2N6YA

Solution structure of holo arcp from yersiniabactin synthetase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
80
structure length
79
Chain Sequence
DNRHAADYQQLRERLIQELNLTPQQLHEESNLIQAGLDIRLMRWLHWFRKNGYRLTLRELYAAPTLAAWNQLMLSRSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HMWP2 nonribosomal peptide synthetase
publication title Solution Structure of a Nonribosomal Peptide Synthetase Carrier Protein Loaded with Its Substrate Reveals Transient, Well-Defined Contacts.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Ligase
total genus 29
structure length 79
sequence length 80
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n6yA00
3NY7B 2L0QA 2KOPA 3LMOA 2KG8A 2JU1A 2KGCA 2LKIA 5KP7B 2L9FA 2GDWA 1OR5A 4PXHB 1F80D 2FQ0A 2FADA 2KW2A 5EJDA 3RG2A 1KLPA 1AF8A 2MF4A 2JGPA 4CA3A 2KGEA 2L4BA 2CG5B 2K93A 2KG9A 2KOQA 5CZDB 2XZ1C 2KOOA 2KG6A 3EJDA 2JQ4A 2GDYA 2MD9A 2K94A 2M5RA 3CE7A 5HVCA 2AVAA 4BPHA 4R0MA 2KWLA 2FQ1A 2K0YA 2LOLA 2KR5A 4H2WC 4PWVB 2K92A 2AFEA 2QNWA 2FVEA 2MVVA 2KORA 1HQBA 2FHSC 2FACA 2LIWA 2XZ0D 4DG9A 2FAEA 2N50A 2N98A 2FQ2A 2L22A 2LIUA 1X3OA 2CQ8A 2CNRA 5KP6B 3GZLA 2KGAA 2KGDA 2FVAA 2MVUA 4HKGA 2CGQA 2LL8A 1ACPA 2MR7A 5HV8A 3GZMA 1T8KA 3EJBA 1DV5A 3EJEA 2N5HA 2EHTA 2LMLA 2AF8A 2KOSA 1NQ4A 2JU2A 4NEOA 2PNGA 4BPGA 2ROQA 2K2QA 2N5IA 4H2XC 1L0HA 2X2BA 5KP8B 2VSQA 2FVFA 4BPFA 2AFDA 2N6ZA 2EHSA 2LPKA 1DNYA 4H2YC 2N6YA 2MR8A 1HY8A 1VKUA 4IZ6A 2DNWA 2K0XA 2MY5A 2GDXA 4MRTC 1L0IA 2LTEA
chains in the Genus database with same CATH superfamily
1Z6MA 2KOPA 3LMOA 1VQPP 1GXHA 2LKIA 2GDWA 1OR5A 3HZQA 2FQ0A 3CC4P 1YJWP 1QVGO 3DS3A 4PH0A 5EJDA 3RG2A 1VQ5P 3G4SP 3DS0A 1AF8A 1RO0A 1NJIQ 1MZ8A 1RO2A 5F2KA 1UJZA 2KG6A 2JQ4A 2EIAA 4U0CA 4GR6A 1KD1Q 4PH1A 2AVAA 2LOLA 4H2WC 3CCUP 2Z44A 1YHQP 2QNWA 4U0FA 1K73Q 2MVVA 4COCA 3DS5A 4GR2A 2VLQA 2WPTA 2LIWA 4M0IA 7CEIA 2FAEA 2N50A 3DPHA 2EFJA 5KP6B 1S72P 2KGAA 2OARA 4QNBA 1M90Q 3RG6C 2MVUA 1ACPA 5HV8A 3EJEA 2E1MA 2M8LA 2N5HA 2NO8A 2KOSA 1QVFO 2ROQA 3H0DA 2K2QA 1M74A 2X2BA 3GKLC 1M6NA 3CXCO 5KP8B 4XRQA 2QA4P 3H47A 2N6ZA 4XFXA 3B4QA 1AYIA 2PEQA 1Q86Q 1W2BO 2LTEA 1KC8Q 1VQ8P 3CC2P 1VQKP 4F37A 5HGMA 1EMVA 2PEMA 2KGCA 1M1KQ 4PXHB 5I4TG 3CPWO 1E0HA 2XT1A 2M8NA 3CCVP 1VQMP 2FADA 3U43A 4MRTC 1KLPA 2MF4A 1EOQA 5JPAA 2JAZA 2KGEA 3CCSP 3DTJA 5HGLA 2KG9A 2KOQA 5CZDB 2KOOA 3H4EA 4IPYA 3EJDA 2L6EA 2GDYA 3P05A 3CE7A 3G1IA 4BPHA 2GZIA 2GZJA 2K0YA 2KR5A 4PWVB 2ONTA 2JB0A 2K92A 2AFEA 2M8PA 1KQSO 2FVEA 3CCLP 2JO0A 2KORA 3G71P 1M6EX 1N8RQ 2PEKA 2XZ0D 4DG9A 3WBHA 2FQ2A 3GJNA 3CMEP 4U0BA 2K5XA 2LIUA 2VLPA 5DCKA 3CC7P 1RNIA 2MR7A 2GYKA 1DV5A 2LMLA 3NTEA 3CCMP 2JU2A 4COPA 2PEIA 2N5IA 2LF4A 4BPFA 2JYLA 4U0DA 2LPKA 3I56P 1Q7YQ 2DNWA 2GDXA 3NY7B 2L0QA 1UNKA 3G29A 2PEOA 3G6EP 2KG8A 5KP7B 3CMAP 2L9FA 1YI2P 2XXMA 1F80D 1VQ4P 1E6JP 1QRJA 1YITP 1ZMBA 2JGPA 2BHVA 3E2DA 4CA3A 5BS1A 1VQNP 3G0VA 4U0AA 2XZ1C 2GZEA 1Q81Q 2K94A 2QEXP 5HVCA 4R0MA 3OW2O 3B5IA 2KODA 2KWLA 3LRYA 1A43A 4UHPB 2EG5A 3CCEP 1IUQA 3CCRP 2XV6A 1YIJP 1HQBA 2FACA 4U0EA 1AUMA 2N98A 3MGEA 2OTJP 2CQ8A 3VRLC 1K9MQ 2BUOA 4HKGA 2CGQA 2Z45A 3CCQP 2EHTA 1ZNVA 3CCJP 1K30A 2AF8A 4NEOA 2PNGA 4BPGA 5HGNA 1IMPA 1IMQA 1GXGA 4H2XC 1L0HA 2VSQA 1D1DA 2AFDA 2GZFA 1DNYA 4H2YC 3DS2A 1HY8A 2PENA 1VQ9P 1VKUA 2K0XA 3M1MA 2CG5B 2PY8A 1L0IA 1CEIA 1FR2A 3CD6P 1YJNP 2JU1A 2ERHA 1K8AQ 2OTLP 3DS4A 5F2OA 5F2NA 2KW2A 2DGYA 4QKOA 3DS1A 2L4BA 2GZGA 2K93A 2JYGA 2MD9A 1VQLP 2VLOA 2M5RA 1Q82Q 2CWOA 3HYBA 2VLNA 2P9XA 1EIAA 2FQ1A 2K0DX 2JBGA 1VQOP 1VQ7P 3G21A 2FHSC 1BXIA 2Z46A 1BAJA 2L22A 1VQ6P 1X3OA 2CNRA 3GZLA 1YJ9P 2KGDA 2FVAA 1JJ2O 2LL8A 1GPJA 5EW5E 3GZMA 1T8KA 3EJBA 2PEJA 3G1GA 1NQ4A 5HGOA 3I55P 5BS2A 2FVFA 4XFZA 4XFYA 4XROA 2EHSA 3Q20A 3G28A 3G26A 2N6YA 2MR8A 4IZ6A 1VHNA 1A8OA 2MY5A 4WYMA
chains in the Genus database with same CATH topology
3NY7B 2L0QA 2KOPA 3LMOA 2KG8A 2JU1A 2KGCA 2LKIA 5KP7B 2L9FA 2GDWA 1OR5A 4PXHB 1F80D 2FQ0A 2FADA 2KW2A 5EJDA 3RG2A 1KLPA 1AF8A 2MF4A 2JGPA 4CA3A 2KGEA 2L4BA 2CG5B 2K93A 2KG9A 2KOQA 5CZDB 2XZ1C 2KOOA 2KG6A 3EJDA 2JQ4A 2GDYA 2MD9A 2K94A 2M5RA 3CE7A 5HVCA 2AVAA 4BPHA 4R0MA 2KWLA 2FQ1A 2K0YA 2LOLA 2KR5A 4H2WC 4PWVB 2K92A 2AFEA 2QNWA 2FVEA 2MVVA 2KORA 1HQBA 2FHSC 2FACA 2LIWA 2XZ0D 4DG9A 2FAEA 2N50A 2N98A 2FQ2A 2L22A 2LIUA 1X3OA 2CQ8A 2CNRA 5KP6B 3GZLA 2KGAA 2KGDA 2FVAA 2MVUA 4HKGA 2CGQA 2LL8A 1ACPA 2MR7A 5HV8A 3GZMA 1T8KA 3EJBA 1DV5A 3EJEA 2N5HA 2EHTA 2LMLA 2AF8A 2KOSA 1NQ4A 2JU2A 4NEOA 2PNGA 4BPGA 2ROQA 2K2QA 2N5IA 4H2XC 1L0HA 2X2BA 5KP8B 2VSQA 2FVFA 4BPFA 2AFDA 2N6ZA 2EHSA 2LPKA 1DNYA 4H2YC 2N6YA 2MR8A 1HY8A 1VKUA 4IZ6A 2DNWA 2K0XA 2MY5A 2GDXA 4MRTC 1L0IA 2LTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NY7 B;  2L0Q A;  2KOP A;  3LMO A;  2KG8 A;  2JU1 A;  2KGC A;  2LKI A;  5KP7 B;  2L9F A;  2GDW A;  1OR5 A;  4PXH B;  1F80 D;  2FQ0 A;  2FAD A;  2KW2 A;  5EJD A;  3RG2 A;  1KLP A;  1AF8 A;  2MF4 A;  2JGP A;  4CA3 A;  2KGE A;  2L4B A;  2CG5 B;  2K93 A;  2KG9 A;  2KOQ A;  5CZD B;  2XZ1 C;  2KOO A;  2KG6 A;  3EJD A;  2JQ4 A;  2GDY A;  2MD9 A;  2K94 A;  2M5R A;  3CE7 A;  5HVC A;  2AVA A;  4BPH A;  4R0M A;  2KWL A;  2FQ1 A;  2K0Y A;  2LOL A;  2KR5 A;  4H2W C;  4PWV B;  2K92 A;  2AFE A;  2QNW A;  2FVE A;  2MVV A;  2KOR A;  1HQB A;  2FHS C;  2FAC A;  2LIW A;  2XZ0 D;  4DG9 A;  2FAE A;  2N50 A;  2N98 A;  2FQ2 A;  2L22 A;  2LIU A;  1X3O A;  2CQ8 A;  2CNR A;  5KP6 B;  3GZL A;  2KGA A;  2KGD A;  2FVA A;  2MVU A;  4HKG A;  2CGQ A;  2LL8 A;  1ACP A;  2MR7 A;  5HV8 A;  3GZM A;  1T8K A;  3EJB A;  1DV5 A;  3EJE A;  2N5H A;  2EHT A;  2LML A;  2AF8 A;  2KOS A;  1NQ4 A;  2JU2 A;  4NEO A;  2PNG A;  4BPG A;  2ROQ A;  2K2Q A;  2N5I A;  4H2X C;  1L0H A;  2X2B A;  5KP8 B;  2VSQ A;  2FVF A;  4BPF A;  2AFD A;  2N6Z A;  2EHS A;  2LPK A;  1DNY A;  4H2Y C;  2N6Y A;  2MR8 A;  1HY8 A;  1VKU A;  4IZ6 A;  2DNW A;  2K0X A;  2MY5 A;  2GDX A;  4MRT C;  1L0I A;  2LTE A; 
#chains in the Genus database with same CATH topology
 1Z6M A;  2KOP A;  3LMO A;  1VQP P;  1GXH A;  2LKI A;  2GDW A;  1OR5 A;  3HZQ A;  2FQ0 A;  3CC4 P;  1YJW P;  1QVG O;  3DS3 A;  4PH0 A;  5EJD A;  3RG2 A;  1VQ5 P;  3G4S P;  3DS0 A;  1AF8 A;  1RO0 A;  1NJI Q;  1MZ8 A;  1RO2 A;  5F2K A;  1UJZ A;  2KG6 A;  2JQ4 A;  2EIA A;  4U0C A;  4GR6 A;  1KD1 Q;  4PH1 A;  2AVA A;  2LOL A;  4H2W C;  3CCU P;  2Z44 A;  1YHQ P;  2QNW A;  4U0F A;  1K73 Q;  2MVV A;  4COC A;  3DS5 A;  4GR2 A;  2VLQ A;  2WPT A;  2LIW A;  4M0I A;  7CEI A;  2FAE A;  2N50 A;  3DPH A;  2EFJ A;  5KP6 B;  1S72 P;  2KGA A;  2OAR A;  4QNB A;  1M90 Q;  3RG6 C;  2MVU A;  1ACP A;  5HV8 A;  3EJE A;  2E1M A;  2M8L A;  2N5H A;  2NO8 A;  2KOS A;  1QVF O;  2ROQ A;  3H0D A;  2K2Q A;  1M74 A;  2X2B A;  3GKL C;  1M6N A;  3CXC O;  5KP8 B;  4XRQ A;  2QA4 P;  3H47 A;  2N6Z A;  4XFX A;  3B4Q A;  1AYI A;  2PEQ A;  1Q86 Q;  1W2B O;  2LTE A;  1KC8 Q;  1VQ8 P;  3CC2 P;  1VQK P;  4F37 A;  5HGM A;  1EMV A;  2PEM A;  2KGC A;  1M1K Q;  4PXH B;  5I4T G;  3CPW O;  1E0H A;  2XT1 A;  2M8N A;  3CCV P;  1VQM P;  2FAD A;  3U43 A;  4MRT C;  1KLP A;  2MF4 A;  1EOQ A;  5JPA A;  2JAZ A;  2KGE A;  3CCS P;  3DTJ A;  5HGL A;  2KG9 A;  2KOQ A;  5CZD B;  2KOO A;  3H4E A;  4IPY A;  3EJD A;  2L6E A;  2GDY A;  3P05 A;  3CE7 A;  3G1I A;  4BPH A;  2GZI A;  2GZJ A;  2K0Y A;  2KR5 A;  4PWV B;  2ONT A;  2JB0 A;  2K92 A;  2AFE A;  2M8P A;  1KQS O;  2FVE A;  3CCL P;  2JO0 A;  2KOR A;  3G71 P;  1M6E X;  1N8R Q;  2PEK A;  2XZ0 D;  4DG9 A;  3WBH A;  2FQ2 A;  3GJN A;  3CME P;  4U0B A;  2K5X A;  2LIU A;  2VLP A;  5DCK A;  3CC7 P;  1RNI A;  2MR7 A;  2GYK A;  1DV5 A;  2LML A;  3NTE A;  3CCM P;  2JU2 A;  4COP A;  2PEI A;  2N5I A;  2LF4 A;  4BPF A;  2JYL A;  4U0D A;  2LPK A;  3I56 P;  1Q7Y Q;  2DNW A;  2GDX A;  3NY7 B;  2L0Q A;  1UNK A;  3G29 A;  2PEO A;  3G6E P;  2KG8 A;  5KP7 B;  3CMA P;  2L9F A;  1YI2 P;  2XXM A;  1F80 D;  1VQ4 P;  1E6J P;  1QRJ A;  1YIT P;  1ZMB A;  2JGP A;  2BHV A;  3E2D A;  4CA3 A;  5BS1 A;  1VQN P;  3G0V A;  4U0A A;  2XZ1 C;  2GZE A;  1Q81 Q;  2K94 A;  2QEX P;  5HVC A;  4R0M A;  3OW2 O;  3B5I A;  2KOD A;  2KWL A;  3LRY A;  1A43 A;  4UHP B;  2EG5 A;  3CCE P;  1IUQ A;  3CCR P;  2XV6 A;  1YIJ P;  1HQB A;  2FAC A;  4U0E A;  1AUM A;  2N98 A;  3MGE A;  2OTJ P;  2CQ8 A;  3VRL C;  1K9M Q;  2BUO A;  4HKG A;  2CGQ A;  2Z45 A;  3CCQ P;  2EHT A;  1ZNV A;  3CCJ P;  1K30 A;  2AF8 A;  4NEO A;  2PNG A;  4BPG A;  5HGN A;  1IMP A;  1IMQ A;  1GXG A;  4H2X C;  1L0H A;  2VSQ A;  1D1D A;  2AFD A;  2GZF A;  1DNY A;  4H2Y C;  3DS2 A;  1HY8 A;  2PEN A;  1VQ9 P;  1VKU A;  2K0X A;  3M1M A;  2CG5 B;  2PY8 A;  1L0I A;  1CEI A;  1FR2 A;  3CD6 P;  1YJN P;  2JU1 A;  2ERH A;  1K8A Q;  2OTL P;  3DS4 A;  5F2O A;  5F2N A;  2KW2 A;  2DGY A;  4QKO A;  3DS1 A;  2L4B A;  2GZG A;  2K93 A;  2JYG A;  2MD9 A;  1VQL P;  2VLO A;  2M5R A;  1Q82 Q;  2CWO A;  3HYB A;  2VLN A;  2P9X A;  1EIA A;  2FQ1 A;  2K0D X;  2JBG A;  1VQO P;  1VQ7 P;  3G21 A;  2FHS C;  1BXI A;  2Z46 A;  1BAJ A;  2L22 A;  1VQ6 P;  1X3O A;  2CNR A;  3GZL A;  1YJ9 P;  2KGD A;  2FVA A;  1JJ2 O;  2LL8 A;  1GPJ A;  5EW5 E;  3GZM A;  1T8K A;  3EJB A;  2PEJ A;  3G1G A;  1NQ4 A;  5HGO A;  3I55 P;  5BS2 A;  2FVF A;  4XFZ A;  4XFY A;  4XRO A;  2EHS A;  3Q20 A;  3G28 A;  3G26 A;  2N6Y A;  2MR8 A;  4IZ6 A;  1VHN A;  1A8O A;  2MY5 A;  4WYM A; 
#chains in the Genus database with same CATH homology
 3NY7 B;  2L0Q A;  2KOP A;  3LMO A;  2KG8 A;  2JU1 A;  2KGC A;  2LKI A;  5KP7 B;  2L9F A;  2GDW A;  1OR5 A;  4PXH B;  1F80 D;  2FQ0 A;  2FAD A;  2KW2 A;  5EJD A;  3RG2 A;  1KLP A;  1AF8 A;  2MF4 A;  2JGP A;  4CA3 A;  2KGE A;  2L4B A;  2CG5 B;  2K93 A;  2KG9 A;  2KOQ A;  5CZD B;  2XZ1 C;  2KOO A;  2KG6 A;  3EJD A;  2JQ4 A;  2GDY A;  2MD9 A;  2K94 A;  2M5R A;  3CE7 A;  5HVC A;  2AVA A;  4BPH A;  4R0M A;  2KWL A;  2FQ1 A;  2K0Y A;  2LOL A;  2KR5 A;  4H2W C;  4PWV B;  2K92 A;  2AFE A;  2QNW A;  2FVE A;  2MVV A;  2KOR A;  1HQB A;  2FHS C;  2FAC A;  2LIW A;  2XZ0 D;  4DG9 A;  2FAE A;  2N50 A;  2N98 A;  2FQ2 A;  2L22 A;  2LIU A;  1X3O A;  2CQ8 A;  2CNR A;  5KP6 B;  3GZL A;  2KGA A;  2KGD A;  2FVA A;  2MVU A;  4HKG A;  2CGQ A;  2LL8 A;  1ACP A;  2MR7 A;  5HV8 A;  3GZM A;  1T8K A;  3EJB A;  1DV5 A;  3EJE A;  2N5H A;  2EHT A;  2LML A;  2AF8 A;  2KOS A;  1NQ4 A;  2JU2 A;  4NEO A;  2PNG A;  4BPG A;  2ROQ A;  2K2Q A;  2N5I A;  4H2X C;  1L0H A;  2X2B A;  5KP8 B;  2VSQ A;  2FVF A;  4BPF A;  2AFD A;  2N6Z A;  2EHS A;  2LPK A;  1DNY A;  4H2Y C;  2N6Y A;  2MR8 A;  1HY8 A;  1VKU A;  4IZ6 A;  2DNW A;  2K0X A;  2MY5 A;  2GDX A;  4MRT C;  1L0I A;  2LTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...