2AFEA

Solution structure of asl1650, an acyl carrier protein from anabaena sp. pcc 7120 with a variant phosphopantetheinylation-site sequence
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
88
structure length
88
Chain Sequence
b'GSHMKTIQPASVEDIQSWLIDQFAQQLDVDPDDIDMEESFDNYDLNSSKALILLGRLEKWLGKELNPVLIFNYPTIAQLAKRLGELYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Asl1650
publication title Solution structure of Asl1650, an acyl carrier protein from Anabaena sp. PCC 7120 with a variant phosphopantetheinylation-site sequence
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Ligand binding protein
total genus 25
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2afeA00
2FADA 2KOQA 1OR5A 2FVFA 2MR7A 4BPHA 2FVAA 5KP7B 2K93A 2CGQA 2GDXA 2LMLA 2K94A 1DNYA 2K92A 1F80D 5KP6B 3EJBA 2CG5B 4CA3A 2KGAA 3RG2A 2GDYA 2QNWA 5KP8B 2N5IA 2N50A 2MR8A 2KORA 2GDWA 3GZLA 2AVAA 2LIUA 2KGCA 1AF8A 2MVUA 2N6YA 1VKUA 2JQ4A 2K2QA 1L0IA 4H2YC 2FACA 4H2XC 2CQ8A 2KGDA 2KR5A 1T8KA 5HVCA 2M5RA 2KWLA 2L0QA 2CNRA 3NY7B 2JGPA 2N5HA 2KGEA 2AFEA 3EJEA 2KW2A 5CZDB 2KG9A 1NQ4A 1X3OA 2EHSA 2KOPA 2X2BA 2AFDA 2FQ0A 2EHTA 2FAEA 2FHSC 2N98A 1HQBA 2PNGA 2DNWA 2LTEA 2XZ1C 2LL8A 2LPKA 2AF8A 2JU1A 2L22A 3GZMA 2VSQA 3LMOA 2ROQA 1KLPA 3CE7A 2N6ZA 2XZ0D 2L9FA 2MF4A 5HV8A 1DV5A 1HY8A 2LOLA 2MVVA 2KOSA 5EJDA 4PXHB 2L4BA 1L0HA 4IZ6A 2KG8A 4PWVB 2KG6A 2JU2A 2K0XA 4BPFA 4HKGA 1ACPA 4BPGA 2LIWA 2LKIA 2MD9A 4H2WC 2K0YA 2FVEA 4DG9A 2MY5A 2FQ2A 4NEOA 2FQ1A 3EJDA 4MRTC 2KOOA 4R0MA
chains in the Genus database with same CATH superfamily
2FADA 2BHVA 2VLQA 2GZEA 3MGEA 2QEXP 2MR7A 4BPHA 1Z6MA 2FVAA 1YI2P 2LMLA 2Z45A 2PENA 1W2BO 2EG5A 3CCJP 2JB0A 2KGAA 2VLNA 1K8AQ 2GDYA 2QNWA 5KP8B 3H0DA 2GZIA 1ZMBA 5EW5E 2MR8A 2GDWA 4UHPB 3OW2O 2M8LA 1L0IA 2GZGA 2CQ8A 2KGDA 5HVCA 2OARA 3VRLC 1M90Q 3CPWO 3Q20A 2JGPA 2N5HA 2AFEA 5CZDB 1NQ4A 2EHSA 2KOPA 4GR6A 1M6NA 3CCMP 3G0VA 2FHSC 2JO0A 2DNWA 3DS2A 2LTEA 2DGYA 1A43A 3GZMA 1VQ7P 1KLPA 1YJNP 3CD6P 3H4EA 3B5IA 1IUQA 3CC4P 7CEIA 5HV8A 1HY8A 2GYKA 1K73Q 2KOSA 4U0DA 5EJDA 3RG6C 5F2KA 4PXHB 2PEIA 2KG8A 2JU2A 5I4TG 1ACPA 1JJ2O 2LF4A 2MY5A 1ZNVA 3CXCO 2NO8A 4U0AA 1VQLP 3I56P 2KOOA 2KOQA 1VHNA 3G71P 1OR5A 3G6EP 4COPA 2K93A 1E0HA 2CGQA 1BXIA 1M6EX 3LRYA 4XFZA 2JYGA 3P05A 1UJZA 5KP6B 4M0IA 2CG5B 3G26A 3CCLP 2PEMA 2K5XA 2M8NA 2N50A 2BUOA 3GZLA 2N6YA 3DPHA 2XV6A 1GXHA 1M74A 2KWLA 2L0QA 1VQPP 2PEKA 2KG9A 2P9XA 2X2BA 3B4QA 4COCA 2FQ0A 4QKOA 2L6EA 2PY8A 2XZ1C 1EOQA 2LPKA 2JU1A 2ROQA 3G1GA 3G1IA 2N6ZA 1Q7YQ 3GJNA 3HZQA 3CCSP 1DV5A 3E2DA 2EFJA 1L0HA 2OTLP 3DS0A 5BS2A 3NTEA 2M8PA 1K9MQ 1MZ8A 2GZFA 2LIWA 4GR2A 2PEQA 1Q82Q 2FVEA 2VLPA 5DCKA 1YHQP 5F2NA 1YJWP 2JBGA 3CC2P 4WYMA 1DNYA 1F80D 1GXGA 1N8RQ 3G29A 1AYIA 5JPAA 3RG2A 1BAJA 2XXMA 2N5IA 1KC8Q 3I55P 2KORA 1RNIA 3G28A 1YJ9P 2KGCA 1YIJP 2MVUA 1VQKP 1VKUA 1K30A 2JQ4A 2FACA 4H2XC 3DS5A 2ONTA 2KR5A 1T8KA 2CNRA 2KGEA 2QA4P 2KW2A 2AFDA 1VQ8P 2FAEA 2N98A 1HQBA 1CEIA 4F37A 5HGMA 3WBHA 1EIAA 3CCQP 2AF8A 4U0BA 2L22A 3LMOA 2VSQA 1VQ4P 3CE7A 4XFXA 1RO2A 2XZ0D 3CCEP 1S72P 2L9FA 4IPYA 2Z44A 2LOLA 2MVVA 3DTJA 1KD1Q 5HGOA 4XFYA 2L4BA 1KQSO 4PWVB 1QVGO 5HGNA 1AUMA 4BPFA 4BPGA 4XRQA 2LKIA 1IMPA 2MD9A 2Z46A 3CC7P 1D1DA 2K0YA 1M1KQ 2PEOA 2FQ2A 4NEOA 4U0CA 3H47A 4PH0A 2K92A 1VQMP 5HGLA 2FVFA 4XROA 1QVFO 5F2OA 5KP7B 1NJIQ 2GDXA 4QNBA 2K94A 1VQ5P 3EJBA 1VQ6P 4CA3A 3CCRP 1IMQA 1VQNP 1Q86Q 3CMEP 1QRJA 2K0DX 2AVAA 2LIUA 4U0EA 1AF8A 3GKLC 2VLOA 2K2QA 3DS1A 4H2YC 3CCUP 2XT1A 1EMVA 4U0FA 3CMAP 2E1MA 2JYLA 2M5RA 2EIAA 1E6JP 3NY7B 3EJEA 3DS4A 1X3OA 2CWOA 3G21A 2EHTA 1GPJA 3G4SP 2JAZA 2PNGA 1UNKA 2GZJA 2LL8A 3M1MA 3DS3A 1YITP 3U43A 2ERHA 2MF4A 2KODA 2WPTA 4IZ6A 1VQOP 2KG6A 1A8OA 2K0XA 2PEJA 4HKGA 1VQ9P 2OTJP 4H2WC 4DG9A 1Q81Q 3CCVP 1RO0A 2FQ1A 3EJDA 3HYBA 4MRTC 1FR2A 4PH1A 4R0MA 5BS1A
chains in the Genus database with same CATH topology
2FADA 2KOQA 1OR5A 2FVFA 2MR7A 4BPHA 2FVAA 5KP7B 2K93A 2CGQA 2GDXA 2LMLA 2K94A 1DNYA 2K92A 1F80D 5KP6B 3EJBA 2CG5B 4CA3A 2KGAA 3RG2A 2GDYA 2QNWA 5KP8B 2N5IA 2N50A 2MR8A 2KORA 2GDWA 3GZLA 2AVAA 2LIUA 2KGCA 1AF8A 2MVUA 2N6YA 1VKUA 2JQ4A 2K2QA 1L0IA 4H2YC 2FACA 4H2XC 2CQ8A 2KGDA 2KR5A 1T8KA 5HVCA 2M5RA 2KWLA 2L0QA 2CNRA 3NY7B 2JGPA 2N5HA 2KGEA 2AFEA 3EJEA 2KW2A 5CZDB 2KG9A 1NQ4A 1X3OA 2EHSA 2KOPA 2X2BA 2AFDA 2FQ0A 2EHTA 2FAEA 2FHSC 2N98A 1HQBA 2PNGA 2DNWA 2LTEA 2XZ1C 2LL8A 2LPKA 2AF8A 2JU1A 2L22A 3GZMA 2VSQA 3LMOA 2ROQA 1KLPA 3CE7A 2N6ZA 2XZ0D 2L9FA 2MF4A 5HV8A 1DV5A 1HY8A 2LOLA 2MVVA 2KOSA 5EJDA 4PXHB 2L4BA 1L0HA 4IZ6A 2KG8A 4PWVB 2KG6A 2JU2A 2K0XA 4BPFA 4HKGA 1ACPA 4BPGA 2LIWA 2LKIA 2MD9A 4H2WC 2K0YA 2FVEA 4DG9A 2MY5A 2FQ2A 4NEOA 2FQ1A 3EJDA 4MRTC 2KOOA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2KOQ A;  1OR5 A;  2FVF A;  2MR7 A;  4BPH A;  2FVA A;  5KP7 B;  2K93 A;  2CGQ A;  2GDX A;  2LML A;  2K94 A;  1DNY A;  2K92 A;  1F80 D;  5KP6 B;  3EJB A;  2CG5 B;  4CA3 A;  2KGA A;  3RG2 A;  2GDY A;  2QNW A;  5KP8 B;  2N5I A;  2N50 A;  2MR8 A;  2KOR A;  2GDW A;  3GZL A;  2AVA A;  2LIU A;  2KGC A;  1AF8 A;  2MVU A;  2N6Y A;  1VKU A;  2JQ4 A;  2K2Q A;  1L0I A;  4H2Y C;  2FAC A;  4H2X C;  2CQ8 A;  2KGD A;  2KR5 A;  1T8K A;  5HVC A;  2M5R A;  2KWL A;  2L0Q A;  2CNR A;  3NY7 B;  2JGP A;  2N5H A;  2KGE A;  2AFE A;  3EJE A;  2KW2 A;  5CZD B;  2KG9 A;  1NQ4 A;  1X3O A;  2EHS A;  2KOP A;  2X2B A;  2AFD A;  2FQ0 A;  2EHT A;  2FAE A;  2FHS C;  2N98 A;  1HQB A;  2PNG A;  2DNW A;  2LTE A;  2XZ1 C;  2LL8 A;  2LPK A;  2AF8 A;  2JU1 A;  2L22 A;  3GZM A;  2VSQ A;  3LMO A;  2ROQ A;  1KLP A;  3CE7 A;  2N6Z A;  2XZ0 D;  2L9F A;  2MF4 A;  5HV8 A;  1DV5 A;  1HY8 A;  2LOL A;  2MVV A;  2KOS A;  5EJD A;  4PXH B;  2L4B A;  1L0H A;  4IZ6 A;  2KG8 A;  4PWV B;  2KG6 A;  2JU2 A;  2K0X A;  4BPF A;  4HKG A;  1ACP A;  4BPG A;  2LIW A;  2LKI A;  2MD9 A;  4H2W C;  2K0Y A;  2FVE A;  4DG9 A;  2MY5 A;  2FQ2 A;  4NEO A;  2FQ1 A;  3EJD A;  4MRT C;  2KOO A;  4R0M A; 
#chains in the Genus database with same CATH topology
 2FAD A;  2BHV A;  2VLQ A;  2GZE A;  3MGE A;  2QEX P;  2MR7 A;  4BPH A;  1Z6M A;  2FVA A;  1YI2 P;  2LML A;  2Z45 A;  2PEN A;  1W2B O;  2EG5 A;  3CCJ P;  2JB0 A;  2KGA A;  2VLN A;  1K8A Q;  2GDY A;  2QNW A;  5KP8 B;  3H0D A;  2GZI A;  1ZMB A;  5EW5 E;  2MR8 A;  2GDW A;  4UHP B;  3OW2 O;  2M8L A;  1L0I A;  2GZG A;  2CQ8 A;  2KGD A;  5HVC A;  2OAR A;  3VRL C;  1M90 Q;  3CPW O;  3Q20 A;  2JGP A;  2N5H A;  2AFE A;  5CZD B;  1NQ4 A;  2EHS A;  2KOP A;  4GR6 A;  1M6N A;  3CCM P;  3G0V A;  2FHS C;  2JO0 A;  2DNW A;  3DS2 A;  2LTE A;  2DGY A;  1A43 A;  3GZM A;  1VQ7 P;  1KLP A;  1YJN P;  3CD6 P;  3H4E A;  3B5I A;  1IUQ A;  3CC4 P;  7CEI A;  5HV8 A;  1HY8 A;  2GYK A;  1K73 Q;  2KOS A;  4U0D A;  5EJD A;  3RG6 C;  5F2K A;  4PXH B;  2PEI A;  2KG8 A;  2JU2 A;  5I4T G;  1ACP A;  1JJ2 O;  2LF4 A;  2MY5 A;  1ZNV A;  3CXC O;  2NO8 A;  4U0A A;  1VQL P;  3I56 P;  2KOO A;  2KOQ A;  1VHN A;  3G71 P;  1OR5 A;  3G6E P;  4COP A;  2K93 A;  1E0H A;  2CGQ A;  1BXI A;  1M6E X;  3LRY A;  4XFZ A;  2JYG A;  3P05 A;  1UJZ A;  5KP6 B;  4M0I A;  2CG5 B;  3G26 A;  3CCL P;  2PEM A;  2K5X A;  2M8N A;  2N50 A;  2BUO A;  3GZL A;  2N6Y A;  3DPH A;  2XV6 A;  1GXH A;  1M74 A;  2KWL A;  2L0Q A;  1VQP P;  2PEK A;  2KG9 A;  2P9X A;  2X2B A;  3B4Q A;  4COC A;  2FQ0 A;  4QKO A;  2L6E A;  2PY8 A;  2XZ1 C;  1EOQ A;  2LPK A;  2JU1 A;  2ROQ A;  3G1G A;  3G1I A;  2N6Z A;  1Q7Y Q;  3GJN A;  3HZQ A;  3CCS P;  1DV5 A;  3E2D A;  2EFJ A;  1L0H A;  2OTL P;  3DS0 A;  5BS2 A;  3NTE A;  2M8P A;  1K9M Q;  1MZ8 A;  2GZF A;  2LIW A;  4GR2 A;  2PEQ A;  1Q82 Q;  2FVE A;  2VLP A;  5DCK A;  1YHQ P;  5F2N A;  1YJW P;  2JBG A;  3CC2 P;  4WYM A;  1DNY A;  1F80 D;  1GXG A;  1N8R Q;  3G29 A;  1AYI A;  5JPA A;  3RG2 A;  1BAJ A;  2XXM A;  2N5I A;  1KC8 Q;  3I55 P;  2KOR A;  1RNI A;  3G28 A;  1YJ9 P;  2KGC A;  1YIJ P;  2MVU A;  1VQK P;  1VKU A;  1K30 A;  2JQ4 A;  2FAC A;  4H2X C;  3DS5 A;  2ONT A;  2KR5 A;  1T8K A;  2CNR A;  2KGE A;  2QA4 P;  2KW2 A;  2AFD A;  1VQ8 P;  2FAE A;  2N98 A;  1HQB A;  1CEI A;  4F37 A;  5HGM A;  3WBH A;  1EIA A;  3CCQ P;  2AF8 A;  4U0B A;  2L22 A;  3LMO A;  2VSQ A;  1VQ4 P;  3CE7 A;  4XFX A;  1RO2 A;  2XZ0 D;  3CCE P;  1S72 P;  2L9F A;  4IPY A;  2Z44 A;  2LOL A;  2MVV A;  3DTJ A;  1KD1 Q;  5HGO A;  4XFY A;  2L4B A;  1KQS O;  4PWV B;  1QVG O;  5HGN A;  1AUM A;  4BPF A;  4BPG A;  4XRQ A;  2LKI A;  1IMP A;  2MD9 A;  2Z46 A;  3CC7 P;  1D1D A;  2K0Y A;  1M1K Q;  2PEO A;  2FQ2 A;  4NEO A;  4U0C A;  3H47 A;  4PH0 A;  2K92 A;  1VQM P;  5HGL A;  2FVF A;  4XRO A;  1QVF O;  5F2O A;  5KP7 B;  1NJI Q;  2GDX A;  4QNB A;  2K94 A;  1VQ5 P;  3EJB A;  1VQ6 P;  4CA3 A;  3CCR P;  1IMQ A;  1VQN P;  1Q86 Q;  3CME P;  1QRJ A;  2K0D X;  2AVA A;  2LIU A;  4U0E A;  1AF8 A;  3GKL C;  2VLO A;  2K2Q A;  3DS1 A;  4H2Y C;  3CCU P;  2XT1 A;  1EMV A;  4U0F A;  3CMA P;  2E1M A;  2JYL A;  2M5R A;  2EIA A;  1E6J P;  3NY7 B;  3EJE A;  3DS4 A;  1X3O A;  2CWO A;  3G21 A;  2EHT A;  1GPJ A;  3G4S P;  2JAZ A;  2PNG A;  1UNK A;  2GZJ A;  2LL8 A;  3M1M A;  3DS3 A;  1YIT P;  3U43 A;  2ERH A;  2MF4 A;  2KOD A;  2WPT A;  4IZ6 A;  1VQO P;  2KG6 A;  1A8O A;  2K0X A;  2PEJ A;  4HKG A;  1VQ9 P;  2OTJ P;  4H2W C;  4DG9 A;  1Q81 Q;  3CCV P;  1RO0 A;  2FQ1 A;  3EJD A;  3HYB A;  4MRT C;  1FR2 A;  4PH1 A;  4R0M A;  5BS1 A; 
#chains in the Genus database with same CATH homology
 2FAD A;  2KOQ A;  1OR5 A;  2FVF A;  2MR7 A;  4BPH A;  2FVA A;  5KP7 B;  2K93 A;  2CGQ A;  2GDX A;  2LML A;  2K94 A;  1DNY A;  2K92 A;  1F80 D;  5KP6 B;  3EJB A;  2CG5 B;  4CA3 A;  2KGA A;  3RG2 A;  2GDY A;  2QNW A;  5KP8 B;  2N5I A;  2N50 A;  2MR8 A;  2KOR A;  2GDW A;  3GZL A;  2AVA A;  2LIU A;  2KGC A;  1AF8 A;  2MVU A;  2N6Y A;  1VKU A;  2JQ4 A;  2K2Q A;  1L0I A;  4H2Y C;  2FAC A;  4H2X C;  2CQ8 A;  2KGD A;  2KR5 A;  1T8K A;  5HVC A;  2M5R A;  2KWL A;  2L0Q A;  2CNR A;  3NY7 B;  2JGP A;  2N5H A;  2KGE A;  2AFE A;  3EJE A;  2KW2 A;  5CZD B;  2KG9 A;  1NQ4 A;  1X3O A;  2EHS A;  2KOP A;  2X2B A;  2AFD A;  2FQ0 A;  2EHT A;  2FAE A;  2FHS C;  2N98 A;  1HQB A;  2PNG A;  2DNW A;  2LTE A;  2XZ1 C;  2LL8 A;  2LPK A;  2AF8 A;  2JU1 A;  2L22 A;  3GZM A;  2VSQ A;  3LMO A;  2ROQ A;  1KLP A;  3CE7 A;  2N6Z A;  2XZ0 D;  2L9F A;  2MF4 A;  5HV8 A;  1DV5 A;  1HY8 A;  2LOL A;  2MVV A;  2KOS A;  5EJD A;  4PXH B;  2L4B A;  1L0H A;  4IZ6 A;  2KG8 A;  4PWV B;  2KG6 A;  2JU2 A;  2K0X A;  4BPF A;  4HKG A;  1ACP A;  4BPG A;  2LIW A;  2LKI A;  2MD9 A;  4H2W C;  2K0Y A;  2FVE A;  4DG9 A;  2MY5 A;  2FQ2 A;  4NEO A;  2FQ1 A;  3EJD A;  4MRT C;  2KOO A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...