2LL8A

Solution nmr structure of the specialized holo-acyl carrier protein rpa2022 from rhodopseudomonas palustris refined with nh rdcs, northeast structural genomics consortium target rpr324
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ll8A00
2AF8A 2KGDA 2GDWA 4MRTC 2XZ0D 2FVEA 2K2QA 2L9FA 2CNRA 1OR5A 3CE7A 3NY7B 1ACPA 2EHTA 2K94A 2LL8A 5HV8A 2X2BA 4BPHA 2KG6A 2KOQA 2KOPA 4DG9A 2MR8A 2MVUA 3GZLA 2M5RA 2MY5A 2K93A 2AFDA 4IZ6A 2MVVA 4NEOA 3EJDA 2LIUA 5HVCA 2MF4A 2CG5B 4PWVB 2MR7A 4R0MA 2KGEA 2FADA 2JQ4A 2LMLA 2AFEA 2JGPA 3EJEA 1F80D 1L0IA 4HKGA 2LTEA 2KW2A 2KG9A 2FACA 3GZMA 2N5IA 2KWLA 2QNWA 5KP8B 2L0QA 2FAEA 3LMOA 1T8KA 2PNGA 2L4BA 2KGCA 2LOLA 2VSQA 2FVAA 2KOSA 1X3OA 2EHSA 2N6ZA 2FQ2A 2ROQA 1DV5A 1KLPA 2K0XA 2CGQA 3EJBA 5EJDA 2N50A 4H2YC 2GDXA 2KG8A 1DNYA 2XZ1C 5KP6B 2GDYA 2LKIA 2FHSC 2FVFA 4H2WC 1AF8A 2KGAA 4BPGA 2LPKA 4H2XC 2KR5A 2N6YA 5CZDB 2DNWA 2AVAA 1VKUA 2JU1A 2L22A 1HY8A 2K92A 2MD9A 2CQ8A 4PXHB 4CA3A 2FQ1A 2LIWA 1L0HA 2K0YA 3RG2A 2JU2A 2FQ0A 1HQBA 2KOOA 1NQ4A 2N98A 2KORA 4BPFA 2N5HA 5KP7B
chains in the Genus database with same CATH superfamily
1VQKP 2XZ0D 1K9MQ 1YJWP 2K2QA 3DS0A 1A43A 3GKLC 1ACPA 2DGYA 4U0FA 4BPHA 1GPJA 3DS3A 5HGNA 2KG6A 1UJZA 3CMAP 1QVGO 2K5XA 3CCEP 2MR8A 1N8RQ 2M5RA 3MGEA 1FR2A 1RNIA 1EOQA 2MF4A 4IPYA 1VQPP 3WBHA 2FADA 4PH0A 3NTEA 4M0IA 1VQNP 4HKGA 3CCQP 2LTEA 2KW2A 2JYLA 2PEMA 1KD1Q 3GZMA 1YI2P 5KP8B 2FAEA 3LMOA 3G4SP 2L4BA 2LOLA 2PY8A 2VSQA 1M6EX 2FVAA 1VQLP 2EHSA 2FQ2A 1DV5A 4U0DA 5EJDA 2N50A 1YJ9P 3CMEP 3CXCO 2GDYA 2BHVA 1M90Q 2FHSC 2FVFA 2PEQA 2KGAA 4BPGA 3VRLC 1UNKA 3G29A 2Z44A 2AVAA 1VKUA 2K92A 5HGMA 2CQ8A 4PXHB 1W2BO 2FQ1A 2LIWA 2LF4A 1E0HA 2K0YA 1VQ4P 2VLPA 2FQ0A 1NQ4A 2PEOA 2GDWA 4MRTC 3CCLP 2L9FA 1S72P 3B4QA 1VHNA 2E1MA 2P9XA 2XV6A 3P05A 2LL8A 3CD6P 3H0DA 4U0BA 1AYIA 2KOPA 2K0DX 2OTLP 2MVUA 4IZ6A 5JPAA 4PWVB 4U0AA 2KODA 1YITP 2GZIA 1VQOP 2KG9A 1VQ6P 2QNWA 2PNGA 2EG5A 5BS2A 3DS2A 1VQ9P 2GYKA 3CPWO 2L6EA 2K0XA 3EJBA 3I55P 4PH1A 2OARA 4COCA 4H2YC 2XZ1C 5KP6B 4H2WC 1AF8A 3G1GA 2NO8A 2GZGA 3G28A 5CZDB 4QNBA 3Q20A 2L22A 1K8AQ 1RO0A 3CCVP 2MD9A 3HYBA 4GR2A 4CA3A 1L0HA 3CC7P 3RG2A 1HQBA 2BUOA 2KOOA 2N98A 1VQ5P 2N5HA 1E6JP 5BS1A 5DCKA 2KGDA 2FVEA 1A8OA 1YJNP 2CNRA 1OR5A 3G0VA 3CE7A 2VLOA 2EHTA 3DTJA 1M6NA 2K94A 2X2BA 1AUMA 1RO2A 2XXMA 3CCMP 4XROA 2KOQA 3G26A 1KC8Q 2M8PA 3HZQA 1VQ7P 4DG9A 2PEJA 2M8LA 2OTJP 2K93A 2MVVA 2Z45A 1Z6MA 2LIUA 5HVCA 2CG5B 1VQ8P 1EIAA 3DS4A 4WYMA 1ZNVA 3CCRP 2JQ4A 1M74A 2AFEA 2PEKA 3RG6C 2JGPA 1M1KQ 1F80D 1JJ2O 2ONTA 2VLQA 5F2NA 5HGLA 3E2DA 2JO0A 2KWLA 1BXIA 1IMPA 3G1IA 1IMQA 5EW5E 2KGCA 1QRJA 3OW2O 5HGOA 1X3OA 2N6ZA 2ROQA 1KLPA 2EFJA 1EMVA 1ZMBA 2CGQA 3U43A 1K73Q 1Q81Q 2GDXA 1DNYA 3I56P 2GZEA 2LKIA 5F2OA 1IUQA 3CC2P 4H2XC 1D1DA 2N6YA 4XFXA 2Z46A 4XRQA 2GZFA 2JU2A 4UHPB 5KP7B 3DS5A 2AF8A 2EIAA 1MZ8A 3NY7B 7CEIA 5HV8A 2CWOA 1CEIA 4U0EA 1Q82Q 3CC4P 4XFYA 3DS1A 3GZLA 2MY5A 2AFDA 4NEOA 2PEIA 1GXGA 3EJDA 2QEXP 3H47A 2MR7A 4R0MA 2KGEA 1Q86Q 2LMLA 1QVFO 4U0CA 3G71P 1BAJA 1K30A 3EJEA 3CCSP 3M1MA 1L0IA 4COPA 2JYGA 2FACA 2ERHA 3GJNA 2N5IA 2L0QA 1T8KA 2GZJA 3B5IA 1Q7YQ 5F2KA 3G6EP 2KOSA 3G21A 2JBGA 2KG8A 3CCJP 4GR6A 1KQSO 2XT1A 3LRYA 2LPKA 1YIJP 3H4EA 1YHQP 4XFZA 2KR5A 2QA4P 1NJIQ 2DNWA 4F37A 2JU1A 1HY8A 2PENA 4QKOA 5I4TG 2VLNA 3DPHA 2WPTA 3CCUP 1GXHA 2JAZA 2M8NA 1VQMP 2KORA 4BPFA 2JB0A
chains in the Genus database with same CATH topology
2AF8A 2KGDA 2GDWA 4MRTC 2XZ0D 2FVEA 2K2QA 2L9FA 2CNRA 1OR5A 3CE7A 3NY7B 1ACPA 2EHTA 2K94A 2LL8A 5HV8A 2X2BA 4BPHA 2KG6A 2KOQA 2KOPA 4DG9A 2MR8A 2MVUA 3GZLA 2M5RA 2MY5A 2K93A 2AFDA 4IZ6A 2MVVA 4NEOA 3EJDA 2LIUA 5HVCA 2MF4A 2CG5B 4PWVB 2MR7A 4R0MA 2KGEA 2FADA 2JQ4A 2LMLA 2AFEA 2JGPA 3EJEA 1F80D 1L0IA 4HKGA 2LTEA 2KW2A 2KG9A 2FACA 3GZMA 2N5IA 2KWLA 2QNWA 5KP8B 2L0QA 2FAEA 3LMOA 1T8KA 2PNGA 2L4BA 2KGCA 2LOLA 2VSQA 2FVAA 2KOSA 1X3OA 2EHSA 2N6ZA 2FQ2A 2ROQA 1DV5A 1KLPA 2K0XA 2CGQA 3EJBA 5EJDA 2N50A 4H2YC 2GDXA 2KG8A 1DNYA 2XZ1C 5KP6B 2GDYA 2LKIA 2FHSC 2FVFA 4H2WC 1AF8A 2KGAA 4BPGA 2LPKA 4H2XC 2KR5A 2N6YA 5CZDB 2DNWA 2AVAA 1VKUA 2JU1A 2L22A 1HY8A 2K92A 2MD9A 2CQ8A 4PXHB 4CA3A 2FQ1A 2LIWA 1L0HA 2K0YA 3RG2A 2JU2A 2FQ0A 1HQBA 2KOOA 1NQ4A 2N98A 2KORA 4BPFA 2N5HA 5KP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  2KGD A;  2GDW A;  4MRT C;  2XZ0 D;  2FVE A;  2K2Q A;  2L9F A;  2CNR A;  1OR5 A;  3CE7 A;  3NY7 B;  1ACP A;  2EHT A;  2K94 A;  2LL8 A;  5HV8 A;  2X2B A;  4BPH A;  2KG6 A;  2KOQ A;  2KOP A;  4DG9 A;  2MR8 A;  2MVU A;  3GZL A;  2M5R A;  2MY5 A;  2K93 A;  2AFD A;  4IZ6 A;  2MVV A;  4NEO A;  3EJD A;  2LIU A;  5HVC A;  2MF4 A;  2CG5 B;  4PWV B;  2MR7 A;  4R0M A;  2KGE A;  2FAD A;  2JQ4 A;  2LML A;  2AFE A;  2JGP A;  3EJE A;  1F80 D;  1L0I A;  4HKG A;  2LTE A;  2KW2 A;  2KG9 A;  2FAC A;  3GZM A;  2N5I A;  2KWL A;  2QNW A;  5KP8 B;  2L0Q A;  2FAE A;  3LMO A;  1T8K A;  2PNG A;  2L4B A;  2KGC A;  2LOL A;  2VSQ A;  2FVA A;  2KOS A;  1X3O A;  2EHS A;  2N6Z A;  2FQ2 A;  2ROQ A;  1DV5 A;  1KLP A;  2K0X A;  2CGQ A;  3EJB A;  5EJD A;  2N50 A;  4H2Y C;  2GDX A;  2KG8 A;  1DNY A;  2XZ1 C;  5KP6 B;  2GDY A;  2LKI A;  2FHS C;  2FVF A;  4H2W C;  1AF8 A;  2KGA A;  4BPG A;  2LPK A;  4H2X C;  2KR5 A;  2N6Y A;  5CZD B;  2DNW A;  2AVA A;  1VKU A;  2JU1 A;  2L22 A;  1HY8 A;  2K92 A;  2MD9 A;  2CQ8 A;  4PXH B;  4CA3 A;  2FQ1 A;  2LIW A;  1L0H A;  2K0Y A;  3RG2 A;  2JU2 A;  2FQ0 A;  1HQB A;  2KOO A;  1NQ4 A;  2N98 A;  2KOR A;  4BPF A;  2N5H A;  5KP7 B; 
#chains in the Genus database with same CATH topology
 1VQK P;  2XZ0 D;  1K9M Q;  1YJW P;  2K2Q A;  3DS0 A;  1A43 A;  3GKL C;  1ACP A;  2DGY A;  4U0F A;  4BPH A;  1GPJ A;  3DS3 A;  5HGN A;  2KG6 A;  1UJZ A;  3CMA P;  1QVG O;  2K5X A;  3CCE P;  2MR8 A;  1N8R Q;  2M5R A;  3MGE A;  1FR2 A;  1RNI A;  1EOQ A;  2MF4 A;  4IPY A;  1VQP P;  3WBH A;  2FAD A;  4PH0 A;  3NTE A;  4M0I A;  1VQN P;  4HKG A;  3CCQ P;  2LTE A;  2KW2 A;  2JYL A;  2PEM A;  1KD1 Q;  3GZM A;  1YI2 P;  5KP8 B;  2FAE A;  3LMO A;  3G4S P;  2L4B A;  2LOL A;  2PY8 A;  2VSQ A;  1M6E X;  2FVA A;  1VQL P;  2EHS A;  2FQ2 A;  1DV5 A;  4U0D A;  5EJD A;  2N50 A;  1YJ9 P;  3CME P;  3CXC O;  2GDY A;  2BHV A;  1M90 Q;  2FHS C;  2FVF A;  2PEQ A;  2KGA A;  4BPG A;  3VRL C;  1UNK A;  3G29 A;  2Z44 A;  2AVA A;  1VKU A;  2K92 A;  5HGM A;  2CQ8 A;  4PXH B;  1W2B O;  2FQ1 A;  2LIW A;  2LF4 A;  1E0H A;  2K0Y A;  1VQ4 P;  2VLP A;  2FQ0 A;  1NQ4 A;  2PEO A;  2GDW A;  4MRT C;  3CCL P;  2L9F A;  1S72 P;  3B4Q A;  1VHN A;  2E1M A;  2P9X A;  2XV6 A;  3P05 A;  2LL8 A;  3CD6 P;  3H0D A;  4U0B A;  1AYI A;  2KOP A;  2K0D X;  2OTL P;  2MVU A;  4IZ6 A;  5JPA A;  4PWV B;  4U0A A;  2KOD A;  1YIT P;  2GZI A;  1VQO P;  2KG9 A;  1VQ6 P;  2QNW A;  2PNG A;  2EG5 A;  5BS2 A;  3DS2 A;  1VQ9 P;  2GYK A;  3CPW O;  2L6E A;  2K0X A;  3EJB A;  3I55 P;  4PH1 A;  2OAR A;  4COC A;  4H2Y C;  2XZ1 C;  5KP6 B;  4H2W C;  1AF8 A;  3G1G A;  2NO8 A;  2GZG A;  3G28 A;  5CZD B;  4QNB A;  3Q20 A;  2L22 A;  1K8A Q;  1RO0 A;  3CCV P;  2MD9 A;  3HYB A;  4GR2 A;  4CA3 A;  1L0H A;  3CC7 P;  3RG2 A;  1HQB A;  2BUO A;  2KOO A;  2N98 A;  1VQ5 P;  2N5H A;  1E6J P;  5BS1 A;  5DCK A;  2KGD A;  2FVE A;  1A8O A;  1YJN P;  2CNR A;  1OR5 A;  3G0V A;  3CE7 A;  2VLO A;  2EHT A;  3DTJ A;  1M6N A;  2K94 A;  2X2B A;  1AUM A;  1RO2 A;  2XXM A;  3CCM P;  4XRO A;  2KOQ A;  3G26 A;  1KC8 Q;  2M8P A;  3HZQ A;  1VQ7 P;  4DG9 A;  2PEJ A;  2M8L A;  2OTJ P;  2K93 A;  2MVV A;  2Z45 A;  1Z6M A;  2LIU A;  5HVC A;  2CG5 B;  1VQ8 P;  1EIA A;  3DS4 A;  4WYM A;  1ZNV A;  3CCR P;  2JQ4 A;  1M74 A;  2AFE A;  2PEK A;  3RG6 C;  2JGP A;  1M1K Q;  1F80 D;  1JJ2 O;  2ONT A;  2VLQ A;  5F2N A;  5HGL A;  3E2D A;  2JO0 A;  2KWL A;  1BXI A;  1IMP A;  3G1I A;  1IMQ A;  5EW5 E;  2KGC A;  1QRJ A;  3OW2 O;  5HGO A;  1X3O A;  2N6Z A;  2ROQ A;  1KLP A;  2EFJ A;  1EMV A;  1ZMB A;  2CGQ A;  3U43 A;  1K73 Q;  1Q81 Q;  2GDX A;  1DNY A;  3I56 P;  2GZE A;  2LKI A;  5F2O A;  1IUQ A;  3CC2 P;  4H2X C;  1D1D A;  2N6Y A;  4XFX A;  2Z46 A;  4XRQ A;  2GZF A;  2JU2 A;  4UHP B;  5KP7 B;  3DS5 A;  2AF8 A;  2EIA A;  1MZ8 A;  3NY7 B;  7CEI A;  5HV8 A;  2CWO A;  1CEI A;  4U0E A;  1Q82 Q;  3CC4 P;  4XFY A;  3DS1 A;  3GZL A;  2MY5 A;  2AFD A;  4NEO A;  2PEI A;  1GXG A;  3EJD A;  2QEX P;  3H47 A;  2MR7 A;  4R0M A;  2KGE A;  1Q86 Q;  2LML A;  1QVF O;  4U0C A;  3G71 P;  1BAJ A;  1K30 A;  3EJE A;  3CCS P;  3M1M A;  1L0I A;  4COP A;  2JYG A;  2FAC A;  2ERH A;  3GJN A;  2N5I A;  2L0Q A;  1T8K A;  2GZJ A;  3B5I A;  1Q7Y Q;  5F2K A;  3G6E P;  2KOS A;  3G21 A;  2JBG A;  2KG8 A;  3CCJ P;  4GR6 A;  1KQS O;  2XT1 A;  3LRY A;  2LPK A;  1YIJ P;  3H4E A;  1YHQ P;  4XFZ A;  2KR5 A;  2QA4 P;  1NJI Q;  2DNW A;  4F37 A;  2JU1 A;  1HY8 A;  2PEN A;  4QKO A;  5I4T G;  2VLN A;  3DPH A;  2WPT A;  3CCU P;  1GXH A;  2JAZ A;  2M8N A;  1VQM P;  2KOR A;  4BPF A;  2JB0 A; 
#chains in the Genus database with same CATH homology
 2AF8 A;  2KGD A;  2GDW A;  4MRT C;  2XZ0 D;  2FVE A;  2K2Q A;  2L9F A;  2CNR A;  1OR5 A;  3CE7 A;  3NY7 B;  1ACP A;  2EHT A;  2K94 A;  2LL8 A;  5HV8 A;  2X2B A;  4BPH A;  2KG6 A;  2KOQ A;  2KOP A;  4DG9 A;  2MR8 A;  2MVU A;  3GZL A;  2M5R A;  2MY5 A;  2K93 A;  2AFD A;  4IZ6 A;  2MVV A;  4NEO A;  3EJD A;  2LIU A;  5HVC A;  2MF4 A;  2CG5 B;  4PWV B;  2MR7 A;  4R0M A;  2KGE A;  2FAD A;  2JQ4 A;  2LML A;  2AFE A;  2JGP A;  3EJE A;  1F80 D;  1L0I A;  4HKG A;  2LTE A;  2KW2 A;  2KG9 A;  2FAC A;  3GZM A;  2N5I A;  2KWL A;  2QNW A;  5KP8 B;  2L0Q A;  2FAE A;  3LMO A;  1T8K A;  2PNG A;  2L4B A;  2KGC A;  2LOL A;  2VSQ A;  2FVA A;  2KOS A;  1X3O A;  2EHS A;  2N6Z A;  2FQ2 A;  2ROQ A;  1DV5 A;  1KLP A;  2K0X A;  2CGQ A;  3EJB A;  5EJD A;  2N50 A;  4H2Y C;  2GDX A;  2KG8 A;  1DNY A;  2XZ1 C;  5KP6 B;  2GDY A;  2LKI A;  2FHS C;  2FVF A;  4H2W C;  1AF8 A;  2KGA A;  4BPG A;  2LPK A;  4H2X C;  2KR5 A;  2N6Y A;  5CZD B;  2DNW A;  2AVA A;  1VKU A;  2JU1 A;  2L22 A;  1HY8 A;  2K92 A;  2MD9 A;  2CQ8 A;  4PXH B;  4CA3 A;  2FQ1 A;  2LIW A;  1L0H A;  2K0Y A;  3RG2 A;  2JU2 A;  2FQ0 A;  1HQB A;  2KOO A;  1NQ4 A;  2N98 A;  2KOR A;  4BPF A;  2N5H A;  5KP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...