3DS3A

Hiv-1 capsid c-terminal domain mutant (y169a) in complex with an inhibitor of particle assembly (cai)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 26
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds3A00
2LF4A 4XRQA 3P05A 5I4TG 1A43A 3DPHA 4WYMA 4IPYA 4XFXA 3DS1A 3H47A 1EIAA 4M0IA 3DS2A 4PH1A 2ONTA 4U0CA 3VRLC 4COCA 3G1GA 3MGEA 3G29A 3H4EA 1E6JP 2XV6A 4U0DA 3G0VA 4XFYA 3G26A 2M8PA 2XT1A 2EIAA 3DS5A 4U0EA 4PH0A 1A8OA 2JYGA 2L6EA 3DS0A 3DTJA 4XROA 3G1IA 5HGLA 2M8LA 2M8NA 3G21A 4U0AA 2JO0A 4QNBA 4COPA 5HGOA 3LRYA 5HGMA 1EOQA 3DS3A 3G28A 2JYLA 1QRJA 4XFZA 5HGNA 2KODA 3NTEA 4U0BA 5JPAA 1D1DA 2BUOA 5DCKA 1BAJA 4U0FA 1AUMA 2XXMA 3DS4A
chains in the Genus database with same CATH superfamily
4H2YC 5KP6B 3CCRP 1YITP 2GYKA 4IZ6A 4PH1A 1NQ4A 2N98A 3LMOA 1KQSO 2GZFA 2PEIA 2EIAA 1UNKA 2KG8A 3HYBA 4XROA 1BXIA 2DNWA 3GJNA 1E0HA 1YI2P 5HV8A 1M1KQ 2CG5B 1K9MQ 3WBHA 3CCQP 2LIWA 3CCSP 2JBGA 3Q20A 3U43A 3MGEA 2KG9A 1Q82Q 2XT1A 2JU1A 3EJEA 2L6EA 3EJDA 1AF8A 3H0DA 1VQMP 5HGOA 3CC2P 1ACPA 1FR2A 2EHTA 5HGMA 1VQKP 2FAEA 2KORA 4CA3A 2FVAA 3I56P 4XFXA 2L4BA 2KOSA 5F2OA 2EG5A 1K30A 3GZLA 3M1MA 1KLPA 3DS0A 4DG9A 2M8LA 4U0AA 2L22A 2KR5A 5HGNA 3CCLP 2LKIA 2FQ1A 5BS1A 2JU2A 2L0QA 5F2NA 1YJNP 5CZDB 3G0VA 4GR2A 1VKUA 2OARA 1YIJP 1YJWP 1JJ2O 4QNBA 2MY5A 3LRYA 5EJDA 1VQ9P 4H2XC 5DCKA 2XXMA 2MVVA 3DS2A 3CMAP 3G71P 7CEIA 4GR6A 1VQNP 2JAZA 1M90Q 1IUQA 2N5HA 3RG2A 4UHPB 5BS2A 2N5IA 2JYLA 2XZ0D 2KOOA 2BHVA 2N6YA 1AYIA 2LF4A 2JGPA 2PY8A 2VSQA 2WPTA 2Z45A 2KOQA 4XFYA 2K93A 2ROQA 1L0IA 4H2WC 1K8AQ 2XZ1C 4COPA 2PNGA 1Q81Q 1YHQP 3G6EP 1ZNVA 2QA4P 2AF8A 2GZGA 3CC4P 3CCMP 2K92A 2M8NA 1GPJA 2X2BA 2JB0A 1M6EX 1VQ4P 1EOQA 1RO0A 2EFJA 2CGQA 1L0HA 1EMVA 1QVGO 5F2KA 2MR7A 2LL8A 5KP8B 2CNRA 2E1MA 3HZQA 2GDWA 2PEJA 2KWLA 2LIUA 2KOPA 1GXGA 5JPAA 2BUOA 1OR5A 3P05A 2FVFA 4PWVB 1S72P 4COCA 3CCJP 3H4EA 2FHSC 2FACA 4U0DA 3CPWO 3CXCO 4U0EA 1MZ8A 1VHNA 2JYGA 2KW2A 2FVEA 5HGLA 3G4SP 2PENA 2K0DX 3CCUP 3CE7A 2FQ0A 1VQPP 5I4TG 1A43A 3DPHA 1IMQA 2KGDA 2K0XA 1VQLP 2ONTA 1GXHA 1NJIQ 2XV6A 2M8PA 4QKOA 2AFEA 1VQ8P 1M6NA 2AFDA 3GKLC 3CMEP 2DGYA 1KD1Q 2LTEA 2PEQA 4M0IA 2KGEA 1T8KA 3G29A 1E6JP 1VQ7P 4NEOA 2K0YA 2GDXA 2M5RA 3DS5A 5HVCA 2GZIA 2N50A 3CD6P 4PXHB 2Z44A 4XFZA 2NO8A 2PEOA 4XRQA 1ZMBA 2MD9A 3B5IA 4IPYA 1HQBA 1Q7YQ 3H47A 4U0CA 5EW5E 2LOLA 4F37A 2FADA 4BPHA 2PEKA 2CQ8A 3CC7P 1N8RQ 2GZJA 2KODA 2QEXP 4U0FA 4R0MA 1CEIA 2K2QA 4WYMA 2KG6A 1K73Q 2K94A 3RG6C 2FQ2A 2AVAA 4HKGA 3G1GA 2VLQA 2L9FA 2LPKA 2MR8A 3G26A 1QVFO 3DTJA 2VLOA 2JO0A 1DNYA 1D1DA 2JQ4A 1BAJA 1HY8A 3DS4A 1F80D 2PEMA 3B4QA 2N6ZA 2VLNA 1RO2A 2VLPA 1DV5A 1VQOP 1UJZA 2GZEA 4MRTC 3G1IA 3G21A 2GDYA 1YJ9P 2ERHA 1M74A 3DS3A 3G28A 3CCEP 2EHSA 4BPFA 1W2BO 2KGAA 1Z6MA 3DS1A 2P9XA 3VRLC 1VQ6P 5KP7B 2OTJP 1VQ5P 2MVUA 1KC8Q 1A8OA 1Q86Q 2QNWA 3EJBA 1QRJA 2CWOA 1RNIA 4U0BA 2OTLP 2MF4A 3OW2O 3CCVP 3I55P 1EIAA 2KGCA 2Z46A 3NY7B 3E2DA 4PH0A 2LMLA 1IMPA 4BPGA 3GZMA 1X3OA 3NTEA 2K5XA 1AUMA
chains in the Genus database with same CATH topology
3P05A 4WYMA 3CCRP 1YITP 1K73Q 1S72P 3RG6C 3DS2A 4PH1A 4COCA 3CMAP 3G71P 3G1GA 4GR6A 3CCJP 3H4EA 1KQSO 1VQNP 2PEIA 4U0DA 3G26A 3CPWO 1QVFO 2EIAA 3CXCO 1M90Q 4U0EA 1IUQA 3HYBA 2JYGA 3DTJA 4XROA 5HGLA 3G4SP 2JO0A 2PENA 5BS2A 2JYLA 2BHVA 3CCUP 1D1DA 1YI2P 1BAJA 3DS4A 1M1KQ 2PEMA 2LF4A 1K9MQ 1VQPP 5I4TG 1A43A 3DPHA 3WBHA 3CCQP 1RO2A 1VQLP 3CCSP 2PY8A 3Q20A 2ONTA 2Z45A 3MGEA 1NJIQ 2XV6A 4XFYA 1Q82Q 2M8PA 2XT1A 1VQOP 2L6EA 1VQ8P 3G1IA 3H0DA 1M6NA 3G21A 1K8AQ 1VQMP 1YJ9P 4COPA 5HGOA 1M74A 3G28A 3DS3A 3CCEP 3CC2P 3CMEP 2DGYA 1KD1Q 1W2BO 1Q81Q 5HGMA 1VQKP 3I56P 1YHQP 4XFXA 2PEQA 3DS1A 2P9XA 4M0IA 3VRLC 1VQ6P 2OTJP 3G6EP 3G29A 1VQ7P 1E6JP 2QA4P 3CC4P 1VQ5P 1KC8Q 5F2OA 2EG5A 3DS5A 3CCMP 1K30A 3M1MA 1A8OA 3DS0A 1Q86Q 2M8LA 2M8NA 4U0AA 3CD6P 1M6EX 1VQ4P 1EOQA 1RO0A 2Z44A 1QRJA 2CWOA 2EFJA 4XFZA 5HGNA 1RNIA 4U0BA 3CCLP 2OTLP 2PEOA 4XRQA 5BS1A 3OW2O 3CCVP 1ZMBA 4IPYA 3B5IA 3I55P 1QVGO 5F2KA 5F2NA 1Q7YQ 3H47A 1EIAA 4U0CA 1YJNP 2Z46A 3G0VA 2E1MA 4GR2A 3HZQA 3E2DA 2OARA 4PH0A 1YIJP 2PEJA 1YJWP 1JJ2O 2PEKA 4QNBA 3CC7P 3LRYA 1VQ9P 1N8RQ 2KODA 3NTEA 5JPAA 2QEXP 2BUOA 5DCKA 4U0FA 1AUMA 2XXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF4 A;  4XRQ A;  3P05 A;  5I4T G;  1A43 A;  3DPH A;  4WYM A;  4IPY A;  4XFX A;  3DS1 A;  3H47 A;  1EIA A;  4M0I A;  3DS2 A;  4PH1 A;  2ONT A;  4U0C A;  3VRL C;  4COC A;  3G1G A;  3MGE A;  3G29 A;  3H4E A;  1E6J P;  2XV6 A;  4U0D A;  3G0V A;  4XFY A;  3G26 A;  2M8P A;  2XT1 A;  2EIA A;  3DS5 A;  4U0E A;  4PH0 A;  1A8O A;  2JYG A;  2L6E A;  3DS0 A;  3DTJ A;  4XRO A;  3G1I A;  5HGL A;  2M8L A;  2M8N A;  3G21 A;  4U0A A;  2JO0 A;  4QNB A;  4COP A;  5HGO A;  3LRY A;  5HGM A;  1EOQ A;  3DS3 A;  3G28 A;  2JYL A;  1QRJ A;  4XFZ A;  5HGN A;  2KOD A;  3NTE A;  4U0B A;  5JPA A;  1D1D A;  2BUO A;  5DCK A;  1BAJ A;  4U0F A;  1AUM A;  2XXM A;  3DS4 A; 
#chains in the Genus database with same CATH topology
 4H2Y C;  5KP6 B;  3CCR P;  1YIT P;  2GYK A;  4IZ6 A;  4PH1 A;  1NQ4 A;  2N98 A;  3LMO A;  1KQS O;  2GZF A;  2PEI A;  2EIA A;  1UNK A;  2KG8 A;  3HYB A;  4XRO A;  1BXI A;  2DNW A;  3GJN A;  1E0H A;  1YI2 P;  5HV8 A;  1M1K Q;  2CG5 B;  1K9M Q;  3WBH A;  3CCQ P;  2LIW A;  3CCS P;  2JBG A;  3Q20 A;  3U43 A;  3MGE A;  2KG9 A;  1Q82 Q;  2XT1 A;  2JU1 A;  3EJE A;  2L6E A;  3EJD A;  1AF8 A;  3H0D A;  1VQM P;  5HGO A;  3CC2 P;  1ACP A;  1FR2 A;  2EHT A;  5HGM A;  1VQK P;  2FAE A;  2KOR A;  4CA3 A;  2FVA A;  3I56 P;  4XFX A;  2L4B A;  2KOS A;  5F2O A;  2EG5 A;  1K30 A;  3GZL A;  3M1M A;  1KLP A;  3DS0 A;  4DG9 A;  2M8L A;  4U0A A;  2L22 A;  2KR5 A;  5HGN A;  3CCL P;  2LKI A;  2FQ1 A;  5BS1 A;  2JU2 A;  2L0Q A;  5F2N A;  1YJN P;  5CZD B;  3G0V A;  4GR2 A;  1VKU A;  2OAR A;  1YIJ P;  1YJW P;  1JJ2 O;  4QNB A;  2MY5 A;  3LRY A;  5EJD A;  1VQ9 P;  4H2X C;  5DCK A;  2XXM A;  2MVV A;  3DS2 A;  3CMA P;  3G71 P;  7CEI A;  4GR6 A;  1VQN P;  2JAZ A;  1M90 Q;  1IUQ A;  2N5H A;  3RG2 A;  4UHP B;  5BS2 A;  2N5I A;  2JYL A;  2XZ0 D;  2KOO A;  2BHV A;  2N6Y A;  1AYI A;  2LF4 A;  2JGP A;  2PY8 A;  2VSQ A;  2WPT A;  2Z45 A;  2KOQ A;  4XFY A;  2K93 A;  2ROQ A;  1L0I A;  4H2W C;  1K8A Q;  2XZ1 C;  4COP A;  2PNG A;  1Q81 Q;  1YHQ P;  3G6E P;  1ZNV A;  2QA4 P;  2AF8 A;  2GZG A;  3CC4 P;  3CCM P;  2K92 A;  2M8N A;  1GPJ A;  2X2B A;  2JB0 A;  1M6E X;  1VQ4 P;  1EOQ A;  1RO0 A;  2EFJ A;  2CGQ A;  1L0H A;  1EMV A;  1QVG O;  5F2K A;  2MR7 A;  2LL8 A;  5KP8 B;  2CNR A;  2E1M A;  3HZQ A;  2GDW A;  2PEJ A;  2KWL A;  2LIU A;  2KOP A;  1GXG A;  5JPA A;  2BUO A;  1OR5 A;  3P05 A;  2FVF A;  4PWV B;  1S72 P;  4COC A;  3CCJ P;  3H4E A;  2FHS C;  2FAC A;  4U0D A;  3CPW O;  3CXC O;  4U0E A;  1MZ8 A;  1VHN A;  2JYG A;  2KW2 A;  2FVE A;  5HGL A;  3G4S P;  2PEN A;  2K0D X;  3CCU P;  3CE7 A;  2FQ0 A;  1VQP P;  5I4T G;  1A43 A;  3DPH A;  1IMQ A;  2KGD A;  2K0X A;  1VQL P;  2ONT A;  1GXH A;  1NJI Q;  2XV6 A;  2M8P A;  4QKO A;  2AFE A;  1VQ8 P;  1M6N A;  2AFD A;  3GKL C;  3CME P;  2DGY A;  1KD1 Q;  2LTE A;  2PEQ A;  4M0I A;  2KGE A;  1T8K A;  3G29 A;  1E6J P;  1VQ7 P;  4NEO A;  2K0Y A;  2GDX A;  2M5R A;  3DS5 A;  5HVC A;  2GZI A;  2N50 A;  3CD6 P;  4PXH B;  2Z44 A;  4XFZ A;  2NO8 A;  2PEO A;  4XRQ A;  1ZMB A;  2MD9 A;  3B5I A;  4IPY A;  1HQB A;  1Q7Y Q;  3H47 A;  4U0C A;  5EW5 E;  2LOL A;  4F37 A;  2FAD A;  4BPH A;  2PEK A;  2CQ8 A;  3CC7 P;  1N8R Q;  2GZJ A;  2KOD A;  2QEX P;  4U0F A;  4R0M A;  1CEI A;  2K2Q A;  4WYM A;  2KG6 A;  1K73 Q;  2K94 A;  3RG6 C;  2FQ2 A;  2AVA A;  4HKG A;  3G1G A;  2VLQ A;  2L9F A;  2LPK A;  2MR8 A;  3G26 A;  1QVF O;  3DTJ A;  2VLO A;  2JO0 A;  1DNY A;  1D1D A;  2JQ4 A;  1BAJ A;  1HY8 A;  3DS4 A;  1F80 D;  2PEM A;  3B4Q A;  2N6Z A;  2VLN A;  1RO2 A;  2VLP A;  1DV5 A;  1VQO P;  1UJZ A;  2GZE A;  4MRT C;  3G1I A;  3G21 A;  2GDY A;  1YJ9 P;  2ERH A;  1M74 A;  3DS3 A;  3G28 A;  3CCE P;  2EHS A;  4BPF A;  1W2B O;  2KGA A;  1Z6M A;  3DS1 A;  2P9X A;  3VRL C;  1VQ6 P;  5KP7 B;  2OTJ P;  1VQ5 P;  2MVU A;  1KC8 Q;  1A8O A;  1Q86 Q;  2QNW A;  3EJB A;  1QRJ A;  2CWO A;  1RNI A;  4U0B A;  2OTL P;  2MF4 A;  3OW2 O;  3CCV P;  3I55 P;  1EIA A;  2KGC A;  2Z46 A;  3NY7 B;  3E2D A;  4PH0 A;  2LML A;  1IMP A;  4BPG A;  3GZM A;  1X3O A;  3NTE A;  2K5X A;  1AUM A; 
#chains in the Genus database with same CATH homology
 3P05 A;  4WYM A;  3CCR P;  1YIT P;  1K73 Q;  1S72 P;  3RG6 C;  3DS2 A;  4PH1 A;  4COC A;  3CMA P;  3G71 P;  3G1G A;  4GR6 A;  3CCJ P;  3H4E A;  1KQS O;  1VQN P;  2PEI A;  4U0D A;  3G26 A;  3CPW O;  1QVF O;  2EIA A;  3CXC O;  1M90 Q;  4U0E A;  1IUQ A;  3HYB A;  2JYG A;  3DTJ A;  4XRO A;  5HGL A;  3G4S P;  2JO0 A;  2PEN A;  5BS2 A;  2JYL A;  2BHV A;  3CCU P;  1D1D A;  1YI2 P;  1BAJ A;  3DS4 A;  1M1K Q;  2PEM A;  2LF4 A;  1K9M Q;  1VQP P;  5I4T G;  1A43 A;  3DPH A;  3WBH A;  3CCQ P;  1RO2 A;  1VQL P;  3CCS P;  2PY8 A;  3Q20 A;  2ONT A;  2Z45 A;  3MGE A;  1NJI Q;  2XV6 A;  4XFY A;  1Q82 Q;  2M8P A;  2XT1 A;  1VQO P;  2L6E A;  1VQ8 P;  3G1I A;  3H0D A;  1M6N A;  3G21 A;  1K8A Q;  1VQM P;  1YJ9 P;  4COP A;  5HGO A;  1M74 A;  3G28 A;  3DS3 A;  3CCE P;  3CC2 P;  3CME P;  2DGY A;  1KD1 Q;  1W2B O;  1Q81 Q;  5HGM A;  1VQK P;  3I56 P;  1YHQ P;  4XFX A;  2PEQ A;  3DS1 A;  2P9X A;  4M0I A;  3VRL C;  1VQ6 P;  2OTJ P;  3G6E P;  3G29 A;  1VQ7 P;  1E6J P;  2QA4 P;  3CC4 P;  1VQ5 P;  1KC8 Q;  5F2O A;  2EG5 A;  3DS5 A;  3CCM P;  1K30 A;  3M1M A;  1A8O A;  3DS0 A;  1Q86 Q;  2M8L A;  2M8N A;  4U0A A;  3CD6 P;  1M6E X;  1VQ4 P;  1EOQ A;  1RO0 A;  2Z44 A;  1QRJ A;  2CWO A;  2EFJ A;  4XFZ A;  5HGN A;  1RNI A;  4U0B A;  3CCL P;  2OTL P;  2PEO A;  4XRQ A;  5BS1 A;  3OW2 O;  3CCV P;  1ZMB A;  4IPY A;  3B5I A;  3I55 P;  1QVG O;  5F2K A;  5F2N A;  1Q7Y Q;  3H47 A;  1EIA A;  4U0C A;  1YJN P;  2Z46 A;  3G0V A;  2E1M A;  4GR2 A;  3HZQ A;  3E2D A;  2OAR A;  4PH0 A;  1YIJ P;  2PEJ A;  1YJW P;  1JJ2 O;  2PEK A;  4QNB A;  3CC7 P;  3LRY A;  1VQ9 P;  1N8R Q;  2KOD A;  3NTE A;  5JPA A;  2QEX P;  2BUO A;  5DCK A;  4U0F A;  1AUM A;  2XXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...