3DS3A

Hiv-1 capsid c-terminal domain mutant (y169a) in complex with an inhibitor of particle assembly (cai)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
73
structure length
73
Chain Sequence
TSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 26
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds3A00
3G26A 1QRJA 4U0FA 4U0CA 2EIAA 3DS3A 2XXMA 5HGLA 4XRQA 4WYMA 3DS0A 2KODA 4XFXA 3G29A 2JO0A 3MGEA 1E6JP 3DS2A 1A43A 5HGMA 3P05A 2BUOA 2ONTA 1A8OA 3H47A 4XFZA 4QNBA 5DCKA 3DS4A 2XT1A 4IPYA 3DS5A 3G28A 4XFYA 4U0EA 2M8LA 2JYLA 4COCA 4COPA 2LF4A 5HGNA 3G1IA 2M8PA 3NTEA 1EOQA 4XROA 1BAJA 3VRLC 4U0BA 2XV6A 4PH1A 3G21A 1EIAA 3G1GA 2JYGA 3DPHA 4U0AA 2L6EA 4PH0A 1D1DA 5I4TG 2M8NA 3H4EA 3DS1A 5HGOA 3DTJA 3LRYA 4M0IA 4U0DA 5JPAA 3G0VA 1AUMA
chains in the Genus database with same CATH superfamily
2KORA 1BXIA 3CMEP 2JAZA 4CA3A 2GZJA 1Q81Q 2GDWA 3G6EP 1X3OA 4COPA 3NTEA 5HV8A 2M5RA 2JQ4A 5KP6B 4M0IA 2K92A 1IMQA 1RNIA 5HGLA 2VLPA 3DS0A 2VLQA 3G29A 1VQLP 2KWLA 3CCRP 2PEJA 4DG9A 1S72P 2PENA 2DGYA 2AFEA 2CG5B 2EHSA 2L4BA 3G1GA 1VQ7P 2XZ0D 1VQMP 3CC7P 2MVUA 4U0DA 1VQ6P 3CCMP 2FQ2A 3CCLP 1YITP 2ONTA 2XZ1C 1IMPA 4R0MA 3CPWO 4U0EA 1CEIA 2KGDA 2LF4A 2CNRA 3M1MA 2LPKA 1Q7YQ 2JB0A 3OW2O 1M90Q 1VQNP 3GZLA 2GDXA 2N50A 2FVFA 2XXMA 1EMVA 2JO0A 2EFJA 2GZEA 1VQ4P 1Z6MA 4F37A 3G4SP 1DNYA 2MVVA 2KGEA 1Q86Q 2XV6A 2JBGA 1K9MQ 2FHSC 2PEMA 5HGOA 2FVAA 4H2XC 5JPAA 2FADA 2N6YA 1E6JP 2Z46A 3EJBA 3P05A 2PEOA 3DS4A 2KG8A 2JU2A 4IZ6A 5HVCA 2N5HA 4PH1A 2K0YA 3DPHA 2KW2A 2M8NA 5EW5E 1KLPA 2Z45A 3I56P 3LMOA 2KGCA 1YJWP 2VLNA 1VHNA 1GXHA 3EJEA 1Q82Q 2MD9A 2KOOA 2LIUA 2L6EA 1K8AQ 2KR5A 5F2OA 1ACPA 2LL8A 4U0CA 2K94A 4WYMA 2AVAA 2CQ8A 1VQ8P 1NJIQ 1VQ5P 2LOLA 1EOQA 2FACA 1NQ4A 3GKLC 1GXGA 3B5IA 2L0QA 1QVGO 1DV5A 3GJNA 2FQ1A 5I4TG 3H4EA 5KP8B 3LRYA 3G0VA 2DNWA 3HYBA 2KOPA 3CCSP 2JU1A 4QNBA 2K93A 4IPYA 1KQSO 1M1KQ 5CZDB 5BS2A 2M8PA 4H2WC 5F2KA 1FR2A 2K0XA 1HY8A 2FVEA 2ERHA 1KD1Q 2EHTA 1QVFO 2VSQA 1VQKP 2PNGA 2KOSA 2BUOA 1A8OA 1IUQA 1M6EX 3HZQA 2JYLA 1VQOP 3CCJP 3U43A 2GZGA 5HGNA 4XROA 3VRLC 4BPFA 7CEIA 2JYGA 4U0AA 3Q20A 2PEIA 2X2BA 1RO2A 3DTJA 2LIWA 1F80D 1HQBA 1UJZA 5BS1A 3G26A 1GPJA 2PY8A 2KODA 2E1MA 3MGEA 1K30A 1AYIA 3G28A 4QKOA 3G71P 2GYKA 1AF8A 2NO8A 2KGAA 1YI2P 3WBHA 2N5IA 2EG5A 1UNKA 2KG9A 4BPHA 1N8RQ 2GZIA 3H0DA 1KC8Q 3NY7B 3I55P 4U0BA 5KP7B 1VKUA 1YJNP 1K73Q 1QRJA 1RO0A 4MRTC 4XRQA 2K2QA 2VLOA 2OARA 1A43A 1M74A 2N6ZA 3CE7A 2AF8A 1ZMBA 4PXHB 3G1IA 4PWVB 2K0DX 2OTJP 3B4QA 2QA4P 2MR8A 1E0HA 3DS2A 3DS3A 3CCVP 1L0IA 5HGMA 5DCKA 2KG6A 2XT1A 1VQPP 2WPTA 1MZ8A 2L22A 2PEQA 1YJ9P 4U0FA 2EIAA 2QNWA 1YHQP 4H2YC 1T8KA 1ZNVA 2FAEA 3EJDA 1W2BO 2M8LA 1YIJP 3CC4P 2N98A 1VQ9P 2LMLA 1D1DA 4GR2A 2CGQA 2L9FA 2MF4A 1JJ2O 2OTLP 3CCEP 2MY5A 3RG6C 2GZFA 2LKIA 3DS5A 2PEKA 4UHPB 5F2NA 4COCA 2KOQA 4BPGA 3RG2A 3CC2P 2CWOA 3CXCO 3G21A 2Z44A 4PH0A 2AFDA 2LTEA 4HKGA 3DS1A 3E2DA 1L0HA 2P9XA 2FQ0A 2MR7A 4XFXA 4GR6A 1OR5A 3H47A 3CD6P 4XFZA 3GZMA 2GDYA 4XFYA 4NEOA 5EJDA 3CCQP 2BHVA 1BAJA 2JGPA 3CCUP 1EIAA 2QEXP 2K5XA 3CMAP 1M6NA 2ROQA 1AUMA
chains in the Genus database with same CATH topology
1QVFO 3DS3A 3CMEP 3CCVP 1VQKP 1E6JP 5HGMA 2Z46A 3P05A 2BUOA 1Q81Q 1A8OA 2PEOA 5DCKA 1IUQA 3DS4A 2XT1A 1M6EX 3G6EP 3HZQA 2JYLA 1VQOP 3CCJP 4COPA 5HGNA 3NTEA 4XROA 3VRLC 4PH1A 1VQPP 2JYGA 3DPHA 4U0AA 2M8NA 3Q20A 2PEIA 1RO2A 3DTJA 4M0IA 5BS1A 2PEQA 3G26A 2Z45A 4U0FA 1YJ9P 2EIAA 1RNIA 1YHQP 5HGLA 3DS0A 2PY8A 2KODA 3G29A 1VQLP 2E1MA 3MGEA 3CCRP 1K30A 2PEJA 3I56P 3G28A 1YJWP 1W2BO 1S72P 2PENA 2M8LA 2DGYA 3G71P 1YIJP 3CC4P 1Q82Q 1VQ9P 3G1GA 1VQ7P 2L6EA 1YI2P 1D1DA 1K8AQ 1AUMA 1VQMP 5F2OA 3CC7P 4U0DA 4GR2A 3WBHA 1VQ6P 4U0CA 3CCMP 4WYMA 2EG5A 1JJ2O 3CCLP 2OTLP 1YITP 2ONTA 3CCEP 1VQ8P 1N8RQ 3RG6C 3DS5A 3CPWO 1NJIQ 2PEKA 1VQ5P 4U0EA 3H0DA 1KC8Q 5F2NA 4COCA 3I55P 2LF4A 1EOQA 3CC2P 4U0BA 2CWOA 3CXCO 3B5IA 3G21A 1QVGO 2Z44A 4PH0A 3M1MA 1Q7YQ 5I4TG 3H4EA 3DS1A 3OW2O 3E2DA 2P9XA 3LRYA 1YJNP 1M90Q 1VQNP 3G0VA 1K73Q 1QRJA 1RO0A 2XXMA 3HYBA 4XRQA 4XFXA 2JO0A 2EFJA 3CCSP 2OARA 4GR6A 1A43A 3H47A 1M74A 3CD6P 4XFZA 4QNBA 1VQ4P 4IPYA 1KQSO 4XFYA 3G4SP 1ZMBA 1M1KQ 5BS2A 3CCQP 3G1IA 2M8PA 2BHVA 1BAJA 3CCUP 1Q86Q 2XV6A 1EIAA 2QEXP 1K9MQ 5F2KA 2PEMA 2OTJP 3CMAP 2QA4P 1M6NA 5HGOA 5JPAA 1KD1Q 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G26 A;  1QRJ A;  4U0F A;  4U0C A;  2EIA A;  3DS3 A;  2XXM A;  5HGL A;  4XRQ A;  4WYM A;  3DS0 A;  2KOD A;  4XFX A;  3G29 A;  2JO0 A;  3MGE A;  1E6J P;  3DS2 A;  1A43 A;  5HGM A;  3P05 A;  2BUO A;  2ONT A;  1A8O A;  3H47 A;  4XFZ A;  4QNB A;  5DCK A;  3DS4 A;  2XT1 A;  4IPY A;  3DS5 A;  3G28 A;  4XFY A;  4U0E A;  2M8L A;  2JYL A;  4COC A;  4COP A;  2LF4 A;  5HGN A;  3G1I A;  2M8P A;  3NTE A;  1EOQ A;  4XRO A;  1BAJ A;  3VRL C;  4U0B A;  2XV6 A;  4PH1 A;  3G21 A;  1EIA A;  3G1G A;  2JYG A;  3DPH A;  4U0A A;  2L6E A;  4PH0 A;  1D1D A;  5I4T G;  2M8N A;  3H4E A;  3DS1 A;  5HGO A;  3DTJ A;  3LRY A;  4M0I A;  4U0D A;  5JPA A;  3G0V A;  1AUM A; 
#chains in the Genus database with same CATH topology
 2KOR A;  1BXI A;  3CME P;  2JAZ A;  4CA3 A;  2GZJ A;  1Q81 Q;  2GDW A;  3G6E P;  1X3O A;  4COP A;  3NTE A;  5HV8 A;  2M5R A;  2JQ4 A;  5KP6 B;  4M0I A;  2K92 A;  1IMQ A;  1RNI A;  5HGL A;  2VLP A;  3DS0 A;  2VLQ A;  3G29 A;  1VQL P;  2KWL A;  3CCR P;  2PEJ A;  4DG9 A;  1S72 P;  2PEN A;  2DGY A;  2AFE A;  2CG5 B;  2EHS A;  2L4B A;  3G1G A;  1VQ7 P;  2XZ0 D;  1VQM P;  3CC7 P;  2MVU A;  4U0D A;  1VQ6 P;  3CCM P;  2FQ2 A;  3CCL P;  1YIT P;  2ONT A;  2XZ1 C;  1IMP A;  4R0M A;  3CPW O;  4U0E A;  1CEI A;  2KGD A;  2LF4 A;  2CNR A;  3M1M A;  2LPK A;  1Q7Y Q;  2JB0 A;  3OW2 O;  1M90 Q;  1VQN P;  3GZL A;  2GDX A;  2N50 A;  2FVF A;  2XXM A;  1EMV A;  2JO0 A;  2EFJ A;  2GZE A;  1VQ4 P;  1Z6M A;  4F37 A;  3G4S P;  1DNY A;  2MVV A;  2KGE A;  1Q86 Q;  2XV6 A;  2JBG A;  1K9M Q;  2FHS C;  2PEM A;  5HGO A;  2FVA A;  4H2X C;  5JPA A;  2FAD A;  2N6Y A;  1E6J P;  2Z46 A;  3EJB A;  3P05 A;  2PEO A;  3DS4 A;  2KG8 A;  2JU2 A;  4IZ6 A;  5HVC A;  2N5H A;  4PH1 A;  2K0Y A;  3DPH A;  2KW2 A;  2M8N A;  5EW5 E;  1KLP A;  2Z45 A;  3I56 P;  3LMO A;  2KGC A;  1YJW P;  2VLN A;  1VHN A;  1GXH A;  3EJE A;  1Q82 Q;  2MD9 A;  2KOO A;  2LIU A;  2L6E A;  1K8A Q;  2KR5 A;  5F2O A;  1ACP A;  2LL8 A;  4U0C A;  2K94 A;  4WYM A;  2AVA A;  2CQ8 A;  1VQ8 P;  1NJI Q;  1VQ5 P;  2LOL A;  1EOQ A;  2FAC A;  1NQ4 A;  3GKL C;  1GXG A;  3B5I A;  2L0Q A;  1QVG O;  1DV5 A;  3GJN A;  2FQ1 A;  5I4T G;  3H4E A;  5KP8 B;  3LRY A;  3G0V A;  2DNW A;  3HYB A;  2KOP A;  3CCS P;  2JU1 A;  4QNB A;  2K93 A;  4IPY A;  1KQS O;  1M1K Q;  5CZD B;  5BS2 A;  2M8P A;  4H2W C;  5F2K A;  1FR2 A;  2K0X A;  1HY8 A;  2FVE A;  2ERH A;  1KD1 Q;  2EHT A;  1QVF O;  2VSQ A;  1VQK P;  2PNG A;  2KOS A;  2BUO A;  1A8O A;  1IUQ A;  1M6E X;  3HZQ A;  2JYL A;  1VQO P;  3CCJ P;  3U43 A;  2GZG A;  5HGN A;  4XRO A;  3VRL C;  4BPF A;  7CEI A;  2JYG A;  4U0A A;  3Q20 A;  2PEI A;  2X2B A;  1RO2 A;  3DTJ A;  2LIW A;  1F80 D;  1HQB A;  1UJZ A;  5BS1 A;  3G26 A;  1GPJ A;  2PY8 A;  2KOD A;  2E1M A;  3MGE A;  1K30 A;  1AYI A;  3G28 A;  4QKO A;  3G71 P;  2GYK A;  1AF8 A;  2NO8 A;  2KGA A;  1YI2 P;  3WBH A;  2N5I A;  2EG5 A;  1UNK A;  2KG9 A;  4BPH A;  1N8R Q;  2GZI A;  3H0D A;  1KC8 Q;  3NY7 B;  3I55 P;  4U0B A;  5KP7 B;  1VKU A;  1YJN P;  1K73 Q;  1QRJ A;  1RO0 A;  4MRT C;  4XRQ A;  2K2Q A;  2VLO A;  2OAR A;  1A43 A;  1M74 A;  2N6Z A;  3CE7 A;  2AF8 A;  1ZMB A;  4PXH B;  3G1I A;  4PWV B;  2K0D X;  2OTJ P;  3B4Q A;  2QA4 P;  2MR8 A;  1E0H A;  3DS2 A;  3DS3 A;  3CCV P;  1L0I A;  5HGM A;  5DCK A;  2KG6 A;  2XT1 A;  1VQP P;  2WPT A;  1MZ8 A;  2L22 A;  2PEQ A;  1YJ9 P;  4U0F A;  2EIA A;  2QNW A;  1YHQ P;  4H2Y C;  1T8K A;  1ZNV A;  2FAE A;  3EJD A;  1W2B O;  2M8L A;  1YIJ P;  3CC4 P;  2N98 A;  1VQ9 P;  2LML A;  1D1D A;  4GR2 A;  2CGQ A;  2L9F A;  2MF4 A;  1JJ2 O;  2OTL P;  3CCE P;  2MY5 A;  3RG6 C;  2GZF A;  2LKI A;  3DS5 A;  2PEK A;  4UHP B;  5F2N A;  4COC A;  2KOQ A;  4BPG A;  3RG2 A;  3CC2 P;  2CWO A;  3CXC O;  3G21 A;  2Z44 A;  4PH0 A;  2AFD A;  2LTE A;  4HKG A;  3DS1 A;  3E2D A;  1L0H A;  2P9X A;  2FQ0 A;  2MR7 A;  4XFX A;  4GR6 A;  1OR5 A;  3H47 A;  3CD6 P;  4XFZ A;  3GZM A;  2GDY A;  4XFY A;  4NEO A;  5EJD A;  3CCQ P;  2BHV A;  1BAJ A;  2JGP A;  3CCU P;  1EIA A;  2QEX P;  2K5X A;  3CMA P;  1M6N A;  2ROQ A;  1AUM A; 
#chains in the Genus database with same CATH homology
 1QVF O;  3DS3 A;  3CME P;  3CCV P;  1VQK P;  1E6J P;  5HGM A;  2Z46 A;  3P05 A;  2BUO A;  1Q81 Q;  1A8O A;  2PEO A;  5DCK A;  1IUQ A;  3DS4 A;  2XT1 A;  1M6E X;  3G6E P;  3HZQ A;  2JYL A;  1VQO P;  3CCJ P;  4COP A;  5HGN A;  3NTE A;  4XRO A;  3VRL C;  4PH1 A;  1VQP P;  2JYG A;  3DPH A;  4U0A A;  2M8N A;  3Q20 A;  2PEI A;  1RO2 A;  3DTJ A;  4M0I A;  5BS1 A;  2PEQ A;  3G26 A;  2Z45 A;  4U0F A;  1YJ9 P;  2EIA A;  1RNI A;  1YHQ P;  5HGL A;  3DS0 A;  2PY8 A;  2KOD A;  3G29 A;  1VQL P;  2E1M A;  3MGE A;  3CCR P;  1K30 A;  2PEJ A;  3I56 P;  3G28 A;  1YJW P;  1W2B O;  1S72 P;  2PEN A;  2M8L A;  2DGY A;  3G71 P;  1YIJ P;  3CC4 P;  1Q82 Q;  1VQ9 P;  3G1G A;  1VQ7 P;  2L6E A;  1YI2 P;  1D1D A;  1K8A Q;  1AUM A;  1VQM P;  5F2O A;  3CC7 P;  4U0D A;  4GR2 A;  3WBH A;  1VQ6 P;  4U0C A;  3CCM P;  4WYM A;  2EG5 A;  1JJ2 O;  3CCL P;  2OTL P;  1YIT P;  2ONT A;  3CCE P;  1VQ8 P;  1N8R Q;  3RG6 C;  3DS5 A;  3CPW O;  1NJI Q;  2PEK A;  1VQ5 P;  4U0E A;  3H0D A;  1KC8 Q;  5F2N A;  4COC A;  3I55 P;  2LF4 A;  1EOQ A;  3CC2 P;  4U0B A;  2CWO A;  3CXC O;  3B5I A;  3G21 A;  1QVG O;  2Z44 A;  4PH0 A;  3M1M A;  1Q7Y Q;  5I4T G;  3H4E A;  3DS1 A;  3OW2 O;  3E2D A;  2P9X A;  3LRY A;  1YJN P;  1M90 Q;  1VQN P;  3G0V A;  1K73 Q;  1QRJ A;  1RO0 A;  2XXM A;  3HYB A;  4XRQ A;  4XFX A;  2JO0 A;  2EFJ A;  3CCS P;  2OAR A;  4GR6 A;  1A43 A;  3H47 A;  1M74 A;  3CD6 P;  4XFZ A;  4QNB A;  1VQ4 P;  4IPY A;  1KQS O;  4XFY A;  3G4S P;  1ZMB A;  1M1K Q;  5BS2 A;  3CCQ P;  3G1I A;  2M8P A;  2BHV A;  1BAJ A;  3CCU P;  1Q86 Q;  2XV6 A;  1EIA A;  2QEX P;  1K9M Q;  5F2K A;  2PEM A;  2OTJ P;  3CMA P;  2QA4 P;  1M6N A;  5HGO A;  5JPA A;  1KD1 Q;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...