2AFEA

Solution structure of asl1650, an acyl carrier protein from anabaena sp. pcc 7120 with a variant phosphopantetheinylation-site sequence
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Ligand binding protein
molecule keywords protein Asl1650
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2afeA00
2AF8A 2LPKA 2FAEA 5CZDB 1NQ4A 4H2YC 2LIWA 4BPHA 2KW2A 2KOPA 4H2WC 2KG8A 2XZ1C 2K93A 3LMOA 2CNRA 2AFDA 5KP8B 2JQ4A 4IZ6A 1L0IA 5KP7B 2KOOA 1DV5A 3GZMA 2FHSC 2KOQA 2FQ1A 2GDYA 4CA3A 1AF8A 2LMLA 4HKGA 2MVUA 2N5IA 2LOLA 1DNYA 2L9FA 2QNWA 2LIUA 2KGDA 2KWLA 2DNWA 3NY7B 2K92A 4NEOA 3EJEA 2JU2A 3CE7A 2JU1A 2CQ8A 4H2XC 2K94A 2KGAA 4MRTC 2L4BA 2JGPA 2KR5A 2FQ0A 2EHSA 2CGQA 2M5RA 1L0HA 2LKIA 1ACPA 2LTEA 2PNGA 2L22A 1X3OA 2N98A 2K0XA 2AFEA 2N5HA 2KOSA 1T8KA 2XZ0D 2N6ZA 2FVFA 4BPGA 2FACA 3RG2A 2MD9A 2KORA 2KGEA 5HVCA 2X2BA 2MR8A 2FADA 4PXHB 3EJDA 1KLPA 2GDXA 2FVEA 2GDWA 3GZLA 2L0QA 2MF4A 1HY8A 2LL8A 2N50A 3EJBA 4BPFA 2K2QA 2N6YA 2AVAA 4PWVB 2EHTA 2MVVA 2MR7A 2FQ2A 2K0YA 2ROQA 5HV8A 2CG5B 2FVAA 1HQBA 2KG6A 1OR5A 2VSQA 4R0MA 2KGCA 2KG9A 5EJDA 1F80D 5KP6B 1VKUA 2MY5A 4DG9A
chains in the Genus database with same CATH superfamily
1IMPA 5BS1A 1Q82Q 2AF8A 3G28A 2KODA 5HGMA 2VLQA 2FAEA 5CZDB 1QVGO 1NQ4A 4H2YC 3G29A 1VQKP 3DS0A 3DTJA 2NO8A 1KC8Q 2GZEA 1UNKA 2PY8A 2KOOA 2BUOA 2ERHA 1JJ2O 2WPTA 2Z45A 2LOLA 4M0IA 2QNWA 2LIUA 3HZQA 1VQOP 1Z6MA 2JU2A 1RO0A 3CE7A 4U0FA 2KGAA 2JGPA 2VLNA 4U0EA 3CCEP 2JO0A 1KQSO 2M5RA 3M1MA 2GZJA 5JPAA 3CXCO 1YJWP 1X3OA 2AFEA 1T8KA 4U0BA 3CMEP 2FACA 3RG2A 2PEQA 5DCKA 3EJDA 1KLPA 2PEMA 3GJNA 3H0DA 3CPWO 1GXGA 3CC4P 2N50A 1K8AQ 2N6YA 2CWOA 2MVVA 3CC2P 2FQ2A 3WBHA 3P05A 3RG6C 2K0YA 2GYKA 2FVAA 1FR2A 1OR5A 2VSQA 4COPA 4XRQA 1VQNP 2MY5A 4DG9A 1KD1Q 1VHNA 2LPKA 3H47A 2EIAA 2LIWA 2K0DX 3E2DA 3CCQP 2KW2A 4XFYA 1IUQA 7CEIA 1VQ5P 3LRYA 4QNBA 3LMOA 3CCVP 5KP8B 2LF4A 5KP7B 1DV5A 3GZMA 1AF8A 2MVUA 2N5IA 2Z46A 4XROA 2EFJA 1DNYA 3CMAP 1YITP 2DNWA 3NY7B 2PEOA 3EJEA 1NJIQ 2JYLA 2PENA 4F37A 1VQLP 1VQ6P 2OTJP 1K73Q 2FQ0A 2CGQA 3G0VA 3G1IA 5F2OA 1QVFO 2N98A 5BS2A 3CD6P 2KOSA 2GZIA 2E1MA 4BPGA 2QEXP 2PEKA 5HVCA 3DPHA 1VQPP 1E0HA 3MGEA 2GDXA 2GDWA 3DS4A 1AYIA 2MF4A 1HY8A 2LL8A 2OARA 3G4SP 1M90Q 3EJBA 4BPFA 2K2QA 4UHPB 2GZGA 1AUMA 4PWVB 1RO2A 3G6EP 3DS2A 2QA4P 3U43A 2XV6A 3H4EA 2VLOA 3HYBA 1A8OA 3CCMP 1K30A 2JB0A 1YJNP 1IMQA 1VQ4P 5F2KA 1VKUA 2L6EA 4WYMA 2M8NA 4U0AA 3DS1A 4XFXA 2KOPA 4H2WC 1VQMP 2XZ1C 3DS5A 1BAJA 1UJZA 2AFDA 2JQ4A 4IZ6A 1L0IA 2PEJA 3B5IA 2FHSC 4GR2A 2JBGA 3GKLC 4CA3A 2K92A 2JU1A 2K94A 2ONTA 1M1KQ 3OW2O 3G71P 3I55P 1L0HA 2LKIA 1ACPA 2PEIA 1Q7YQ 2L22A 4XFZA 2K0XA 2XZ0D 3Q20A 3CCLP 2M8PA 2N6ZA 1ZMBA 2KORA 3DS3A 1A43A 2DGYA 2L0QA 1EOQA 2JYGA 3CCUP 4GR6A 1E6JP 4PH1A 2MR7A 1D1DA 1YJ9P 1VQ8P 2CG5B 2JAZA 1GPJA 3G1GA 1HQBA 2GZFA 1GXHA 5HGOA 2EG5A 2P9XA 4R0MA 3G21A 1EIAA 2OTLP 3CCSP 5KP6B 2K5XA 4IPYA 4COCA 5EW5E 3CCJP 3G26A 1EMVA 4BPHA 1W2BO 2KG8A 2Z44A 3I56P 2K93A 2CNRA 4U0DA 2KOQA 2FQ1A 2GDYA 2LMLA 4HKGA 3CC7P 2XXMA 4PH0A 2L9FA 2KGDA 2KWLA 1QRJA 1YIJP 4NEOA 3CCRP 1N8RQ 2CQ8A 4H2XC 4MRTC 2L4BA 2KR5A 2EHSA 3B4QA 2XT1A 2LTEA 2PNGA 1Q81Q 3VRLC 2N5HA 1MZ8A 2FVFA 4QKOA 2MD9A 2M8LA 2KGEA 2X2BA 2MR8A 2FADA 1M6EX 1M74A 4PXHB 2FVEA 3GZLA 1VQ9P 2AVAA 4U0CA 1S72P 2EHTA 1BXIA 2BHVA 2ROQA 5HV8A 5HGNA 1M6NA 5I4TG 1YI2P 2KG6A 2VLPA 1ZNVA 1K9MQ 5F2NA 1Q86Q 2KGCA 2KG9A 5EJDA 1F80D 1YHQP 5HGLA 1CEIA 1VQ7P 1RNIA 3NTEA
chains in the Genus database with same CATH topology
2AF8A 2LPKA 2FAEA 5CZDB 1NQ4A 4H2YC 2LIWA 4BPHA 2KW2A 2KOPA 4H2WC 2KG8A 2XZ1C 2K93A 3LMOA 2CNRA 2AFDA 5KP8B 2JQ4A 4IZ6A 1L0IA 5KP7B 2KOOA 1DV5A 3GZMA 2FHSC 2KOQA 2FQ1A 2GDYA 4CA3A 1AF8A 2LMLA 4HKGA 2MVUA 2N5IA 2LOLA 1DNYA 2L9FA 2QNWA 2LIUA 2KGDA 2KWLA 2DNWA 3NY7B 2K92A 4NEOA 3EJEA 2JU2A 3CE7A 2JU1A 2CQ8A 4H2XC 2K94A 2KGAA 4MRTC 2L4BA 2JGPA 2KR5A 2FQ0A 2EHSA 2CGQA 2M5RA 1L0HA 2LKIA 1ACPA 2LTEA 2PNGA 2L22A 1X3OA 2N98A 2K0XA 2AFEA 2N5HA 2KOSA 1T8KA 2XZ0D 2N6ZA 2FVFA 4BPGA 2FACA 3RG2A 2MD9A 2KORA 2KGEA 5HVCA 2X2BA 2MR8A 2FADA 4PXHB 3EJDA 1KLPA 2GDXA 2FVEA 2GDWA 3GZLA 2L0QA 2MF4A 1HY8A 2LL8A 2N50A 3EJBA 4BPFA 2K2QA 2N6YA 2AVAA 4PWVB 2EHTA 2MVVA 2MR7A 2FQ2A 2K0YA 2ROQA 5HV8A 2CG5B 2FVAA 1HQBA 2KG6A 1OR5A 2VSQA 4R0MA 2KGCA 2KG9A 5EJDA 1F80D 5KP6B 1VKUA 2MY5A 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  2LPK A;  2FAE A;  5CZD B;  1NQ4 A;  4H2Y C;  2LIW A;  4BPH A;  2KW2 A;  2KOP A;  4H2W C;  2KG8 A;  2XZ1 C;  2K93 A;  3LMO A;  2CNR A;  2AFD A;  5KP8 B;  2JQ4 A;  4IZ6 A;  1L0I A;  5KP7 B;  2KOO A;  1DV5 A;  3GZM A;  2FHS C;  2KOQ A;  2FQ1 A;  2GDY A;  4CA3 A;  1AF8 A;  2LML A;  4HKG A;  2MVU A;  2N5I A;  2LOL A;  1DNY A;  2L9F A;  2QNW A;  2LIU A;  2KGD A;  2KWL A;  2DNW A;  3NY7 B;  2K92 A;  4NEO A;  3EJE A;  2JU2 A;  3CE7 A;  2JU1 A;  2CQ8 A;  4H2X C;  2K94 A;  2KGA A;  4MRT C;  2L4B A;  2JGP A;  2KR5 A;  2FQ0 A;  2EHS A;  2CGQ A;  2M5R A;  1L0H A;  2LKI A;  1ACP A;  2LTE A;  2PNG A;  2L22 A;  1X3O A;  2N98 A;  2K0X A;  2AFE A;  2N5H A;  2KOS A;  1T8K A;  2XZ0 D;  2N6Z A;  2FVF A;  4BPG A;  2FAC A;  3RG2 A;  2MD9 A;  2KOR A;  2KGE A;  5HVC A;  2X2B A;  2MR8 A;  2FAD A;  4PXH B;  3EJD A;  1KLP A;  2GDX A;  2FVE A;  2GDW A;  3GZL A;  2L0Q A;  2MF4 A;  1HY8 A;  2LL8 A;  2N50 A;  3EJB A;  4BPF A;  2K2Q A;  2N6Y A;  2AVA A;  4PWV B;  2EHT A;  2MVV A;  2MR7 A;  2FQ2 A;  2K0Y A;  2ROQ A;  5HV8 A;  2CG5 B;  2FVA A;  1HQB A;  2KG6 A;  1OR5 A;  2VSQ A;  4R0M A;  2KGC A;  2KG9 A;  5EJD A;  1F80 D;  5KP6 B;  1VKU A;  2MY5 A;  4DG9 A; 
#chains in the Genus database with same CATH topology
 1IMP A;  5BS1 A;  1Q82 Q;  2AF8 A;  3G28 A;  2KOD A;  5HGM A;  2VLQ A;  2FAE A;  5CZD B;  1QVG O;  1NQ4 A;  4H2Y C;  3G29 A;  1VQK P;  3DS0 A;  3DTJ A;  2NO8 A;  1KC8 Q;  2GZE A;  1UNK A;  2PY8 A;  2KOO A;  2BUO A;  2ERH A;  1JJ2 O;  2WPT A;  2Z45 A;  2LOL A;  4M0I A;  2QNW A;  2LIU A;  3HZQ A;  1VQO P;  1Z6M A;  2JU2 A;  1RO0 A;  3CE7 A;  4U0F A;  2KGA A;  2JGP A;  2VLN A;  4U0E A;  3CCE P;  2JO0 A;  1KQS O;  2M5R A;  3M1M A;  2GZJ A;  5JPA A;  3CXC O;  1YJW P;  1X3O A;  2AFE A;  1T8K A;  4U0B A;  3CME P;  2FAC A;  3RG2 A;  2PEQ A;  5DCK A;  3EJD A;  1KLP A;  2PEM A;  3GJN A;  3H0D A;  3CPW O;  1GXG A;  3CC4 P;  2N50 A;  1K8A Q;  2N6Y A;  2CWO A;  2MVV A;  3CC2 P;  2FQ2 A;  3WBH A;  3P05 A;  3RG6 C;  2K0Y A;  2GYK A;  2FVA A;  1FR2 A;  1OR5 A;  2VSQ A;  4COP A;  4XRQ A;  1VQN P;  2MY5 A;  4DG9 A;  1KD1 Q;  1VHN A;  2LPK A;  3H47 A;  2EIA A;  2LIW A;  2K0D X;  3E2D A;  3CCQ P;  2KW2 A;  4XFY A;  1IUQ A;  7CEI A;  1VQ5 P;  3LRY A;  4QNB A;  3LMO A;  3CCV P;  5KP8 B;  2LF4 A;  5KP7 B;  1DV5 A;  3GZM A;  1AF8 A;  2MVU A;  2N5I A;  2Z46 A;  4XRO A;  2EFJ A;  1DNY A;  3CMA P;  1YIT P;  2DNW A;  3NY7 B;  2PEO A;  3EJE A;  1NJI Q;  2JYL A;  2PEN A;  4F37 A;  1VQL P;  1VQ6 P;  2OTJ P;  1K73 Q;  2FQ0 A;  2CGQ A;  3G0V A;  3G1I A;  5F2O A;  1QVF O;  2N98 A;  5BS2 A;  3CD6 P;  2KOS A;  2GZI A;  2E1M A;  4BPG A;  2QEX P;  2PEK A;  5HVC A;  3DPH A;  1VQP P;  1E0H A;  3MGE A;  2GDX A;  2GDW A;  3DS4 A;  1AYI A;  2MF4 A;  1HY8 A;  2LL8 A;  2OAR A;  3G4S P;  1M90 Q;  3EJB A;  4BPF A;  2K2Q A;  4UHP B;  2GZG A;  1AUM A;  4PWV B;  1RO2 A;  3G6E P;  3DS2 A;  2QA4 P;  3U43 A;  2XV6 A;  3H4E A;  2VLO A;  3HYB A;  1A8O A;  3CCM P;  1K30 A;  2JB0 A;  1YJN P;  1IMQ A;  1VQ4 P;  5F2K A;  1VKU A;  2L6E A;  4WYM A;  2M8N A;  4U0A A;  3DS1 A;  4XFX A;  2KOP A;  4H2W C;  1VQM P;  2XZ1 C;  3DS5 A;  1BAJ A;  1UJZ A;  2AFD A;  2JQ4 A;  4IZ6 A;  1L0I A;  2PEJ A;  3B5I A;  2FHS C;  4GR2 A;  2JBG A;  3GKL C;  4CA3 A;  2K92 A;  2JU1 A;  2K94 A;  2ONT A;  1M1K Q;  3OW2 O;  3G71 P;  3I55 P;  1L0H A;  2LKI A;  1ACP A;  2PEI A;  1Q7Y Q;  2L22 A;  4XFZ A;  2K0X A;  2XZ0 D;  3Q20 A;  3CCL P;  2M8P A;  2N6Z A;  1ZMB A;  2KOR A;  3DS3 A;  1A43 A;  2DGY A;  2L0Q A;  1EOQ A;  2JYG A;  3CCU P;  4GR6 A;  1E6J P;  4PH1 A;  2MR7 A;  1D1D A;  1YJ9 P;  1VQ8 P;  2CG5 B;  2JAZ A;  1GPJ A;  3G1G A;  1HQB A;  2GZF A;  1GXH A;  5HGO A;  2EG5 A;  2P9X A;  4R0M A;  3G21 A;  1EIA A;  2OTL P;  3CCS P;  5KP6 B;  2K5X A;  4IPY A;  4COC A;  5EW5 E;  3CCJ P;  3G26 A;  1EMV A;  4BPH A;  1W2B O;  2KG8 A;  2Z44 A;  3I56 P;  2K93 A;  2CNR A;  4U0D A;  2KOQ A;  2FQ1 A;  2GDY A;  2LML A;  4HKG A;  3CC7 P;  2XXM A;  4PH0 A;  2L9F A;  2KGD A;  2KWL A;  1QRJ A;  1YIJ P;  4NEO A;  3CCR P;  1N8R Q;  2CQ8 A;  4H2X C;  4MRT C;  2L4B A;  2KR5 A;  2EHS A;  3B4Q A;  2XT1 A;  2LTE A;  2PNG A;  1Q81 Q;  3VRL C;  2N5H A;  1MZ8 A;  2FVF A;  4QKO A;  2MD9 A;  2M8L A;  2KGE A;  2X2B A;  2MR8 A;  2FAD A;  1M6E X;  1M74 A;  4PXH B;  2FVE A;  3GZL A;  1VQ9 P;  2AVA A;  4U0C A;  1S72 P;  2EHT A;  1BXI A;  2BHV A;  2ROQ A;  5HV8 A;  5HGN A;  1M6N A;  5I4T G;  1YI2 P;  2KG6 A;  2VLP A;  1ZNV A;  1K9M Q;  5F2N A;  1Q86 Q;  2KGC A;  2KG9 A;  5EJD A;  1F80 D;  1YHQ P;  5HGL A;  1CEI A;  1VQ7 P;  1RNI A;  3NTE A; 
#chains in the Genus database with same CATH homology
 2AF8 A;  2LPK A;  2FAE A;  5CZD B;  1NQ4 A;  4H2Y C;  2LIW A;  4BPH A;  2KW2 A;  2KOP A;  4H2W C;  2KG8 A;  2XZ1 C;  2K93 A;  3LMO A;  2CNR A;  2AFD A;  5KP8 B;  2JQ4 A;  4IZ6 A;  1L0I A;  5KP7 B;  2KOO A;  1DV5 A;  3GZM A;  2FHS C;  2KOQ A;  2FQ1 A;  2GDY A;  4CA3 A;  1AF8 A;  2LML A;  4HKG A;  2MVU A;  2N5I A;  2LOL A;  1DNY A;  2L9F A;  2QNW A;  2LIU A;  2KGD A;  2KWL A;  2DNW A;  3NY7 B;  2K92 A;  4NEO A;  3EJE A;  2JU2 A;  3CE7 A;  2JU1 A;  2CQ8 A;  4H2X C;  2K94 A;  2KGA A;  4MRT C;  2L4B A;  2JGP A;  2KR5 A;  2FQ0 A;  2EHS A;  2CGQ A;  2M5R A;  1L0H A;  2LKI A;  1ACP A;  2LTE A;  2PNG A;  2L22 A;  1X3O A;  2N98 A;  2K0X A;  2AFE A;  2N5H A;  2KOS A;  1T8K A;  2XZ0 D;  2N6Z A;  2FVF A;  4BPG A;  2FAC A;  3RG2 A;  2MD9 A;  2KOR A;  2KGE A;  5HVC A;  2X2B A;  2MR8 A;  2FAD A;  4PXH B;  3EJD A;  1KLP A;  2GDX A;  2FVE A;  2GDW A;  3GZL A;  2L0Q A;  2MF4 A;  1HY8 A;  2LL8 A;  2N50 A;  3EJB A;  4BPF A;  2K2Q A;  2N6Y A;  2AVA A;  4PWV B;  2EHT A;  2MVV A;  2MR7 A;  2FQ2 A;  2K0Y A;  2ROQ A;  5HV8 A;  2CG5 B;  2FVA A;  1HQB A;  2KG6 A;  1OR5 A;  2VSQ A;  4R0M A;  2KGC A;  2KG9 A;  5EJD A;  1F80 D;  5KP6 B;  1VKU A;  2MY5 A;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...