2LL8A

Solution nmr structure of the specialized holo-acyl carrier protein rpa2022 from rhodopseudomonas palustris refined with nh rdcs, northeast structural genomics consortium target rpr324
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ll8A00
2CQ8A 2MR7A 4H2XC 2MVUA 2JGPA 3RG2A 2KGEA 2PNGA 2L0QA 2KOOA 2N98A 1AF8A 2DNWA 2GDXA 2CG5B 2N5HA 1HQBA 2FADA 2LKIA 2L4BA 2LMLA 2LTEA 4MRTC 2N6YA 2JU1A 2AF8A 2EHTA 1F80D 1NQ4A 2LPKA 2KOPA 2N5IA 2KW2A 2KG9A 2XZ0D 3EJDA 5KP8B 2KORA 4BPGA 2FQ2A 2L9FA 2QNWA 2AVAA 2FQ1A 2CGQA 2FVEA 5EJDA 2XZ1C 5CZDB 4H2YC 2LL8A 2KGDA 2KGAA 2AFDA 2VSQA 4IZ6A 2GDYA 2LIWA 2KWLA 1HY8A 2FACA 2K0XA 2MY5A 5HVCA 1KLPA 4R0MA 2X2BA 1T8KA 1DV5A 1VKUA 2MD9A 1L0IA 2K0YA 4PWVB 2KG6A 1X3OA 1L0HA 2JQ4A 1ACPA 2ROQA 5HV8A 2FHSC 3CE7A 2LIUA 2JU2A 3LMOA 3EJEA 2FAEA 2MR8A 2MVVA 2FQ0A 2GDWA 4CA3A 2L22A 4DG9A 2FVAA 2EHSA 2KR5A 2KOSA 3EJBA 2K92A 4NEOA 5KP6B 2KG8A 4PXHB 4H2WC 2MF4A 3GZLA 2CNRA 2K2QA 2K94A 2FVFA 2N6ZA 2N50A 5KP7B 3NY7B 1DNYA 2K93A 4HKGA 3GZMA 2LOLA 1OR5A 4BPHA 2M5RA 2AFEA 2KGCA 2KOQA 4BPFA
chains in the Genus database with same CATH superfamily
2JGPA 1BXIA 2OTLP 3CC7P 2L0QA 2CG5B 2Z46A 2L4BA 1UJZA 2LTEA 4MRTC 1K9MQ 2M8PA 2M8NA 1M6NA 2LPKA 2KOPA 4GR6A 2KW2A 3RG6C 1M6EX 1VQMP 2FQ2A 2FQ1A 4U0EA 3DS3A 2CGQA 3CXCO 3WBHA 5HGNA 2PEOA 2XZ1C 4U0FA 3CC2P 2LL8A 1M1KQ 2KGDA 2DGYA 1VQKP 3E2DA 1AUMA 3CCJP 1Q86Q 2AFDA 4IZ6A 2P9XA 2GZFA 1UNKA 1HY8A 2FACA 4PH0A 3CCSP 2JYLA 2PEMA 4R0MA 2X2BA 2K0YA 1VQLP 2JQ4A 1A8OA 5BS2A 2VLOA 1RO2A 1VQ6P 1VHNA 1BAJA 1KC8Q 2JAZA 2FAEA 2JBGA 2MVVA 2GDWA 1S72P 4DG9A 2FVAA 4IPYA 3DS4A 2KG8A 1VQ9P 1YIJP 1GXGA 3I56P 2PEJA 3LRYA 5KP7B 4PH1A 1DNYA 2XV6A 4XFYA 2ERHA 4F37A 2KOQA 4BPFA 1Z6MA 2LF4A 3RG2A 1AF8A 2PY8A 2KODA 2N5HA 1HQBA 2FADA 2XXMA 3H47A 2JU1A 3NTEA 1E0HA 2AF8A 1NQ4A 5JPAA 3DS0A 2XZ0D 2L6EA 1VQOP 2QNWA 5F2KA 7CEIA 2FVEA 1Q82Q 5CZDB 3HYBA 2PENA 2NO8A 1CEIA 2PEQA 2WPTA 2VSQA 2JO0A 3OW2O 2LIWA 1N8RQ 1YJ9P 2E1MA 3G21A 2K0XA 3GJNA 3P05A 4XROA 5HVCA 3CPWO 1KLPA 3VRLC 4WYMA 3HZQA 1VQ4P 1QVFO 1IMQA 1X3OA 1ACPA 2FHSC 1RNIA 3LMOA 2XT1A 5I4TG 2L22A 3CCLP 4NEOA 1EOQA 1YHQP 2JB0A 3M1MA 5HGLA 2K94A 3GZMA 2JYGA 1MZ8A 2VLNA 1Q81Q 1VQPP 3G28A 1NJIQ 2CQ8A 2MR7A 4H2XC 2MVUA 2N98A 2KOOA 2Z45A 3B4QA 2DNWA 2GDXA 3DTJA 3CMEP 4UHPB 2LMLA 3DPHA 2BHVA 1VQNP 2N6YA 2ONTA 2N5IA 2EFJA 3U43A 4U0BA 1QRJA 1RO0A 2KG9A 2KORA 4BPGA 4GR2A 2K0DX 1Q7YQ 2L9FA 4XRQA 2AVAA 3MGEA 5EJDA 4XFXA 4QNBA 2KGAA 1ZNVA 2GZEA 2QA4P 2GDYA 3I55P 2QEXP 3G1GA 1IMPA 2EIAA 1VQ5P 1T8KA 1IUQA 5F2OA 1L0IA 2KG6A 1L0HA 2ROQA 2PEKA 1AYIA 3CE7A 2LIUA 1JJ2O 3DS2A 2JU2A 3EJEA 2GZGA 2MR8A 1FR2A 2FQ0A 3CCUP 3CC4P 4COCA 3CD6P 2KOSA 3EJBA 2VLQA 3CCVP 5KP6B 3B5IA 4PXHB 5HGMA 2MF4A 1YJNP 3GZLA 2CNRA 1KQSO 4U0AA 3G0VA 5EW5E 1K30A 2K93A 4HKGA 1VQ8P 2LOLA 3CCEP 3G4SP 1OR5A 2VLPA 2M5RA 2AFEA 3GKLC 3Q20A 2KGEA 2PNGA 1K73Q 3G29A 5DCKA 1M90Q 3G6EP 1YITP 1VQ7P 2LKIA 2OARA 2PEIA 3H4EA 5BS1A 1F80D 2EHTA 4U0CA 3G1IA 4COPA 2GYKA 3EJDA 5KP8B 1M74A 3H0DA 3DS5A 4M0IA 3G71P 1W2BO 3DS1A 3CMAP 3CCRP 4H2YC 3CCMP 4XFZA 2CWOA 2K5XA 4U0DA 2KWLA 2MY5A 2EG5A 1GXHA 1YJWP 2Z44A 2GZJA 1DV5A 1E6JP 1VKUA 2MD9A 1QVGO 4PWVB 5F2NA 5HV8A 3G26A 2M8LA 3CCQP 1YI2P 1D1DA 2BUOA 5HGOA 1GPJA 1EIAA 4CA3A 2EHSA 1A43A 4QKOA 1EMVA 2KR5A 2K92A 1K8AQ 2GZIA 4H2WC 2OTJP 2K2QA 2FVFA 2N6ZA 1ZMBA 2N50A 3NY7B 1KD1Q 4BPHA 2KGCA
chains in the Genus database with same CATH topology
2CQ8A 2MR7A 4H2XC 2MVUA 2JGPA 3RG2A 2KGEA 2PNGA 2L0QA 2KOOA 2N98A 1AF8A 2DNWA 2GDXA 2CG5B 2N5HA 1HQBA 2FADA 2LKIA 2L4BA 2LMLA 2LTEA 4MRTC 2N6YA 2JU1A 2AF8A 2EHTA 1F80D 1NQ4A 2LPKA 2KOPA 2N5IA 2KW2A 2KG9A 2XZ0D 3EJDA 5KP8B 2KORA 4BPGA 2FQ2A 2L9FA 2QNWA 2AVAA 2FQ1A 2CGQA 2FVEA 5EJDA 2XZ1C 5CZDB 4H2YC 2LL8A 2KGDA 2KGAA 2AFDA 2VSQA 4IZ6A 2GDYA 2LIWA 2KWLA 1HY8A 2FACA 2K0XA 2MY5A 5HVCA 1KLPA 4R0MA 2X2BA 1T8KA 1DV5A 1VKUA 2MD9A 1L0IA 2K0YA 4PWVB 2KG6A 1X3OA 1L0HA 2JQ4A 1ACPA 2ROQA 5HV8A 2FHSC 3CE7A 2LIUA 2JU2A 3LMOA 3EJEA 2FAEA 2MR8A 2MVVA 2FQ0A 2GDWA 4CA3A 2L22A 4DG9A 2FVAA 2EHSA 2KR5A 2KOSA 3EJBA 2K92A 4NEOA 5KP6B 2KG8A 4PXHB 4H2WC 2MF4A 3GZLA 2CNRA 2K2QA 2K94A 2FVFA 2N6ZA 2N50A 5KP7B 3NY7B 1DNYA 2K93A 4HKGA 3GZMA 2LOLA 1OR5A 4BPHA 2M5RA 2AFEA 2KGCA 2KOQA 4BPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ8 A;  2MR7 A;  4H2X C;  2MVU A;  2JGP A;  3RG2 A;  2KGE A;  2PNG A;  2L0Q A;  2KOO A;  2N98 A;  1AF8 A;  2DNW A;  2GDX A;  2CG5 B;  2N5H A;  1HQB A;  2FAD A;  2LKI A;  2L4B A;  2LML A;  2LTE A;  4MRT C;  2N6Y A;  2JU1 A;  2AF8 A;  2EHT A;  1F80 D;  1NQ4 A;  2LPK A;  2KOP A;  2N5I A;  2KW2 A;  2KG9 A;  2XZ0 D;  3EJD A;  5KP8 B;  2KOR A;  4BPG A;  2FQ2 A;  2L9F A;  2QNW A;  2AVA A;  2FQ1 A;  2CGQ A;  2FVE A;  5EJD A;  2XZ1 C;  5CZD B;  4H2Y C;  2LL8 A;  2KGD A;  2KGA A;  2AFD A;  2VSQ A;  4IZ6 A;  2GDY A;  2LIW A;  2KWL A;  1HY8 A;  2FAC A;  2K0X A;  2MY5 A;  5HVC A;  1KLP A;  4R0M A;  2X2B A;  1T8K A;  1DV5 A;  1VKU A;  2MD9 A;  1L0I A;  2K0Y A;  4PWV B;  2KG6 A;  1X3O A;  1L0H A;  2JQ4 A;  1ACP A;  2ROQ A;  5HV8 A;  2FHS C;  3CE7 A;  2LIU A;  2JU2 A;  3LMO A;  3EJE A;  2FAE A;  2MR8 A;  2MVV A;  2FQ0 A;  2GDW A;  4CA3 A;  2L22 A;  4DG9 A;  2FVA A;  2EHS A;  2KR5 A;  2KOS A;  3EJB A;  2K92 A;  4NEO A;  5KP6 B;  2KG8 A;  4PXH B;  4H2W C;  2MF4 A;  3GZL A;  2CNR A;  2K2Q A;  2K94 A;  2FVF A;  2N6Z A;  2N50 A;  5KP7 B;  3NY7 B;  1DNY A;  2K93 A;  4HKG A;  3GZM A;  2LOL A;  1OR5 A;  4BPH A;  2M5R A;  2AFE A;  2KGC A;  2KOQ A;  4BPF A; 
#chains in the Genus database with same CATH topology
 2JGP A;  1BXI A;  2OTL P;  3CC7 P;  2L0Q A;  2CG5 B;  2Z46 A;  2L4B A;  1UJZ A;  2LTE A;  4MRT C;  1K9M Q;  2M8P A;  2M8N A;  1M6N A;  2LPK A;  2KOP A;  4GR6 A;  2KW2 A;  3RG6 C;  1M6E X;  1VQM P;  2FQ2 A;  2FQ1 A;  4U0E A;  3DS3 A;  2CGQ A;  3CXC O;  3WBH A;  5HGN A;  2PEO A;  2XZ1 C;  4U0F A;  3CC2 P;  2LL8 A;  1M1K Q;  2KGD A;  2DGY A;  1VQK P;  3E2D A;  1AUM A;  3CCJ P;  1Q86 Q;  2AFD A;  4IZ6 A;  2P9X A;  2GZF A;  1UNK A;  1HY8 A;  2FAC A;  4PH0 A;  3CCS P;  2JYL A;  2PEM A;  4R0M A;  2X2B A;  2K0Y A;  1VQL P;  2JQ4 A;  1A8O A;  5BS2 A;  2VLO A;  1RO2 A;  1VQ6 P;  1VHN A;  1BAJ A;  1KC8 Q;  2JAZ A;  2FAE A;  2JBG A;  2MVV A;  2GDW A;  1S72 P;  4DG9 A;  2FVA A;  4IPY A;  3DS4 A;  2KG8 A;  1VQ9 P;  1YIJ P;  1GXG A;  3I56 P;  2PEJ A;  3LRY A;  5KP7 B;  4PH1 A;  1DNY A;  2XV6 A;  4XFY A;  2ERH A;  4F37 A;  2KOQ A;  4BPF A;  1Z6M A;  2LF4 A;  3RG2 A;  1AF8 A;  2PY8 A;  2KOD A;  2N5H A;  1HQB A;  2FAD A;  2XXM A;  3H47 A;  2JU1 A;  3NTE A;  1E0H A;  2AF8 A;  1NQ4 A;  5JPA A;  3DS0 A;  2XZ0 D;  2L6E A;  1VQO P;  2QNW A;  5F2K A;  7CEI A;  2FVE A;  1Q82 Q;  5CZD B;  3HYB A;  2PEN A;  2NO8 A;  1CEI A;  2PEQ A;  2WPT A;  2VSQ A;  2JO0 A;  3OW2 O;  2LIW A;  1N8R Q;  1YJ9 P;  2E1M A;  3G21 A;  2K0X A;  3GJN A;  3P05 A;  4XRO A;  5HVC A;  3CPW O;  1KLP A;  3VRL C;  4WYM A;  3HZQ A;  1VQ4 P;  1QVF O;  1IMQ A;  1X3O A;  1ACP A;  2FHS C;  1RNI A;  3LMO A;  2XT1 A;  5I4T G;  2L22 A;  3CCL P;  4NEO A;  1EOQ A;  1YHQ P;  2JB0 A;  3M1M A;  5HGL A;  2K94 A;  3GZM A;  2JYG A;  1MZ8 A;  2VLN A;  1Q81 Q;  1VQP P;  3G28 A;  1NJI Q;  2CQ8 A;  2MR7 A;  4H2X C;  2MVU A;  2N98 A;  2KOO A;  2Z45 A;  3B4Q A;  2DNW A;  2GDX A;  3DTJ A;  3CME P;  4UHP B;  2LML A;  3DPH A;  2BHV A;  1VQN P;  2N6Y A;  2ONT A;  2N5I A;  2EFJ A;  3U43 A;  4U0B A;  1QRJ A;  1RO0 A;  2KG9 A;  2KOR A;  4BPG A;  4GR2 A;  2K0D X;  1Q7Y Q;  2L9F A;  4XRQ A;  2AVA A;  3MGE A;  5EJD A;  4XFX A;  4QNB A;  2KGA A;  1ZNV A;  2GZE A;  2QA4 P;  2GDY A;  3I55 P;  2QEX P;  3G1G A;  1IMP A;  2EIA A;  1VQ5 P;  1T8K A;  1IUQ A;  5F2O A;  1L0I A;  2KG6 A;  1L0H A;  2ROQ A;  2PEK A;  1AYI A;  3CE7 A;  2LIU A;  1JJ2 O;  3DS2 A;  2JU2 A;  3EJE A;  2GZG A;  2MR8 A;  1FR2 A;  2FQ0 A;  3CCU P;  3CC4 P;  4COC A;  3CD6 P;  2KOS A;  3EJB A;  2VLQ A;  3CCV P;  5KP6 B;  3B5I A;  4PXH B;  5HGM A;  2MF4 A;  1YJN P;  3GZL A;  2CNR A;  1KQS O;  4U0A A;  3G0V A;  5EW5 E;  1K30 A;  2K93 A;  4HKG A;  1VQ8 P;  2LOL A;  3CCE P;  3G4S P;  1OR5 A;  2VLP A;  2M5R A;  2AFE A;  3GKL C;  3Q20 A;  2KGE A;  2PNG A;  1K73 Q;  3G29 A;  5DCK A;  1M90 Q;  3G6E P;  1YIT P;  1VQ7 P;  2LKI A;  2OAR A;  2PEI A;  3H4E A;  5BS1 A;  1F80 D;  2EHT A;  4U0C A;  3G1I A;  4COP A;  2GYK A;  3EJD A;  5KP8 B;  1M74 A;  3H0D A;  3DS5 A;  4M0I A;  3G71 P;  1W2B O;  3DS1 A;  3CMA P;  3CCR P;  4H2Y C;  3CCM P;  4XFZ A;  2CWO A;  2K5X A;  4U0D A;  2KWL A;  2MY5 A;  2EG5 A;  1GXH A;  1YJW P;  2Z44 A;  2GZJ A;  1DV5 A;  1E6J P;  1VKU A;  2MD9 A;  1QVG O;  4PWV B;  5F2N A;  5HV8 A;  3G26 A;  2M8L A;  3CCQ P;  1YI2 P;  1D1D A;  2BUO A;  5HGO A;  1GPJ A;  1EIA A;  4CA3 A;  2EHS A;  1A43 A;  4QKO A;  1EMV A;  2KR5 A;  2K92 A;  1K8A Q;  2GZI A;  4H2W C;  2OTJ P;  2K2Q A;  2FVF A;  2N6Z A;  1ZMB A;  2N50 A;  3NY7 B;  1KD1 Q;  4BPH A;  2KGC A; 
#chains in the Genus database with same CATH homology
 2CQ8 A;  2MR7 A;  4H2X C;  2MVU A;  2JGP A;  3RG2 A;  2KGE A;  2PNG A;  2L0Q A;  2KOO A;  2N98 A;  1AF8 A;  2DNW A;  2GDX A;  2CG5 B;  2N5H A;  1HQB A;  2FAD A;  2LKI A;  2L4B A;  2LML A;  2LTE A;  4MRT C;  2N6Y A;  2JU1 A;  2AF8 A;  2EHT A;  1F80 D;  1NQ4 A;  2LPK A;  2KOP A;  2N5I A;  2KW2 A;  2KG9 A;  2XZ0 D;  3EJD A;  5KP8 B;  2KOR A;  4BPG A;  2FQ2 A;  2L9F A;  2QNW A;  2AVA A;  2FQ1 A;  2CGQ A;  2FVE A;  5EJD A;  2XZ1 C;  5CZD B;  4H2Y C;  2LL8 A;  2KGD A;  2KGA A;  2AFD A;  2VSQ A;  4IZ6 A;  2GDY A;  2LIW A;  2KWL A;  1HY8 A;  2FAC A;  2K0X A;  2MY5 A;  5HVC A;  1KLP A;  4R0M A;  2X2B A;  1T8K A;  1DV5 A;  1VKU A;  2MD9 A;  1L0I A;  2K0Y A;  4PWV B;  2KG6 A;  1X3O A;  1L0H A;  2JQ4 A;  1ACP A;  2ROQ A;  5HV8 A;  2FHS C;  3CE7 A;  2LIU A;  2JU2 A;  3LMO A;  3EJE A;  2FAE A;  2MR8 A;  2MVV A;  2FQ0 A;  2GDW A;  4CA3 A;  2L22 A;  4DG9 A;  2FVA A;  2EHS A;  2KR5 A;  2KOS A;  3EJB A;  2K92 A;  4NEO A;  5KP6 B;  2KG8 A;  4PXH B;  4H2W C;  2MF4 A;  3GZL A;  2CNR A;  2K2Q A;  2K94 A;  2FVF A;  2N6Z A;  2N50 A;  5KP7 B;  3NY7 B;  1DNY A;  2K93 A;  4HKG A;  3GZM A;  2LOL A;  1OR5 A;  4BPH A;  2M5R A;  2AFE A;  2KGC A;  2KOQ A;  4BPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...