2LL8A

Solution nmr structure of the specialized holo-acyl carrier protein rpa2022 from rhodopseudomonas palustris refined with nh rdcs, northeast structural genomics consortium target rpr324
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
MTSTFDRVATIIAETCDIPRETITPESHAIDDLGIDSLDFLDIAFAIDKAFGIKLPLEKWTQEVNDGKATTEQYFVLKNLAARIDELVAAKGALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a specialized acyl carrier protein essential for lipid A biosynthesis with very long-chain fatty acids in open and closed conformations.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Transferase
molecule keywords Specialized acyl carrier protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2011-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ll8A00
5KP7B 4IZ6A 2KWLA 2CNRA 2EHTA 2CG5B 2L22A 1X3OA 2N6YA 4H2WC 4BPGA 2KOQA 2JU1A 2KW2A 2QNWA 2DNWA 2LPKA 2L0QA 2MVVA 4BPFA 2LOLA 3NY7B 2KOOA 4H2XC 2LTEA 5EJDA 2N98A 1L0HA 4HKGA 4NEOA 2FVAA 2KG8A 3EJDA 4R0MA 2K0YA 2JQ4A 1HQBA 2FAEA 2GDXA 2K94A 2ROQA 3RG2A 2LL8A 2VSQA 2N50A 1L0IA 3CE7A 2MR8A 2KG6A 2K93A 2JU2A 2AFDA 2KGAA 2L9FA 4MRTC 2X2BA 3GZLA 2FQ0A 2CQ8A 2EHSA 4BPHA 2MD9A 2CGQA 5HVCA 2GDWA 3LMOA 1DV5A 1HY8A 2XZ1C 2N6ZA 2KORA 2KR5A 2PNGA 4H2YC 2FHSC 5KP8B 2MR7A 2JGPA 2MY5A 1VKUA 1ACPA 2LMLA 2FVEA 2AFEA 2MVUA 4CA3A 2KGCA 5KP6B 2MF4A 2XZ0D 4PXHB 3EJEA 2KOSA 4DG9A 1T8KA 2LIWA 1AF8A 2KGDA 2K92A 1DNYA 1OR5A 2M5RA 2KGEA 2N5IA 2LIUA 2FVFA 1KLPA 2FQ1A 2FADA 5HV8A 2KG9A 2FACA 1NQ4A 4PWVB 2AF8A 2KOPA 2L4BA 2K2QA 2AVAA 2LKIA 2GDYA 5CZDB 2K0XA 1F80D 2N5HA 2FQ2A 3EJBA 3GZMA
chains in the Genus database with same CATH superfamily
1YIJP 3B4QA 2PEMA 2KWLA 1GXHA 1ZNVA 2JU1A 2VLOA 2LPKA 1VQNP 4XROA 2MVVA 4BPFA 2LOLA 2KOOA 2LTEA 4COPA 5F2NA 1VQKP 1L0HA 1Q82Q 1EIAA 1UJZA 2Z45A 3DPHA 2FAEA 1FR2A 2WPTA 3RG2A 1M74A 2LL8A 1Z6MA 1L0IA 3CE7A 5JPAA 2MR8A 2JU2A 2AFDA 2ONTA 1QVFO 2PEOA 3H0DA 2EHSA 4BPHA 2JB0A 4U0FA 3RG6C 2QA4P 3H4EA 5HGLA 3G28A 2OARA 4H2YC 1M6NA 2JGPA 3Q20A 2MY5A 2LMLA 1KQSO 4CA3A 2XZ0D 2JO0A 1VQOP 1A43A 3MGEA 1DNYA 2K92A 2JBGA 2GZIA 3CCVP 2LIUA 5HGMA 5BS2A 2FQ1A 2EG5A 5HV8A 1Q7YQ 5F2KA 1IMQA 2FQ2A 2GZGA 1VQLP 3GZMA 2GZEA 2P9XA 1ZMBA 3DS3A 4IPYA 4IZ6A 2CG5B 2PEQA 2VLQA 3OW2O 4U0DA 1AYIA 1X3OA 2N6YA 1Q86Q 4U0BA 1YJNP 2QNWA 2L0QA 3B5IA 2Z46A 2OTJP 3NY7B 4H2XC 1S72P 2N98A 1A8OA 2XXMA 2PEIA 3EJDA 1W2BO 7CEIA 1RNIA 2JQ4A 3CCSP 2ROQA 3I55P 2NO8A 3CCUP 2KG6A 2K93A 2OTLP 3DS2A 2X2BA 1VQ5P 1GPJA 3CCQP 2FQ0A 3GJNA 2CQ8A 2GZFA 4XFYA 2DGYA 5HVCA 2ERHA 3CMAP 3LMOA 1BAJA 2VLPA 2XZ1C 2KORA 2KR5A 3G26A 4WYMA 2FHSC 2PEKA 2EIAA 1K73Q 3LRYA 1ACPA 4PH1A 2FVEA 5HGOA 2MVUA 1MZ8A 2KOSA 4DG9A 4UHPB 2BUOA 2GZJA 2LIWA 3CCRP 2KGDA 1AF8A 2LF4A 3DS4A 1M90Q 2FVFA 1KLPA 2Z44A 2K0DX 2PY8A 2PENA 4U0AA 2EFJA 3EJBA 4GR2A 5KP7B 3WBHA 2PEJA 3CCEP 2EHTA 3CPWO 1BXIA 2L22A 1AUMA 1YJWP 4BPGA 2DNWA 3I56P 3CCLP 1M1KQ 2QEXP 5F2OA 1VQ7P 2K5XA 2M8NA 4NEOA 1CEIA 4XRQA 2KG8A 2JYGA 3E2DA 4XFXA 2CWOA 4R0MA 4COCA 4XFZA 2K0YA 1HQBA 1VQPP 2GDXA 2VSQA 2JYLA 1JJ2O 1KD1Q 2KGAA 4MRTC 3CD6P 3GZLA 3DS0A 1M6EX 1VQ6P 1EMVA 1DV5A 3G4SP 1HY8A 3HZQA 1N8RQ 3CMEP 3G0VA 5DCKA 5KP8B 3G6EP 1VQMP 1YITP 4F37A 2M8PA 2KGCA 3CCJP 2MF4A 1UNKA 4PXHB 3EJEA 5BS1A 1VQ9P 1VHNA 3CC2P 1OR5A 2KGEA 2JAZA 1K9MQ 3CCMP 3NTEA 2KG9A 4GR6A 4PWVB 2AF8A 1QRJA 2KOPA 1Q81Q 2K2QA 2AVAA 2GDYA 5CZDB 2N5HA 1IMPA 4QKOA 1RO0A 3GKLC 2CNRA 3DS5A 3G21A 4H2WC 1QVGO 3P05A 2KOQA 5EW5E 2KW2A 1E0HA 1YI2P 5EJDA 1VQ8P 1K30A 2GYKA 4HKGA 1RO2A 3HYBA 2FVAA 1IUQA 4U0CA 2XT1A 3DTJA 2K94A 2N50A 1KC8Q 2BHVA 2L9FA 3G29A 4U0EA 2MD9A 4QNBA 3DS1A 3G1IA 2CGQA 3CC7P 2GDWA 1EOQA 2N6ZA 1NJIQ 2PNGA 4PH0A 2MR7A 1K8AQ 2E1MA 1D1DA 3G71P 1VKUA 2KODA 3G1GA 3H47A 3CXCO 1E6JP 2AFEA 2VLNA 2M8LA 5KP6B 1YHQP 3U43A 1T8KA 2M5RA 2N5IA 3M1MA 5HGNA 1VQ4P 5I4TG 2L6EA 1YJ9P 2FADA 2FACA 1NQ4A 2L4BA 2XV6A 3CC4P 3VRLC 2LKIA 2K0XA 1F80D 4M0IA 1GXGA
chains in the Genus database with same CATH topology
5KP7B 4IZ6A 2KWLA 2CNRA 2EHTA 2CG5B 2L22A 1X3OA 2N6YA 4H2WC 4BPGA 2KOQA 2JU1A 2KW2A 2QNWA 2DNWA 2LPKA 2L0QA 2MVVA 4BPFA 2LOLA 3NY7B 2KOOA 4H2XC 2LTEA 5EJDA 2N98A 1L0HA 4HKGA 4NEOA 2FVAA 2KG8A 3EJDA 4R0MA 2K0YA 2JQ4A 1HQBA 2FAEA 2GDXA 2K94A 2ROQA 3RG2A 2LL8A 2VSQA 2N50A 1L0IA 3CE7A 2MR8A 2KG6A 2K93A 2JU2A 2AFDA 2KGAA 2L9FA 4MRTC 2X2BA 3GZLA 2FQ0A 2CQ8A 2EHSA 4BPHA 2MD9A 2CGQA 5HVCA 2GDWA 3LMOA 1DV5A 1HY8A 2XZ1C 2N6ZA 2KORA 2KR5A 2PNGA 4H2YC 2FHSC 5KP8B 2MR7A 2JGPA 2MY5A 1VKUA 1ACPA 2LMLA 2FVEA 2AFEA 2MVUA 4CA3A 2KGCA 5KP6B 2MF4A 2XZ0D 4PXHB 3EJEA 2KOSA 4DG9A 1T8KA 2LIWA 1AF8A 2KGDA 2K92A 1DNYA 1OR5A 2M5RA 2KGEA 2N5IA 2LIUA 2FVFA 1KLPA 2FQ1A 2FADA 5HV8A 2KG9A 2FACA 1NQ4A 4PWVB 2AF8A 2KOPA 2L4BA 2K2QA 2AVAA 2LKIA 2GDYA 5CZDB 2K0XA 1F80D 2N5HA 2FQ2A 3EJBA 3GZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP7 B;  4IZ6 A;  2KWL A;  2CNR A;  2EHT A;  2CG5 B;  2L22 A;  1X3O A;  2N6Y A;  4H2W C;  4BPG A;  2KOQ A;  2JU1 A;  2KW2 A;  2QNW A;  2DNW A;  2LPK A;  2L0Q A;  2MVV A;  4BPF A;  2LOL A;  3NY7 B;  2KOO A;  4H2X C;  2LTE A;  5EJD A;  2N98 A;  1L0H A;  4HKG A;  4NEO A;  2FVA A;  2KG8 A;  3EJD A;  4R0M A;  2K0Y A;  2JQ4 A;  1HQB A;  2FAE A;  2GDX A;  2K94 A;  2ROQ A;  3RG2 A;  2LL8 A;  2VSQ A;  2N50 A;  1L0I A;  3CE7 A;  2MR8 A;  2KG6 A;  2K93 A;  2JU2 A;  2AFD A;  2KGA A;  2L9F A;  4MRT C;  2X2B A;  3GZL A;  2FQ0 A;  2CQ8 A;  2EHS A;  4BPH A;  2MD9 A;  2CGQ A;  5HVC A;  2GDW A;  3LMO A;  1DV5 A;  1HY8 A;  2XZ1 C;  2N6Z A;  2KOR A;  2KR5 A;  2PNG A;  4H2Y C;  2FHS C;  5KP8 B;  2MR7 A;  2JGP A;  2MY5 A;  1VKU A;  1ACP A;  2LML A;  2FVE A;  2AFE A;  2MVU A;  4CA3 A;  2KGC A;  5KP6 B;  2MF4 A;  2XZ0 D;  4PXH B;  3EJE A;  2KOS A;  4DG9 A;  1T8K A;  2LIW A;  1AF8 A;  2KGD A;  2K92 A;  1DNY A;  1OR5 A;  2M5R A;  2KGE A;  2N5I A;  2LIU A;  2FVF A;  1KLP A;  2FQ1 A;  2FAD A;  5HV8 A;  2KG9 A;  2FAC A;  1NQ4 A;  4PWV B;  2AF8 A;  2KOP A;  2L4B A;  2K2Q A;  2AVA A;  2LKI A;  2GDY A;  5CZD B;  2K0X A;  1F80 D;  2N5H A;  2FQ2 A;  3EJB A;  3GZM A; 
#chains in the Genus database with same CATH topology
 1YIJ P;  3B4Q A;  2PEM A;  2KWL A;  1GXH A;  1ZNV A;  2JU1 A;  2VLO A;  2LPK A;  1VQN P;  4XRO A;  2MVV A;  4BPF A;  2LOL A;  2KOO A;  2LTE A;  4COP A;  5F2N A;  1VQK P;  1L0H A;  1Q82 Q;  1EIA A;  1UJZ A;  2Z45 A;  3DPH A;  2FAE A;  1FR2 A;  2WPT A;  3RG2 A;  1M74 A;  2LL8 A;  1Z6M A;  1L0I A;  3CE7 A;  5JPA A;  2MR8 A;  2JU2 A;  2AFD A;  2ONT A;  1QVF O;  2PEO A;  3H0D A;  2EHS A;  4BPH A;  2JB0 A;  4U0F A;  3RG6 C;  2QA4 P;  3H4E A;  5HGL A;  3G28 A;  2OAR A;  4H2Y C;  1M6N A;  2JGP A;  3Q20 A;  2MY5 A;  2LML A;  1KQS O;  4CA3 A;  2XZ0 D;  2JO0 A;  1VQO P;  1A43 A;  3MGE A;  1DNY A;  2K92 A;  2JBG A;  2GZI A;  3CCV P;  2LIU A;  5HGM A;  5BS2 A;  2FQ1 A;  2EG5 A;  5HV8 A;  1Q7Y Q;  5F2K A;  1IMQ A;  2FQ2 A;  2GZG A;  1VQL P;  3GZM A;  2GZE A;  2P9X A;  1ZMB A;  3DS3 A;  4IPY A;  4IZ6 A;  2CG5 B;  2PEQ A;  2VLQ A;  3OW2 O;  4U0D A;  1AYI A;  1X3O A;  2N6Y A;  1Q86 Q;  4U0B A;  1YJN P;  2QNW A;  2L0Q A;  3B5I A;  2Z46 A;  2OTJ P;  3NY7 B;  4H2X C;  1S72 P;  2N98 A;  1A8O A;  2XXM A;  2PEI A;  3EJD A;  1W2B O;  7CEI A;  1RNI A;  2JQ4 A;  3CCS P;  2ROQ A;  3I55 P;  2NO8 A;  3CCU P;  2KG6 A;  2K93 A;  2OTL P;  3DS2 A;  2X2B A;  1VQ5 P;  1GPJ A;  3CCQ P;  2FQ0 A;  3GJN A;  2CQ8 A;  2GZF A;  4XFY A;  2DGY A;  5HVC A;  2ERH A;  3CMA P;  3LMO A;  1BAJ A;  2VLP A;  2XZ1 C;  2KOR A;  2KR5 A;  3G26 A;  4WYM A;  2FHS C;  2PEK A;  2EIA A;  1K73 Q;  3LRY A;  1ACP A;  4PH1 A;  2FVE A;  5HGO A;  2MVU A;  1MZ8 A;  2KOS A;  4DG9 A;  4UHP B;  2BUO A;  2GZJ A;  2LIW A;  3CCR P;  2KGD A;  1AF8 A;  2LF4 A;  3DS4 A;  1M90 Q;  2FVF A;  1KLP A;  2Z44 A;  2K0D X;  2PY8 A;  2PEN A;  4U0A A;  2EFJ A;  3EJB A;  4GR2 A;  5KP7 B;  3WBH A;  2PEJ A;  3CCE P;  2EHT A;  3CPW O;  1BXI A;  2L22 A;  1AUM A;  1YJW P;  4BPG A;  2DNW A;  3I56 P;  3CCL P;  1M1K Q;  2QEX P;  5F2O A;  1VQ7 P;  2K5X A;  2M8N A;  4NEO A;  1CEI A;  4XRQ A;  2KG8 A;  2JYG A;  3E2D A;  4XFX A;  2CWO A;  4R0M A;  4COC A;  4XFZ A;  2K0Y A;  1HQB A;  1VQP P;  2GDX A;  2VSQ A;  2JYL A;  1JJ2 O;  1KD1 Q;  2KGA A;  4MRT C;  3CD6 P;  3GZL A;  3DS0 A;  1M6E X;  1VQ6 P;  1EMV A;  1DV5 A;  3G4S P;  1HY8 A;  3HZQ A;  1N8R Q;  3CME P;  3G0V A;  5DCK A;  5KP8 B;  3G6E P;  1VQM P;  1YIT P;  4F37 A;  2M8P A;  2KGC A;  3CCJ P;  2MF4 A;  1UNK A;  4PXH B;  3EJE A;  5BS1 A;  1VQ9 P;  1VHN A;  3CC2 P;  1OR5 A;  2KGE A;  2JAZ A;  1K9M Q;  3CCM P;  3NTE A;  2KG9 A;  4GR6 A;  4PWV B;  2AF8 A;  1QRJ A;  2KOP A;  1Q81 Q;  2K2Q A;  2AVA A;  2GDY A;  5CZD B;  2N5H A;  1IMP A;  4QKO A;  1RO0 A;  3GKL C;  2CNR A;  3DS5 A;  3G21 A;  4H2W C;  1QVG O;  3P05 A;  2KOQ A;  5EW5 E;  2KW2 A;  1E0H A;  1YI2 P;  5EJD A;  1VQ8 P;  1K30 A;  2GYK A;  4HKG A;  1RO2 A;  3HYB A;  2FVA A;  1IUQ A;  4U0C A;  2XT1 A;  3DTJ A;  2K94 A;  2N50 A;  1KC8 Q;  2BHV A;  2L9F A;  3G29 A;  4U0E A;  2MD9 A;  4QNB A;  3DS1 A;  3G1I A;  2CGQ A;  3CC7 P;  2GDW A;  1EOQ A;  2N6Z A;  1NJI Q;  2PNG A;  4PH0 A;  2MR7 A;  1K8A Q;  2E1M A;  1D1D A;  3G71 P;  1VKU A;  2KOD A;  3G1G A;  3H47 A;  3CXC O;  1E6J P;  2AFE A;  2VLN A;  2M8L A;  5KP6 B;  1YHQ P;  3U43 A;  1T8K A;  2M5R A;  2N5I A;  3M1M A;  5HGN A;  1VQ4 P;  5I4T G;  2L6E A;  1YJ9 P;  2FAD A;  2FAC A;  1NQ4 A;  2L4B A;  2XV6 A;  3CC4 P;  3VRL C;  2LKI A;  2K0X A;  1F80 D;  4M0I A;  1GXG A; 
#chains in the Genus database with same CATH homology
 5KP7 B;  4IZ6 A;  2KWL A;  2CNR A;  2EHT A;  2CG5 B;  2L22 A;  1X3O A;  2N6Y A;  4H2W C;  4BPG A;  2KOQ A;  2JU1 A;  2KW2 A;  2QNW A;  2DNW A;  2LPK A;  2L0Q A;  2MVV A;  4BPF A;  2LOL A;  3NY7 B;  2KOO A;  4H2X C;  2LTE A;  5EJD A;  2N98 A;  1L0H A;  4HKG A;  4NEO A;  2FVA A;  2KG8 A;  3EJD A;  4R0M A;  2K0Y A;  2JQ4 A;  1HQB A;  2FAE A;  2GDX A;  2K94 A;  2ROQ A;  3RG2 A;  2LL8 A;  2VSQ A;  2N50 A;  1L0I A;  3CE7 A;  2MR8 A;  2KG6 A;  2K93 A;  2JU2 A;  2AFD A;  2KGA A;  2L9F A;  4MRT C;  2X2B A;  3GZL A;  2FQ0 A;  2CQ8 A;  2EHS A;  4BPH A;  2MD9 A;  2CGQ A;  5HVC A;  2GDW A;  3LMO A;  1DV5 A;  1HY8 A;  2XZ1 C;  2N6Z A;  2KOR A;  2KR5 A;  2PNG A;  4H2Y C;  2FHS C;  5KP8 B;  2MR7 A;  2JGP A;  2MY5 A;  1VKU A;  1ACP A;  2LML A;  2FVE A;  2AFE A;  2MVU A;  4CA3 A;  2KGC A;  5KP6 B;  2MF4 A;  2XZ0 D;  4PXH B;  3EJE A;  2KOS A;  4DG9 A;  1T8K A;  2LIW A;  1AF8 A;  2KGD A;  2K92 A;  1DNY A;  1OR5 A;  2M5R A;  2KGE A;  2N5I A;  2LIU A;  2FVF A;  1KLP A;  2FQ1 A;  2FAD A;  5HV8 A;  2KG9 A;  2FAC A;  1NQ4 A;  4PWV B;  2AF8 A;  2KOP A;  2L4B A;  2K2Q A;  2AVA A;  2LKI A;  2GDY A;  5CZD B;  2K0X A;  1F80 D;  2N5H A;  2FQ2 A;  3EJB A;  3GZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...