2AFEA

Solution structure of asl1650, an acyl carrier protein from anabaena sp. pcc 7120 with a variant phosphopantetheinylation-site sequence
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords protein Asl1650
publication title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence
pubmed doi rcsb
source organism Nostoc sp.
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2afeA00
4BPHA 1HY8A 2AVAA 2KGAA 2CG5B 1DV5A 1OR5A 2KGCA 2KOSA 2N98A 2M5RA 4CA3A 2FVFA 4HKGA 4BPFA 2KOOA 2MR7A 2MR8A 2KWLA 2PNGA 2X2BA 4R0MA 4H2YC 2GDYA 2XZ0D 2AFEA 4PWVB 4NEOA 2FQ2A 3GZLA 2FVEA 1NQ4A 1DNYA 2FQ0A 2MVUA 2KR5A 2LKIA 4PXHB 5KP7B 2FACA 2JU2A 2K0YA 2KOPA 3EJEA 2XZ1C 2N6ZA 2KG9A 4MRTC 2KGDA 5EJDA 2LIWA 2KW2A 2DNWA 2JGPA 5KP8B 2EHSA 2FVAA 2L0QA 2K93A 2GDWA 3GZMA 2MY5A 3LMOA 5HV8A 2K2QA 4H2XC 2VSQA 2FQ1A 2EHTA 2L4BA 3NY7B 4BPGA 5KP6B 2N5IA 2KG8A 1X3OA 5CZDB 2AFDA 5HVCA 1L0IA 4H2WC 3RG2A 2JQ4A 2KGEA 2K0XA 2K94A 2N6YA 1AF8A 2AF8A 2FHSC 1F80D 2MF4A 2QNWA 3EJDA 2LTEA 2L22A 2JU1A 1L0HA 1KLPA 1T8KA 2CNRA 2KOQA 2GDXA 4DG9A 2L9FA 1ACPA 2LMLA 2FAEA 2LPKA 3CE7A 2LL8A 1VKUA 2CGQA 2MD9A 4IZ6A 2KORA 2N5HA 2MVVA 2ROQA 2KG6A 2N50A 1HQBA 2LOLA 3EJBA 2FADA 2K92A 2LIUA 2CQ8A
chains in the Genus database with same CATH superfamily
1EMVA 2KGAA 1DV5A 4U0EA 2OTJP 2KGCA 3P05A 4HKGA 2XV6A 5DCKA 2LF4A 2MR7A 5EW5E 3CXCO 2PEQA 3OW2O 4WYMA 1IMPA 4IPYA 2X2BA 2PNGA 1K8AQ 1A43A 3DPHA 4GR2A 1S72P 4PWVB 3G4SP 4NEOA 3GZLA 3G29A 1NQ4A 2PEKA 3CCLP 4PXHB 2FACA 4XFYA 2E1MA 3CMAP 3E2DA 3EJEA 2OARA 1MZ8A 2KODA 5F2KA 2L0QA 1IMQA 2JAZA 1VQLP 1RO0A 1GXHA 3CCMP 2XT1A 3CD6P 1BAJA 2BHVA 3H0DA 2DGYA 5BS2A 1K9MQ 2VLPA 5CZDB 1VQ7P 1VQ9P 2JQ4A 5BS1A 1E0HA 2N6YA 1AF8A 2JYGA 2EG5A 3CMEP 2JU1A 1L0HA 4QKOA 5HGMA 1K30A 3DTJA 4M0IA 2KOQA 2L9FA 4XFXA 2LPKA 4IZ6A 3CCQP 1VQKP 1HQBA 2LOLA 3DS2A 4U0BA 2GZGA 4UHPB 4BPHA 2AVAA 1AYIA 2CG5B 1E6JP 1OR5A 2KOSA 2L6EA 2N98A 2M5RA 3G1IA 4U0AA 2FVFA 4U0FA 3DS4A 4XRQA 1Q7YQ 2KWLA 1GPJA 1QVGO 2XZ0D 1YHQP 2PEOA 1AUMA 2M8PA 1VQ5P 1VQNP 1GXGA 1Q86Q 5KP7B 3B5IA 1YIJP 2PEIA 2K0YA 3CC7P 3I55P 1CEIA 5EJDA 2P9XA 2LIWA 3DS0A 4XROA 2EFJA 3B4QA 5HGNA 3LMOA 1VHNA 3H4EA 2EHTA 5F2OA 3NY7B 3NTEA 5KP6B 2N5IA 1X3OA 3GKLC 2JB0A 1EIAA 1YJWP 5JPAA 1D1DA 2AFDA 2JO0A 5HVCA 1UJZA 3WBHA 1VQ8P 1VQ6P 1M6NA 5HGLA 3CCUP 1FR2A 2EIAA 3G0VA 1KD1Q 2FHSC 1UNKA 1JJ2O 2LTEA 1KLPA 1T8KA 2CNRA 1VKUA 4U0CA 4PH1A 2N5HA 2ROQA 4PH0A 2KG6A 3EJBA 3HYBA 2FADA 2Z44A 3G1GA 7CEIA 2M8LA 4COCA 2PY8A 1QVFO 2PEMA 2NO8A 4BPFA 2KOOA 2JYLA 2M8NA 4R0MA 2GZIA 3DS5A 3DS3A 2PEJA 1NJIQ 2Z46A 3RG6C 1KC8Q 3CC4P 2FQ0A 2MVUA 1N8RQ 3CCEP 2GZFA 2VLNA 2KOPA 4U0DA 3CCSP 1YITP 4MRTC 2KGDA 1VQOP 3HZQA 2JGPA 2VLOA 2FVAA 3GZMA 2MY5A 2K2QA 4H2XC 4QNBA 2L4BA 3I56P 1EOQA 2WPTA 2QEXP 2GYKA 2OTLP 3DS1A 3CCVP 3RG2A 2VLQA 2XXMA 1RNIA 2K0XA 3G71P 2K0DX 1QRJA 5F2NA 2AF8A 1Q81Q 5I4TG 3CPWO 2GDXA 4DG9A 2LMLA 3G26A 3VRLC 2FAEA 3CE7A 2LL8A 3M1MA 2CGQA 3CCRP 2MD9A 2KORA 2MVVA 3H47A 3G21A 1ZNVA 3CC2P 2ERHA 1M90Q 2K92A 1IUQA 2CQ8A 1HY8A 2Z45A 1Q82Q 1W2BO 2GZEA 4CA3A 1KQSO 3GJNA 1YJ9P 1ZMBA 1M1KQ 2MR8A 4H2YC 2GDYA 2AFEA 1M74A 1BXIA 4COPA 2FQ2A 2ONTA 2FVEA 2GZJA 1DNYA 3MGEA 2KR5A 2LKIA 1VQMP 2JU2A 3U43A 2XZ1C 2N6ZA 2KG9A 3Q20A 2KW2A 2DNWA 5KP8B 1Z6MA 2EHSA 1YI2P 2CWOA 2K93A 2PENA 2GDWA 2BUOA 5HV8A 2JBGA 1M6EX 2VSQA 2FQ1A 3CCJP 3G6EP 4BPGA 2KG8A 1L0IA 4GR6A 4H2WC 2KGEA 1RO2A 1K73Q 2K94A 5HGOA 3EJDA 1F80D 2MF4A 2QNWA 1YJNP 2L22A 2QA4P 1ACPA 1VQPP 3LRYA 1VQ4P 4XFZA 3G28A 4F37A 2N50A 1A8OA 2K5XA 2LIUA
chains in the Genus database with same CATH topology
4BPHA 1HY8A 2AVAA 2KGAA 2CG5B 1DV5A 1OR5A 2KGCA 2KOSA 2N98A 2M5RA 4CA3A 2FVFA 4HKGA 4BPFA 2KOOA 2MR7A 2MR8A 2KWLA 2PNGA 2X2BA 4R0MA 4H2YC 2GDYA 2XZ0D 2AFEA 4PWVB 4NEOA 2FQ2A 3GZLA 2FVEA 1NQ4A 1DNYA 2FQ0A 2MVUA 2KR5A 2LKIA 4PXHB 5KP7B 2FACA 2JU2A 2K0YA 2KOPA 3EJEA 2XZ1C 2N6ZA 2KG9A 4MRTC 2KGDA 5EJDA 2LIWA 2KW2A 2DNWA 2JGPA 5KP8B 2EHSA 2FVAA 2L0QA 2K93A 2GDWA 3GZMA 2MY5A 3LMOA 5HV8A 2K2QA 4H2XC 2VSQA 2FQ1A 2EHTA 2L4BA 3NY7B 4BPGA 5KP6B 2N5IA 2KG8A 1X3OA 5CZDB 2AFDA 5HVCA 1L0IA 4H2WC 3RG2A 2JQ4A 2KGEA 2K0XA 2K94A 2N6YA 1AF8A 2AF8A 2FHSC 1F80D 2MF4A 2QNWA 3EJDA 2LTEA 2L22A 2JU1A 1L0HA 1KLPA 1T8KA 2CNRA 2KOQA 2GDXA 4DG9A 2L9FA 1ACPA 2LMLA 2FAEA 2LPKA 3CE7A 2LL8A 1VKUA 2CGQA 2MD9A 4IZ6A 2KORA 2N5HA 2MVVA 2ROQA 2KG6A 2N50A 1HQBA 2LOLA 3EJBA 2FADA 2K92A 2LIUA 2CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPH A;  1HY8 A;  2AVA A;  2KGA A;  2CG5 B;  1DV5 A;  1OR5 A;  2KGC A;  2KOS A;  2N98 A;  2M5R A;  4CA3 A;  2FVF A;  4HKG A;  4BPF A;  2KOO A;  2MR7 A;  2MR8 A;  2KWL A;  2PNG A;  2X2B A;  4R0M A;  4H2Y C;  2GDY A;  2XZ0 D;  2AFE A;  4PWV B;  4NEO A;  2FQ2 A;  3GZL A;  2FVE A;  1NQ4 A;  1DNY A;  2FQ0 A;  2MVU A;  2KR5 A;  2LKI A;  4PXH B;  5KP7 B;  2FAC A;  2JU2 A;  2K0Y A;  2KOP A;  3EJE A;  2XZ1 C;  2N6Z A;  2KG9 A;  4MRT C;  2KGD A;  5EJD A;  2LIW A;  2KW2 A;  2DNW A;  2JGP A;  5KP8 B;  2EHS A;  2FVA A;  2L0Q A;  2K93 A;  2GDW A;  3GZM A;  2MY5 A;  3LMO A;  5HV8 A;  2K2Q A;  4H2X C;  2VSQ A;  2FQ1 A;  2EHT A;  2L4B A;  3NY7 B;  4BPG A;  5KP6 B;  2N5I A;  2KG8 A;  1X3O A;  5CZD B;  2AFD A;  5HVC A;  1L0I A;  4H2W C;  3RG2 A;  2JQ4 A;  2KGE A;  2K0X A;  2K94 A;  2N6Y A;  1AF8 A;  2AF8 A;  2FHS C;  1F80 D;  2MF4 A;  2QNW A;  3EJD A;  2LTE A;  2L22 A;  2JU1 A;  1L0H A;  1KLP A;  1T8K A;  2CNR A;  2KOQ A;  2GDX A;  4DG9 A;  2L9F A;  1ACP A;  2LML A;  2FAE A;  2LPK A;  3CE7 A;  2LL8 A;  1VKU A;  2CGQ A;  2MD9 A;  4IZ6 A;  2KOR A;  2N5H A;  2MVV A;  2ROQ A;  2KG6 A;  2N50 A;  1HQB A;  2LOL A;  3EJB A;  2FAD A;  2K92 A;  2LIU A;  2CQ8 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  2KGA A;  1DV5 A;  4U0E A;  2OTJ P;  2KGC A;  3P05 A;  4HKG A;  2XV6 A;  5DCK A;  2LF4 A;  2MR7 A;  5EW5 E;  3CXC O;  2PEQ A;  3OW2 O;  4WYM A;  1IMP A;  4IPY A;  2X2B A;  2PNG A;  1K8A Q;  1A43 A;  3DPH A;  4GR2 A;  1S72 P;  4PWV B;  3G4S P;  4NEO A;  3GZL A;  3G29 A;  1NQ4 A;  2PEK A;  3CCL P;  4PXH B;  2FAC A;  4XFY A;  2E1M A;  3CMA P;  3E2D A;  3EJE A;  2OAR A;  1MZ8 A;  2KOD A;  5F2K A;  2L0Q A;  1IMQ A;  2JAZ A;  1VQL P;  1RO0 A;  1GXH A;  3CCM P;  2XT1 A;  3CD6 P;  1BAJ A;  2BHV A;  3H0D A;  2DGY A;  5BS2 A;  1K9M Q;  2VLP A;  5CZD B;  1VQ7 P;  1VQ9 P;  2JQ4 A;  5BS1 A;  1E0H A;  2N6Y A;  1AF8 A;  2JYG A;  2EG5 A;  3CME P;  2JU1 A;  1L0H A;  4QKO A;  5HGM A;  1K30 A;  3DTJ A;  4M0I A;  2KOQ A;  2L9F A;  4XFX A;  2LPK A;  4IZ6 A;  3CCQ P;  1VQK P;  1HQB A;  2LOL A;  3DS2 A;  4U0B A;  2GZG A;  4UHP B;  4BPH A;  2AVA A;  1AYI A;  2CG5 B;  1E6J P;  1OR5 A;  2KOS A;  2L6E A;  2N98 A;  2M5R A;  3G1I A;  4U0A A;  2FVF A;  4U0F A;  3DS4 A;  4XRQ A;  1Q7Y Q;  2KWL A;  1GPJ A;  1QVG O;  2XZ0 D;  1YHQ P;  2PEO A;  1AUM A;  2M8P A;  1VQ5 P;  1VQN P;  1GXG A;  1Q86 Q;  5KP7 B;  3B5I A;  1YIJ P;  2PEI A;  2K0Y A;  3CC7 P;  3I55 P;  1CEI A;  5EJD A;  2P9X A;  2LIW A;  3DS0 A;  4XRO A;  2EFJ A;  3B4Q A;  5HGN A;  3LMO A;  1VHN A;  3H4E A;  2EHT A;  5F2O A;  3NY7 B;  3NTE A;  5KP6 B;  2N5I A;  1X3O A;  3GKL C;  2JB0 A;  1EIA A;  1YJW P;  5JPA A;  1D1D A;  2AFD A;  2JO0 A;  5HVC A;  1UJZ A;  3WBH A;  1VQ8 P;  1VQ6 P;  1M6N A;  5HGL A;  3CCU P;  1FR2 A;  2EIA A;  3G0V A;  1KD1 Q;  2FHS C;  1UNK A;  1JJ2 O;  2LTE A;  1KLP A;  1T8K A;  2CNR A;  1VKU A;  4U0C A;  4PH1 A;  2N5H A;  2ROQ A;  4PH0 A;  2KG6 A;  3EJB A;  3HYB A;  2FAD A;  2Z44 A;  3G1G A;  7CEI A;  2M8L A;  4COC A;  2PY8 A;  1QVF O;  2PEM A;  2NO8 A;  4BPF A;  2KOO A;  2JYL A;  2M8N A;  4R0M A;  2GZI A;  3DS5 A;  3DS3 A;  2PEJ A;  1NJI Q;  2Z46 A;  3RG6 C;  1KC8 Q;  3CC4 P;  2FQ0 A;  2MVU A;  1N8R Q;  3CCE P;  2GZF A;  2VLN A;  2KOP A;  4U0D A;  3CCS P;  1YIT P;  4MRT C;  2KGD A;  1VQO P;  3HZQ A;  2JGP A;  2VLO A;  2FVA A;  3GZM A;  2MY5 A;  2K2Q A;  4H2X C;  4QNB A;  2L4B A;  3I56 P;  1EOQ A;  2WPT A;  2QEX P;  2GYK A;  2OTL P;  3DS1 A;  3CCV P;  3RG2 A;  2VLQ A;  2XXM A;  1RNI A;  2K0X A;  3G71 P;  2K0D X;  1QRJ A;  5F2N A;  2AF8 A;  1Q81 Q;  5I4T G;  3CPW O;  2GDX A;  4DG9 A;  2LML A;  3G26 A;  3VRL C;  2FAE A;  3CE7 A;  2LL8 A;  3M1M A;  2CGQ A;  3CCR P;  2MD9 A;  2KOR A;  2MVV A;  3H47 A;  3G21 A;  1ZNV A;  3CC2 P;  2ERH A;  1M90 Q;  2K92 A;  1IUQ A;  2CQ8 A;  1HY8 A;  2Z45 A;  1Q82 Q;  1W2B O;  2GZE A;  4CA3 A;  1KQS O;  3GJN A;  1YJ9 P;  1ZMB A;  1M1K Q;  2MR8 A;  4H2Y C;  2GDY A;  2AFE A;  1M74 A;  1BXI A;  4COP A;  2FQ2 A;  2ONT A;  2FVE A;  2GZJ A;  1DNY A;  3MGE A;  2KR5 A;  2LKI A;  1VQM P;  2JU2 A;  3U43 A;  2XZ1 C;  2N6Z A;  2KG9 A;  3Q20 A;  2KW2 A;  2DNW A;  5KP8 B;  1Z6M A;  2EHS A;  1YI2 P;  2CWO A;  2K93 A;  2PEN A;  2GDW A;  2BUO A;  5HV8 A;  2JBG A;  1M6E X;  2VSQ A;  2FQ1 A;  3CCJ P;  3G6E P;  4BPG A;  2KG8 A;  1L0I A;  4GR6 A;  4H2W C;  2KGE A;  1RO2 A;  1K73 Q;  2K94 A;  5HGO A;  3EJD A;  1F80 D;  2MF4 A;  2QNW A;  1YJN P;  2L22 A;  2QA4 P;  1ACP A;  1VQP P;  3LRY A;  1VQ4 P;  4XFZ A;  3G28 A;  4F37 A;  2N50 A;  1A8O A;  2K5X A;  2LIU A; 
#chains in the Genus database with same CATH homology
 4BPH A;  1HY8 A;  2AVA A;  2KGA A;  2CG5 B;  1DV5 A;  1OR5 A;  2KGC A;  2KOS A;  2N98 A;  2M5R A;  4CA3 A;  2FVF A;  4HKG A;  4BPF A;  2KOO A;  2MR7 A;  2MR8 A;  2KWL A;  2PNG A;  2X2B A;  4R0M A;  4H2Y C;  2GDY A;  2XZ0 D;  2AFE A;  4PWV B;  4NEO A;  2FQ2 A;  3GZL A;  2FVE A;  1NQ4 A;  1DNY A;  2FQ0 A;  2MVU A;  2KR5 A;  2LKI A;  4PXH B;  5KP7 B;  2FAC A;  2JU2 A;  2K0Y A;  2KOP A;  3EJE A;  2XZ1 C;  2N6Z A;  2KG9 A;  4MRT C;  2KGD A;  5EJD A;  2LIW A;  2KW2 A;  2DNW A;  2JGP A;  5KP8 B;  2EHS A;  2FVA A;  2L0Q A;  2K93 A;  2GDW A;  3GZM A;  2MY5 A;  3LMO A;  5HV8 A;  2K2Q A;  4H2X C;  2VSQ A;  2FQ1 A;  2EHT A;  2L4B A;  3NY7 B;  4BPG A;  5KP6 B;  2N5I A;  2KG8 A;  1X3O A;  5CZD B;  2AFD A;  5HVC A;  1L0I A;  4H2W C;  3RG2 A;  2JQ4 A;  2KGE A;  2K0X A;  2K94 A;  2N6Y A;  1AF8 A;  2AF8 A;  2FHS C;  1F80 D;  2MF4 A;  2QNW A;  3EJD A;  2LTE A;  2L22 A;  2JU1 A;  1L0H A;  1KLP A;  1T8K A;  2CNR A;  2KOQ A;  2GDX A;  4DG9 A;  2L9F A;  1ACP A;  2LML A;  2FAE A;  2LPK A;  3CE7 A;  2LL8 A;  1VKU A;  2CGQ A;  2MD9 A;  4IZ6 A;  2KOR A;  2N5H A;  2MVV A;  2ROQ A;  2KG6 A;  2N50 A;  1HQB A;  2LOL A;  3EJB A;  2FAD A;  2K92 A;  2LIU A;  2CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...