2AFEA

Solution structure of asl1650, an acyl carrier protein from anabaena sp. pcc 7120 with a variant phosphopantetheinylation-site sequence
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Ligand binding protein
molecule keywords protein Asl1650
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2afeA00
1HQBA 2LKIA 2DNWA 2EHSA 5EJDA 2KGEA 2XZ1C 2FQ2A 2CGQA 2JU2A 4PWVB 2L4BA 2N98A 4H2XC 4BPHA 1HY8A 1KLPA 2N50A 2FVEA 2MD9A 5CZDB 5KP8B 2JU1A 2L0QA 2K94A 2AF8A 2KORA 4IZ6A 2KG8A 1DV5A 2K2QA 2LL8A 1L0HA 2FADA 2GDXA 2KG9A 2AVAA 2CG5B 2LIUA 2QNWA 1OR5A 4DG9A 2LTEA 2KOSA 2K92A 3NY7B 4H2WC 3EJEA 3CE7A 2FVFA 2L9FA 1AF8A 2LMLA 2CNRA 2MR8A 2KOOA 2KWLA 2X2BA 3RG2A 2EHTA 2FACA 4BPGA 1ACPA 4CA3A 2LOLA 2N5HA 2CQ8A 4MRTC 2AFDA 2FHSC 1X3OA 2MF4A 1T8KA 2K93A 3GZLA 5HVCA 2FVAA 2PNGA 2KR5A 1VKUA 2JQ4A 2GDWA 2L22A 2K0YA 2LIWA 4NEOA 2MVVA 5KP7B 2FQ1A 2MVUA 2K0XA 4R0MA 3LMOA 1NQ4A 1L0IA 2FAEA 1F80D 2LPKA 2XZ0D 2N5IA 4BPFA 2GDYA 2ROQA 2KGAA 4HKGA 3EJBA 2N6ZA 1DNYA 2KG6A 2KOQA 2VSQA 5KP6B 2JGPA 2AFEA 2KW2A 2KOPA 2FQ0A 4PXHB 5HV8A 3EJDA 2KGCA 3GZMA 4H2YC 2N6YA 2MR7A 2M5RA 2KGDA 2MY5A
chains in the Genus database with same CATH superfamily
1HQBA 4U0AA 4IPYA 1VQPP 1YITP 2EHSA 2JBGA 4U0DA 1K73Q 2FQ2A 2Z44A 2L4BA 2N98A 4H2XC 2PEIA 1RNIA 2XXMA 1Q82Q 4XFXA 2AF8A 2NO8A 2M8LA 1L0HA 3DPHA 1M74A 2AVAA 2XT1A 2LIUA 5BS2A 2OTJP 2LTEA 2KOSA 3G26A 3EJEA 2FVFA 2L9FA 4U0FA 1VQLP 5HGOA 2LMLA 4PH1A 1VQ5P 3RG2A 2EHTA 3G0VA 4BPGA 1QVFO 1RO0A 3G6EP 1M6NA 1M1KQ 1JJ2O 2L6EA 2WPTA 1YJWP 3GZLA 2GZIA 5HVCA 2FVAA 2M8NA 3H47A 5HGNA 3DS5A 4XRQA 5KP7B 3G29A 7CEIA 5JPAA 2K0XA 3CCUP 4R0MA 4XROA 1GXHA 1F80D 2LPKA 2XZ0D 1VQ4P 4BPFA 2K5XA 4HKGA 3EJBA 1EOQA 1YHQP 2KG6A 2VSQA 3CC4P 1N8RQ 1AYIA 4GR6A 3MGEA 3G4SP 3NTEA 3CCRP 4PH0A 4H2YC 1CEIA 3CPWO 3DS1A 2DNWA 5F2OA 1ZNVA 2XZ1C 1A43A 2PEMA 2JU2A 4PWVB 3CCVP 1YJNP 1KLPA 3Q20A 3CXCO 5CZDB 3DS4A 3CCSP 2JU1A 3CCQP 1IUQA 4IZ6A 3WBHA 2LL8A 1VQKP 3DS3A 1EMVA 2CG5B 1OR5A 2JB0A 1K8AQ 4M0IA 3NY7B 3VRLC 2CNRA 1BXIA 2GZFA 4CA3A 1BAJA 3H4EA 2LOLA 1GXGA 1QVGO 2CQ8A 2E1MA 4MRTC 2AFDA 2QEXP 1VQNP 2MF4A 3DS2A 3GKLC 2KODA 2KR5A 3GJNA 2JQ4A 3CCMP 3DTJA 2EFJA 3M1MA 2OARA 2GDWA 2PEOA 2L22A 2LIWA 4NEOA 2MVVA 2GZJA 4U0EA 1FR2A 4QKOA 1KD1Q 2JYLA 2PEQA 2KOQA 1RO2A 2EIAA 2AFEA 3G28A 1W2BO 3CC2P 4PXHB 1VQ9P 1Z6MA 3CMAP 2ERHA 3OW2O 3GZMA 1VQMP 1M6EX 3H0DA 4WYMA 4U0CA 2JAZA 2P9XA 5EJDA 1Q7YQ 2KGEA 3CC7P 2CGQA 4BPHA 2FVEA 3U43A 4QNBA 3CD6P 2K94A 5HGMA 1E0HA 1DV5A 2FADA 1KC8Q 1QRJA 2PEJA 4DG9A 1NJIQ 3CMEP 3HYBA 1YI2P 3CE7A 1AF8A 2MR8A 2KOOA 5DCKA 2FACA 1ACPA 1KQSO 2Z45A 2FHSC 1X3OA 1YIJP 1T8KA 4GR2A 1VQ6P 1VQOP 1Q81Q 3B4QA 1VQ8P 1MZ8A 2OTLP 4UHPB 2CWOA 1YJ9P 2DGYA 1UJZA 1NQ4A 1L0IA 2FAEA 2BUOA 2N5IA 2VLPA 2ROQA 2EG5A 3RG6C 2K0DX 5F2KA 4COCA 5BS1A 2FQ0A 5HV8A 1D1DA 1IMQA 2GZGA 2PEKA 2KGDA 2GYKA 2JYGA 2LKIA 3G21A 1K30A 3G71P 1GPJA 2JO0A 5EW5E 5I4TG 3I56P 1K9MQ 1HY8A 2N50A 3HZQA 2MD9A 3LRYA 5KP8B 2L0QA 2LF4A 2KORA 2VLOA 2KG8A 3B5IA 2K2QA 2M8PA 2GDXA 2KG9A 3G1IA 2QNWA 3DS0A 1VHNA 2K92A 4H2WC 1VQ7P 4XFZA 3CCLP 3G1GA 2KWLA 1M90Q 2X2BA 4F37A 1Q86Q 2ONTA 1IMPA 2VLNA 2PENA 2N5HA 4XFYA 2K93A 4U0BA 2PNGA 3E2DA 1VKUA 1UNKA 2BHVA 3CCJP 2K0YA 5F2NA 1E6JP 3CCEP 2FQ1A 2MVUA 3LMOA 2Z46A 2GZEA 2XV6A 1AUMA 2GDYA 2KGAA 2N6ZA 1DNYA 1A8OA 5KP6B 2JGPA 1EIAA 2KW2A 2KOPA 4COPA 2QA4P 2PY8A 3P05A 3I55P 1ZMBA 3EJDA 1S72P 2KGCA 2N6YA 2MR7A 5HGLA 2M5RA 2VLQA 2MY5A
chains in the Genus database with same CATH topology
1HQBA 2LKIA 2DNWA 2EHSA 5EJDA 2KGEA 2XZ1C 2FQ2A 2CGQA 2JU2A 4PWVB 2L4BA 2N98A 4H2XC 4BPHA 1HY8A 1KLPA 2N50A 2FVEA 2MD9A 5CZDB 5KP8B 2JU1A 2L0QA 2K94A 2AF8A 2KORA 4IZ6A 2KG8A 1DV5A 2K2QA 2LL8A 1L0HA 2FADA 2GDXA 2KG9A 2AVAA 2CG5B 2LIUA 2QNWA 1OR5A 4DG9A 2LTEA 2KOSA 2K92A 3NY7B 4H2WC 3EJEA 3CE7A 2FVFA 2L9FA 1AF8A 2LMLA 2CNRA 2MR8A 2KOOA 2KWLA 2X2BA 3RG2A 2EHTA 2FACA 4BPGA 1ACPA 4CA3A 2LOLA 2N5HA 2CQ8A 4MRTC 2AFDA 2FHSC 1X3OA 2MF4A 1T8KA 2K93A 3GZLA 5HVCA 2FVAA 2PNGA 2KR5A 1VKUA 2JQ4A 2GDWA 2L22A 2K0YA 2LIWA 4NEOA 2MVVA 5KP7B 2FQ1A 2MVUA 2K0XA 4R0MA 3LMOA 1NQ4A 1L0IA 2FAEA 1F80D 2LPKA 2XZ0D 2N5IA 4BPFA 2GDYA 2ROQA 2KGAA 4HKGA 3EJBA 2N6ZA 1DNYA 2KG6A 2KOQA 2VSQA 5KP6B 2JGPA 2AFEA 2KW2A 2KOPA 2FQ0A 4PXHB 5HV8A 3EJDA 2KGCA 3GZMA 4H2YC 2N6YA 2MR7A 2M5RA 2KGDA 2MY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  2LKI A;  2DNW A;  2EHS A;  5EJD A;  2KGE A;  2XZ1 C;  2FQ2 A;  2CGQ A;  2JU2 A;  4PWV B;  2L4B A;  2N98 A;  4H2X C;  4BPH A;  1HY8 A;  1KLP A;  2N50 A;  2FVE A;  2MD9 A;  5CZD B;  5KP8 B;  2JU1 A;  2L0Q A;  2K94 A;  2AF8 A;  2KOR A;  4IZ6 A;  2KG8 A;  1DV5 A;  2K2Q A;  2LL8 A;  1L0H A;  2FAD A;  2GDX A;  2KG9 A;  2AVA A;  2CG5 B;  2LIU A;  2QNW A;  1OR5 A;  4DG9 A;  2LTE A;  2KOS A;  2K92 A;  3NY7 B;  4H2W C;  3EJE A;  3CE7 A;  2FVF A;  2L9F A;  1AF8 A;  2LML A;  2CNR A;  2MR8 A;  2KOO A;  2KWL A;  2X2B A;  3RG2 A;  2EHT A;  2FAC A;  4BPG A;  1ACP A;  4CA3 A;  2LOL A;  2N5H A;  2CQ8 A;  4MRT C;  2AFD A;  2FHS C;  1X3O A;  2MF4 A;  1T8K A;  2K93 A;  3GZL A;  5HVC A;  2FVA A;  2PNG A;  2KR5 A;  1VKU A;  2JQ4 A;  2GDW A;  2L22 A;  2K0Y A;  2LIW A;  4NEO A;  2MVV A;  5KP7 B;  2FQ1 A;  2MVU A;  2K0X A;  4R0M A;  3LMO A;  1NQ4 A;  1L0I A;  2FAE A;  1F80 D;  2LPK A;  2XZ0 D;  2N5I A;  4BPF A;  2GDY A;  2ROQ A;  2KGA A;  4HKG A;  3EJB A;  2N6Z A;  1DNY A;  2KG6 A;  2KOQ A;  2VSQ A;  5KP6 B;  2JGP A;  2AFE A;  2KW2 A;  2KOP A;  2FQ0 A;  4PXH B;  5HV8 A;  3EJD A;  2KGC A;  3GZM A;  4H2Y C;  2N6Y A;  2MR7 A;  2M5R A;  2KGD A;  2MY5 A; 
#chains in the Genus database with same CATH topology
 1HQB A;  4U0A A;  4IPY A;  1VQP P;  1YIT P;  2EHS A;  2JBG A;  4U0D A;  1K73 Q;  2FQ2 A;  2Z44 A;  2L4B A;  2N98 A;  4H2X C;  2PEI A;  1RNI A;  2XXM A;  1Q82 Q;  4XFX A;  2AF8 A;  2NO8 A;  2M8L A;  1L0H A;  3DPH A;  1M74 A;  2AVA A;  2XT1 A;  2LIU A;  5BS2 A;  2OTJ P;  2LTE A;  2KOS A;  3G26 A;  3EJE A;  2FVF A;  2L9F A;  4U0F A;  1VQL P;  5HGO A;  2LML A;  4PH1 A;  1VQ5 P;  3RG2 A;  2EHT A;  3G0V A;  4BPG A;  1QVF O;  1RO0 A;  3G6E P;  1M6N A;  1M1K Q;  1JJ2 O;  2L6E A;  2WPT A;  1YJW P;  3GZL A;  2GZI A;  5HVC A;  2FVA A;  2M8N A;  3H47 A;  5HGN A;  3DS5 A;  4XRQ A;  5KP7 B;  3G29 A;  7CEI A;  5JPA A;  2K0X A;  3CCU P;  4R0M A;  4XRO A;  1GXH A;  1F80 D;  2LPK A;  2XZ0 D;  1VQ4 P;  4BPF A;  2K5X A;  4HKG A;  3EJB A;  1EOQ A;  1YHQ P;  2KG6 A;  2VSQ A;  3CC4 P;  1N8R Q;  1AYI A;  4GR6 A;  3MGE A;  3G4S P;  3NTE A;  3CCR P;  4PH0 A;  4H2Y C;  1CEI A;  3CPW O;  3DS1 A;  2DNW A;  5F2O A;  1ZNV A;  2XZ1 C;  1A43 A;  2PEM A;  2JU2 A;  4PWV B;  3CCV P;  1YJN P;  1KLP A;  3Q20 A;  3CXC O;  5CZD B;  3DS4 A;  3CCS P;  2JU1 A;  3CCQ P;  1IUQ A;  4IZ6 A;  3WBH A;  2LL8 A;  1VQK P;  3DS3 A;  1EMV A;  2CG5 B;  1OR5 A;  2JB0 A;  1K8A Q;  4M0I A;  3NY7 B;  3VRL C;  2CNR A;  1BXI A;  2GZF A;  4CA3 A;  1BAJ A;  3H4E A;  2LOL A;  1GXG A;  1QVG O;  2CQ8 A;  2E1M A;  4MRT C;  2AFD A;  2QEX P;  1VQN P;  2MF4 A;  3DS2 A;  3GKL C;  2KOD A;  2KR5 A;  3GJN A;  2JQ4 A;  3CCM P;  3DTJ A;  2EFJ A;  3M1M A;  2OAR A;  2GDW A;  2PEO A;  2L22 A;  2LIW A;  4NEO A;  2MVV A;  2GZJ A;  4U0E A;  1FR2 A;  4QKO A;  1KD1 Q;  2JYL A;  2PEQ A;  2KOQ A;  1RO2 A;  2EIA A;  2AFE A;  3G28 A;  1W2B O;  3CC2 P;  4PXH B;  1VQ9 P;  1Z6M A;  3CMA P;  2ERH A;  3OW2 O;  3GZM A;  1VQM P;  1M6E X;  3H0D A;  4WYM A;  4U0C A;  2JAZ A;  2P9X A;  5EJD A;  1Q7Y Q;  2KGE A;  3CC7 P;  2CGQ A;  4BPH A;  2FVE A;  3U43 A;  4QNB A;  3CD6 P;  2K94 A;  5HGM A;  1E0H A;  1DV5 A;  2FAD A;  1KC8 Q;  1QRJ A;  2PEJ A;  4DG9 A;  1NJI Q;  3CME P;  3HYB A;  1YI2 P;  3CE7 A;  1AF8 A;  2MR8 A;  2KOO A;  5DCK A;  2FAC A;  1ACP A;  1KQS O;  2Z45 A;  2FHS C;  1X3O A;  1YIJ P;  1T8K A;  4GR2 A;  1VQ6 P;  1VQO P;  1Q81 Q;  3B4Q A;  1VQ8 P;  1MZ8 A;  2OTL P;  4UHP B;  2CWO A;  1YJ9 P;  2DGY A;  1UJZ A;  1NQ4 A;  1L0I A;  2FAE A;  2BUO A;  2N5I A;  2VLP A;  2ROQ A;  2EG5 A;  3RG6 C;  2K0D X;  5F2K A;  4COC A;  5BS1 A;  2FQ0 A;  5HV8 A;  1D1D A;  1IMQ A;  2GZG A;  2PEK A;  2KGD A;  2GYK A;  2JYG A;  2LKI A;  3G21 A;  1K30 A;  3G71 P;  1GPJ A;  2JO0 A;  5EW5 E;  5I4T G;  3I56 P;  1K9M Q;  1HY8 A;  2N50 A;  3HZQ A;  2MD9 A;  3LRY A;  5KP8 B;  2L0Q A;  2LF4 A;  2KOR A;  2VLO A;  2KG8 A;  3B5I A;  2K2Q A;  2M8P A;  2GDX A;  2KG9 A;  3G1I A;  2QNW A;  3DS0 A;  1VHN A;  2K92 A;  4H2W C;  1VQ7 P;  4XFZ A;  3CCL P;  3G1G A;  2KWL A;  1M90 Q;  2X2B A;  4F37 A;  1Q86 Q;  2ONT A;  1IMP A;  2VLN A;  2PEN A;  2N5H A;  4XFY A;  2K93 A;  4U0B A;  2PNG A;  3E2D A;  1VKU A;  1UNK A;  2BHV A;  3CCJ P;  2K0Y A;  5F2N A;  1E6J P;  3CCE P;  2FQ1 A;  2MVU A;  3LMO A;  2Z46 A;  2GZE A;  2XV6 A;  1AUM A;  2GDY A;  2KGA A;  2N6Z A;  1DNY A;  1A8O A;  5KP6 B;  2JGP A;  1EIA A;  2KW2 A;  2KOP A;  4COP A;  2QA4 P;  2PY8 A;  3P05 A;  3I55 P;  1ZMB A;  3EJD A;  1S72 P;  2KGC A;  2N6Y A;  2MR7 A;  5HGL A;  2M5R A;  2VLQ A;  2MY5 A; 
#chains in the Genus database with same CATH homology
 1HQB A;  2LKI A;  2DNW A;  2EHS A;  5EJD A;  2KGE A;  2XZ1 C;  2FQ2 A;  2CGQ A;  2JU2 A;  4PWV B;  2L4B A;  2N98 A;  4H2X C;  4BPH A;  1HY8 A;  1KLP A;  2N50 A;  2FVE A;  2MD9 A;  5CZD B;  5KP8 B;  2JU1 A;  2L0Q A;  2K94 A;  2AF8 A;  2KOR A;  4IZ6 A;  2KG8 A;  1DV5 A;  2K2Q A;  2LL8 A;  1L0H A;  2FAD A;  2GDX A;  2KG9 A;  2AVA A;  2CG5 B;  2LIU A;  2QNW A;  1OR5 A;  4DG9 A;  2LTE A;  2KOS A;  2K92 A;  3NY7 B;  4H2W C;  3EJE A;  3CE7 A;  2FVF A;  2L9F A;  1AF8 A;  2LML A;  2CNR A;  2MR8 A;  2KOO A;  2KWL A;  2X2B A;  3RG2 A;  2EHT A;  2FAC A;  4BPG A;  1ACP A;  4CA3 A;  2LOL A;  2N5H A;  2CQ8 A;  4MRT C;  2AFD A;  2FHS C;  1X3O A;  2MF4 A;  1T8K A;  2K93 A;  3GZL A;  5HVC A;  2FVA A;  2PNG A;  2KR5 A;  1VKU A;  2JQ4 A;  2GDW A;  2L22 A;  2K0Y A;  2LIW A;  4NEO A;  2MVV A;  5KP7 B;  2FQ1 A;  2MVU A;  2K0X A;  4R0M A;  3LMO A;  1NQ4 A;  1L0I A;  2FAE A;  1F80 D;  2LPK A;  2XZ0 D;  2N5I A;  4BPF A;  2GDY A;  2ROQ A;  2KGA A;  4HKG A;  3EJB A;  2N6Z A;  1DNY A;  2KG6 A;  2KOQ A;  2VSQ A;  5KP6 B;  2JGP A;  2AFE A;  2KW2 A;  2KOP A;  2FQ0 A;  4PXH B;  5HV8 A;  3EJD A;  2KGC A;  3GZM A;  4H2Y C;  2N6Y A;  2MR7 A;  2M5R A;  2KGD A;  2MY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...