 2MR8A 1HQBA 2JQ4A 2PEIA 1UJZA 2KG8A 5BS2A 3CE7A 3CXCO
chains in the Genus database with same CATH topology
2KOOA 3LMOA 2JU2A 2CQ8A 4PWVB 2LL8A 2LPKA 2FVFA 1T8KA 2LTEA 2KG6A 2ROQA 2XZ1C 4H2XC 4IZ6A 2KGDA 2KR5A 5KP6B 2K0XA 2KORA 2FAEA 2X2BA 2K93A 3EJDA 5HV8A 4BPHA 2L0QA 1X3OA 2KGCA 5HVCA 4R0MA 1L0HA 2N98A 2N5IA 2KWLA 2AF8A 4HKGA 2LIWA 2L4BA 2KGEA 2K0YA 5CZDB 4MRTC 4BPGA 2CG5B 4CA3A 2KOQA 2KW2A 2N6YA 4H2WC 2AVAA 2MR7A 3EJBA 2FACA 2GDWA 2N5HA 2XZ0D 2FQ0A 2AFDA 4H2YC 1HY8A 3NY7B 1NQ4A 2KOPA 1OR5A 2EHSA 2QNWA 2GDXA 1ACPA 1AF8A 1DV5A 4DG9A 2FVEA 1KLPA 2KGAA 2L9FA 2CNRA 2FQ2A 2LIUA 2KOSA 2FQ1A 1DNYA 3GZLA 2M5RA 2L22A 2N6ZA 2JGPA 2VSQA 3GZMA 3EJEA 2K94A 3RG2A 2EHTA 2LMLA 2FVAA 2DNWA 1VKUA 5KP7B 1L0IA 2FHSC 4BPFA 2MF4A 5KP8B 2FADA 5EJDA 2N50A 4PXHB 2AFEA 2KG9A 2K92A 2JU1A 2MVUA 2K2QA 2PNGA 2LKIA 2MVVA 1F80D 1HQBA 2MR8A 2JQ4A 2MY5A 2CGQA 2MD9A 4NEOA 2GDYA 2KG8A 3CE7A 2LOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOO A;  3LMO A;  2JU2 A;  2CQ8 A;  4PWV B;  2LL8 A;  2LPK A;  2FVF A;  1T8K A;  2LTE A;  2KG6 A;  2ROQ A;  2XZ1 C;  4H2X C;  4IZ6 A;  2KGD A;  2KR5 A;  5KP6 B;  2K0X A;  2KOR A;  2FAE A;  2X2B A;  2K93 A;  3EJD A;  5HV8 A;  4BPH A;  2L0Q A;  1X3O A;  2KGC A;  5HVC A;  4R0M A;  1L0H A;  2N98 A;  2N5I A;  2KWL A;  2AF8 A;  4HKG A;  2LIW A;  2L4B A;  2KGE A;  2K0Y A;  5CZD B;  4MRT C;  4BPG A;  2CG5 B;  4CA3 A;  2KOQ A;  2KW2 A;  2N6Y A;  4H2W C;  2AVA A;  2MR7 A;  3EJB A;  2FAC A;  2GDW A;  2N5H A;  2XZ0 D;  2FQ0 A;  2AFD A;  4H2Y C;  1HY8 A;  3NY7 B;  1NQ4 A;  2KOP A;  1OR5 A;  2EHS A;  2QNW A;  2GDX A;  1ACP A;  1AF8 A;  1DV5 A;  4DG9 A;  2FVE A;  1KLP A;  2KGA A;  2L9F A;  2CNR A;  2FQ2 A;  2LIU A;  2KOS A;  2FQ1 A;  1DNY A;  3GZL A;  2M5R A;  2L22 A;  2N6Z A;  2JGP A;  2VSQ A;  3GZM A;  3EJE A;  2K94 A;  3RG2 A;  2EHT A;  2LML A;  2FVA A;  2DNW A;  1VKU A;  5KP7 B;  1L0I A;  2FHS C;  4BPF A;  2MF4 A;  5KP8 B;  2FAD A;  5EJD A;  2N50 A;  4PXH B;  2AFE A;  2KG9 A;  2K92 A;  2JU1 A;  2MVU A;  2K2Q A;  2PNG A;  2LKI A;  2MVV A;  1F80 D;  1HQB A;  2MR8 A;  2JQ4 A;  2MY5 A;  2CGQ A;  2MD9 A;  4NEO A;  2GDY A;  2KG8 A;  3CE7 A;  2LOL A; 
#chains in the Genus database with same CATH topology
 2XXM A;  3LMO A;  4QNB A;  1YIJ P;  2CQ8 A;  4COC A;  4UHP B;  2LPK A;  4H2X C;  2KGD A;  4U0D A;  2K0X A;  2KOR A;  2QEX P;  2XV6 A;  1K73 Q;  2M8N A;  1YJW P;  3CCR P;  1X3O A;  5HVC A;  2PEJ A;  2N98 A;  2AF8 A;  2EFJ A;  2CWO A;  2K0Y A;  1VQO P;  4COP A;  1QRJ A;  1VQ5 P;  1ZMB A;  2CG5 B;  1VQP P;  2VLP A;  1VQK P;  2PEQ A;  2XZ0 D;  2JAZ A;  2EHS A;  1IUQ A;  2OAR A;  1ACP A;  1AF8 A;  3DS3 A;  4DG9 A;  3CCL P;  3CC7 P;  2BUO A;  3HYB A;  2JYL A;  1Q82 Q;  2KOS A;  2FQ1 A;  1DNY A;  1M6E X;  3CMA P;  1AYI A;  1VQM P;  3P05 A;  3GZM A;  3EJE A;  1EIA A;  2K94 A;  2EHT A;  1KC8 Q;  5KP7 B;  1D1D A;  3OW2 O;  5KP8 B;  3M1M A;  3CCM P;  5F2K A;  2E1M A;  4PXH B;  2ERH A;  3G1G A;  2AFE A;  2KG9 A;  2K92 A;  1NJI Q;  1VQ6 P;  1QVF O;  2L6E A;  3H0D A;  2JU1 A;  4U0E A;  5EW5 E;  1F80 D;  2MY5 A;  2XT1 A;  2GDY A;  2EG5 A;  1K30 A;  2JU2 A;  2LL8 A;  1T8K A;  2LTE A;  3G28 A;  1Q81 Q;  3WBH A;  2ROQ A;  3CCQ P;  5KP6 B;  7CEI A;  2X2B A;  1Z6M A;  3EJD A;  4GR6 A;  1Q86 Q;  1UNK A;  2N5I A;  3U43 A;  2EIA A;  1BAJ A;  3DTJ A;  1KD1 Q;  1BXI A;  1CEI A;  1YHQ P;  4BPG A;  3G71 P;  5HGN A;  2PEO A;  2P9X A;  2KW2 A;  2JYG A;  2AVA A;  3HZQ A;  2GDW A;  1M1K Q;  1JJ2 O;  1YIT P;  4WYM A;  3NY7 B;  3RG6 C;  3DS4 A;  3G29 A;  2GDX A;  4XFX A;  5HGO A;  1M90 Q;  1K9M Q;  2FVE A;  1KLP A;  4XRQ A;  1VQ8 P;  1EOQ A;  2VLO A;  2FQ2 A;  3CME P;  3GZL A;  2K0D X;  3DPH A;  1E6J P;  3RG2 A;  2PEK A;  3DS1 A;  1QVG O;  2FVA A;  2OTL P;  2DNW A;  3CCU P;  4BPF A;  2GZJ A;  1GPJ A;  2K2Q A;  3DS2 A;  2MVV A;  3GKL C;  1AUM A;  4GR2 A;  5I4T G;  2CGQ A;  4PH0 A;  4NEO A;  1VKU A;  1YI2 P;  3GJN A;  2KOO A;  3MGE A;  3DS5 A;  4PWV B;  3Q20 A;  3E2D A;  2FVF A;  3H47 A;  2KG6 A;  2BHV A;  4F37 A;  3CPW O;  2OTJ P;  3G26 A;  2L0Q A;  3CCE P;  2KGC A;  3I55 P;  2WPT A;  1L0H A;  3NTE A;  4HKG A;  2DGY A;  1RO2 A;  1M74 A;  5CZD B;  3LRY A;  4XRO A;  3G0V A;  1FR2 A;  2GYK A;  1Q7Y Q;  4CA3 A;  2GZF A;  2KOQ A;  2N6Y A;  4H2W C;  1VHN A;  3EJB A;  2JB0 A;  2GZI A;  2AFD A;  4H2Y C;  1HY8 A;  1IMP A;  2KOP A;  1OR5 A;  4U0F A;  5F2N A;  4U0C A;  3DS0 A;  1DV5 A;  3CD6 P;  3G6E P;  1W2B O;  3CCV P;  4QKO A;  1IMQ A;  1GXG A;  3CC2 P;  2JO0 A;  4IPY A;  2N6Z A;  2JGP A;  1MZ8 A;  3B4Q A;  2M8P A;  4M0I A;  5JPA A;  4U0A A;  2FHS C;  2Z46 A;  1VQ4 P;  5BS1 A;  2N50 A;  2K5X A;  3VRL C;  2PEM A;  1VQ7 P;  2KOD A;  2PNG A;  2LKI A;  1VQN P;  1S72 P;  2MD9 A;  1YJN P;  2Z45 A;  2GZG A;  2LOL A;  2PY8 A;  4U0B A;  2ONT A;  2XZ1 C;  3G21 A;  4IZ6 A;  5DCK A;  2KR5 A;  2FAE A;  2K93 A;  2VLN A;  5HV8 A;  4BPH A;  1VQL P;  4R0M A;  4PH1 A;  2KWL A;  1N8R Q;  2GZE A;  2L4B A;  2KGE A;  2LIW A;  1ZNV A;  3H4E A;  3B5I A;  4MRT C;  5F2O A;  1E0H A;  2VLQ A;  2NO8 A;  1KQS O;  2MR7 A;  3G4S P;  2FAC A;  2N5H A;  4XFZ A;  5HGL A;  3CCJ P;  2FQ0 A;  3I56 P;  1M6N A;  2PEN A;  1VQ9 P;  1K8A Q;  1NQ4 A;  2QNW A;  2QA4 P;  3G1I A;  3CCS P;  2KGA A;  2L9F A;  1GXH A;  2JBG A;  2CNR A;  2LIU A;  1YJ9 P;  2M5R A;  2L22 A;  2VSQ A;  5HGM A;  2Z44 A;  1A43 A;  2LML A;  2M8L A;  1EMV A;  1RNI A;  1L0I A;  3CC4 P;  1RO0 A;  2MF4 A;  2FAD A;  5EJD A;  4XFY A;  2LF4 A;  2MVU A;  1A8O A;  2MR8 A;  1HQB A;  2JQ4 A;  2PEI A;  1UJZ A;  2KG8 A;  5BS2 A;  3CE7 A;  3CXC O; 
#chains in the Genus database with same CATH homology
 2KOO A;  3LMO A;  2JU2 A;  2CQ8 A;  4PWV B;  2LL8 A;  2LPK A;  2FVF A;  1T8K A;  2LTE A;  2KG6 A;  2ROQ A;  2XZ1 C;  4H2X C;  4IZ6 A;  2KGD A;  2KR5 A;  5KP6 B;  2K0X A;  2KOR A;  2FAE A;  2X2B A;  2K93 A;  3EJD A;  5HV8 A;  4BPH A;  2L0Q A;  1X3O A;  2KGC A;  5HVC A;  4R0M A;  1L0H A;  2N98 A;  2N5I A;  2KWL A;  2AF8 A;  4HKG A;  2LIW A;  2L4B A;  2KGE A;  2K0Y A;  5CZD B;  4MRT C;  4BPG A;  2CG5 B;  4CA3 A;  2KOQ A;  2KW2 A;  2N6Y A;  4H2W C;  2AVA A;  2MR7 A;  3EJB A;  2FAC A;  2GDW A;  2N5H A;  2XZ0 D;  2FQ0 A;  2AFD A;  4H2Y C;  1HY8 A;  3NY7 B;  1NQ4 A;  2KOP A;  1OR5 A;  2EHS A;  2QNW A;  2GDX A;  1ACP A;  1AF8 A;  1DV5 A;  4DG9 A;  2FVE A;  1KLP A;  2KGA A;  2L9F A;  2CNR A;  2FQ2 A;  2LIU A;  2KOS A;  2FQ1 A;  1DNY A;  3GZL A;  2M5R A;  2L22 A;  2N6Z A;  2JGP A;  2VSQ A;  3GZM A;  3EJE A;  2K94 A;  3RG2 A;  2EHT A;  2LML A;  2FVA A;  2DNW A;  1VKU A;  5KP7 B;  1L0I A;  2FHS C;  4BPF A;  2MF4 A;  5KP8 B;  2FAD A;  5EJD A;  2N50 A;  4PXH B;  2AFE A;  2KG9 A;  2K92 A;  2JU1 A;  2MVU A;  2K2Q A;  2PNG A;  2LKI A;  2MVV A;  1F80 D;  1HQB A;  2MR8 A;  2JQ4 A;  2MY5 A;  2CGQ A;  2MD9 A;  4NEO A;  2GDY A;  2KG8 A;  3CE7 A;  2LOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...