4HKGA

Crystal structure of free-standing peptidyl carrier protein from uncharacterized acinetobacter baumannii secondary metabolic pathway
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
NKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVALSVSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine attachment site family protein
publication title Structural and bioinformatic characterization of an Acinetobacter baumannii type II carrier protein.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Phosphopantetheine binding protein
total genus 26
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4hkgA00
1VKUA 2KOQA 1AF8A 2AVAA 2L0QA 4H2XC 2KG9A 2K93A 2AFEA 2PNGA 2CQ8A 2N6ZA 4HKGA 2GDWA 3LMOA 4DG9A 2XZ1C 2LIUA 2K2QA 3EJBA 2GDXA 1KLPA 3EJDA 2KGDA 2AFDA 2FAEA 2KG6A 2LIWA 2CNRA 4H2WC 2MVUA 2LL8A 2KOOA 1HY8A 2FADA 1DV5A 2KGCA 2CGQA 2L9FA 2FACA 5KP7B 2L22A 5KP6B 4R0MA 2MF4A 1X3OA 2K92A 4PXHB 1F80D 2LPKA 2FVAA 2CG5B 2DNWA 1HQBA 2N50A 2L4BA 2MVVA 2KW2A 1L0HA 2JU1A 2KGEA 2KG8A 4CA3A 2K0XA 2MY5A 3NY7B 2VSQA 2JGPA 2FQ1A 2MR8A 5CZDB 5EJDA 4NEOA 4BPFA 2K0YA 4H2YC 3CE7A 2EHTA 2LOLA 2LMLA 2KGAA 2N98A 2KORA 5HV8A 2QNWA 4BPHA 2KOPA 2N5HA 3EJEA 2FHSC 2EHSA 2JU2A 1L0IA 2MR7A 2KR5A 1NQ4A 4IZ6A 2GDYA 2JQ4A 1DNYA 2KOSA 2M5RA 1ACPA 2ROQA 2FQ0A 3RG2A 2LKIA 4BPGA 2XZ0D 5HVCA 5KP8B 4PWVB 2X2BA 4MRTC 2K94A 3GZLA 2AF8A 2N6YA 2N5IA 3GZMA 2MD9A 2FQ2A 1OR5A 2FVFA 1T8KA 2FVEA 2LTEA 2KWLA
chains in the Genus database with same CATH superfamily
1AF8A 4H2XC 2JB0A 2Z46A 3P05A 2QEXP 3OW2O 1AUMA 2VLQA 1Z6MA 4HKGA 2GDWA 4DG9A 5I4TG 3EJBA 2KODA 2XT1A 4M0IA 3DPHA 2AFDA 5EW5E 2FAEA 3CCUP 2KG6A 2CNRA 2KOOA 2ONTA 1HY8A 1IMQA 1VQ4P 1DV5A 1Q7YQ 2KGCA 2BHVA 1VQ6P 1VQLP 3VRLC 2GZFA 2M8NA 3CC2P 4PXHB 1F80D 4XFZA 1E6JP 2LPKA 2PEOA 2FVAA 3G0VA 3CCMP 2L4BA 2MVVA 1VQ8P 3CC4P 1Q82Q 1MZ8A 2K0YA 1GXGA 2PEQA 5HGLA 2M8PA 3B4QA 2KORA 2PEMA 2DGYA 3HZQA 1E0HA 1M6EX 2XV6A 2WPTA 1GXHA 2L6EA 3EJEA 2JAZA 3CCEP 2EHSA 2GZGA 1L0IA 2JYGA 4IZ6A 2JQ4A 4COPA 1ACPA 2ROQA 1RO2A 2M8LA 1A43A 4PH0A 1ZNVA 5KP8B 4MRTC 1UNKA 3G4SP 2N6YA 4U0DA 2FQ2A 2FVFA 1QVGO 3CCQP 2FVEA 2LTEA 1VKUA 2LF4A 2EIAA 2E1MA 3CCJP 2K93A 2PNGA 2CQ8A 2N6ZA 1KQSO 1JJ2O 3G26A 2PEJA 3DTJA 3RG6C 2GDXA 1S72P 2OTLP 2OTJP 4H2WC 1M90Q 2OARA 4U0AA 1RNIA 3CPWO 2CGQA 1CEIA 2FACA 1VQPP 2MF4A 1X3OA 4QKOA 1KD1Q 1NJIQ 4GR2A 1KC8Q 2N50A 2KG8A 2K0XA 2MY5A 3U43A 4U0CA 5CZDB 3DS4A 3G21A 4H2YC 2LOLA 3CMAP 1VQOP 2LMLA 3DS2A 1RO0A 3GJNA 2CWOA 3G71P 3GKLC 1EMVA 1QVFO 2Z44A 2GZIA 1NQ4A 1VQ9P 1W2BO 1M74A 2KOSA 1K73Q 2XZ0D 3M1MA 5F2KA 4PWVB 1BAJA 3CXCO 2MD9A 2PEKA 1OR5A 2K5XA 3G6EP 2KWLA 3H0DA 1YJWP 1K9MQ 1EIAA 2KOQA 5F2NA 2P9XA 3CCRP 1GPJA 2JO0A 3CCVP 2AFEA 2VLNA 3WBHA 1A8OA 3CCSP 2LIUA 3B5IA 5HGOA 2EG5A 2K2QA 2NO8A 2PENA 1KLPA 3EJDA 2KGDA 3I55P 2MVUA 2LL8A 1FR2A 2FADA 3HYBA 2L9FA 3H4EA 2GZEA 5KP7B 1K30A 2L22A 4R0MA 2JYLA 2K92A 2PY8A 3MGEA 3DS3A 1AYIA 1Q81Q 1YITP 1HQBA 1L0HA 2JU1A 2KGEA 4CA3A 3G28A 3NY7B 2GYKA 2MR8A 3G1GA 4NEOA 4BPFA 4UHPB 3CE7A 2EHTA 2BUOA 2KGAA 3DS1A 2N98A 3DS0A 4BPHA 1YHQP 1IMPA 2MR7A 2KR5A 4XRQA 1VQ5P 1N8RQ 1D1DA 2GDYA 3CD6P 1DNYA 2VLOA 2M5RA 3RG2A 3CC7P 2LKIA 4F37A 5HVCA 1UJZA 1VQNP 2X2BA 2K94A 4IPYA 2AF8A 2N5IA 1VQMP 4U0FA 1YIJP 1T8KA 2PEIA 4QNBA 3CCLP 4WYMA 2AVAA 2L0QA 2KG9A 1M6NA 2JBGA 2Z45A 7CEIA 1VHNA 1BXIA 1YJ9P 5F2OA 4U0BA 3LMOA 2XZ1C 2GZJA 5BS2A 3I56P 1VQ7P 2LIWA 3Q20A 5DCKA 3H47A 5JPAA 1M1KQ 2QA4P 5KP6B 5BS1A 4XFYA 3NTEA 3CMEP 1YJNP 1VQKP 4COCA 2CG5B 3G29A 1YI2P 2DNWA 2KW2A 1EOQA 2VLPA 1QRJA 2VSQA 2JGPA 1ZMBA 2FQ1A 3LRYA 5EJDA 2K0DX 4PH1A 4U0EA 5HV8A 2QNWA 2EFJA 1IUQA 2ERHA 2KOPA 3E2DA 3G1IA 1K8AQ 2N5HA 1Q86Q 2FHSC 2JU2A 5HGMA 4XFXA 5HGNA 2FQ0A 4XROA 4BPGA 3DS5A 3GZLA 3GZMA 2XXMA 4GR6A
chains in the Genus database with same CATH topology
1VKUA 2KOQA 1AF8A 2AVAA 2L0QA 4H2XC 2KG9A 2K93A 2AFEA 2PNGA 2CQ8A 2N6ZA 4HKGA 2GDWA 3LMOA 4DG9A 2XZ1C 2LIUA 2K2QA 3EJBA 2GDXA 1KLPA 3EJDA 2KGDA 2AFDA 2FAEA 2KG6A 2LIWA 2CNRA 4H2WC 2MVUA 2LL8A 2KOOA 1HY8A 2FADA 1DV5A 2KGCA 2CGQA 2L9FA 2FACA 5KP7B 2L22A 5KP6B 4R0MA 2MF4A 1X3OA 2K92A 4PXHB 1F80D 2LPKA 2FVAA 2CG5B 2DNWA 1HQBA 2N50A 2L4BA 2MVVA 2KW2A 1L0HA 2JU1A 2KGEA 2KG8A 4CA3A 2K0XA 2MY5A 3NY7B 2VSQA 2JGPA 2FQ1A 2MR8A 5CZDB 5EJDA 4NEOA 4BPFA 2K0YA 4H2YC 3CE7A 2EHTA 2LOLA 2LMLA 2KGAA 2N98A 2KORA 5HV8A 2QNWA 4BPHA 2KOPA 2N5HA 3EJEA 2FHSC 2EHSA 2JU2A 1L0IA 2MR7A 2KR5A 1NQ4A 4IZ6A 2GDYA 2JQ4A 1DNYA 2KOSA 2M5RA 1ACPA 2ROQA 2FQ0A 3RG2A 2LKIA 4BPGA 2XZ0D 5HVCA 5KP8B 4PWVB 2X2BA 4MRTC 2K94A 3GZLA 2AF8A 2N6YA 2N5IA 3GZMA 2MD9A 2FQ2A 1OR5A 2FVFA 1T8KA 2FVEA 2LTEA 2KWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKU A;  2KOQ A;  1AF8 A;  2AVA A;  2L0Q A;  4H2X C;  2KG9 A;  2K93 A;  2AFE A;  2PNG A;  2CQ8 A;  2N6Z A;  4HKG A;  2GDW A;  3LMO A;  4DG9 A;  2XZ1 C;  2LIU A;  2K2Q A;  3EJB A;  2GDX A;  1KLP A;  3EJD A;  2KGD A;  2AFD A;  2FAE A;  2KG6 A;  2LIW A;  2CNR A;  4H2W C;  2MVU A;  2LL8 A;  2KOO A;  1HY8 A;  2FAD A;  1DV5 A;  2KGC A;  2CGQ A;  2L9F A;  2FAC A;  5KP7 B;  2L22 A;  5KP6 B;  4R0M A;  2MF4 A;  1X3O A;  2K92 A;  4PXH B;  1F80 D;  2LPK A;  2FVA A;  2CG5 B;  2DNW A;  1HQB A;  2N50 A;  2L4B A;  2MVV A;  2KW2 A;  1L0H A;  2JU1 A;  2KGE A;  2KG8 A;  4CA3 A;  2K0X A;  2MY5 A;  3NY7 B;  2VSQ A;  2JGP A;  2FQ1 A;  2MR8 A;  5CZD B;  5EJD A;  4NEO A;  4BPF A;  2K0Y A;  4H2Y C;  3CE7 A;  2EHT A;  2LOL A;  2LML A;  2KGA A;  2N98 A;  2KOR A;  5HV8 A;  2QNW A;  4BPH A;  2KOP A;  2N5H A;  3EJE A;  2FHS C;  2EHS A;  2JU2 A;  1L0I A;  2MR7 A;  2KR5 A;  1NQ4 A;  4IZ6 A;  2GDY A;  2JQ4 A;  1DNY A;  2KOS A;  2M5R A;  1ACP A;  2ROQ A;  2FQ0 A;  3RG2 A;  2LKI A;  4BPG A;  2XZ0 D;  5HVC A;  5KP8 B;  4PWV B;  2X2B A;  4MRT C;  2K94 A;  3GZL A;  2AF8 A;  2N6Y A;  2N5I A;  3GZM A;  2MD9 A;  2FQ2 A;  1OR5 A;  2FVF A;  1T8K A;  2FVE A;  2LTE A;  2KWL A; 
#chains in the Genus database with same CATH topology
 1AF8 A;  4H2X C;  2JB0 A;  2Z46 A;  3P05 A;  2QEX P;  3OW2 O;  1AUM A;  2VLQ A;  1Z6M A;  4HKG A;  2GDW A;  4DG9 A;  5I4T G;  3EJB A;  2KOD A;  2XT1 A;  4M0I A;  3DPH A;  2AFD A;  5EW5 E;  2FAE A;  3CCU P;  2KG6 A;  2CNR A;  2KOO A;  2ONT A;  1HY8 A;  1IMQ A;  1VQ4 P;  1DV5 A;  1Q7Y Q;  2KGC A;  2BHV A;  1VQ6 P;  1VQL P;  3VRL C;  2GZF A;  2M8N A;  3CC2 P;  4PXH B;  1F80 D;  4XFZ A;  1E6J P;  2LPK A;  2PEO A;  2FVA A;  3G0V A;  3CCM P;  2L4B A;  2MVV A;  1VQ8 P;  3CC4 P;  1Q82 Q;  1MZ8 A;  2K0Y A;  1GXG A;  2PEQ A;  5HGL A;  2M8P A;  3B4Q A;  2KOR A;  2PEM A;  2DGY A;  3HZQ A;  1E0H A;  1M6E X;  2XV6 A;  2WPT A;  1GXH A;  2L6E A;  3EJE A;  2JAZ A;  3CCE P;  2EHS A;  2GZG A;  1L0I A;  2JYG A;  4IZ6 A;  2JQ4 A;  4COP A;  1ACP A;  2ROQ A;  1RO2 A;  2M8L A;  1A43 A;  4PH0 A;  1ZNV A;  5KP8 B;  4MRT C;  1UNK A;  3G4S P;  2N6Y A;  4U0D A;  2FQ2 A;  2FVF A;  1QVG O;  3CCQ P;  2FVE A;  2LTE A;  1VKU A;  2LF4 A;  2EIA A;  2E1M A;  3CCJ P;  2K93 A;  2PNG A;  2CQ8 A;  2N6Z A;  1KQS O;  1JJ2 O;  3G26 A;  2PEJ A;  3DTJ A;  3RG6 C;  2GDX A;  1S72 P;  2OTL P;  2OTJ P;  4H2W C;  1M90 Q;  2OAR A;  4U0A A;  1RNI A;  3CPW O;  2CGQ A;  1CEI A;  2FAC A;  1VQP P;  2MF4 A;  1X3O A;  4QKO A;  1KD1 Q;  1NJI Q;  4GR2 A;  1KC8 Q;  2N50 A;  2KG8 A;  2K0X A;  2MY5 A;  3U43 A;  4U0C A;  5CZD B;  3DS4 A;  3G21 A;  4H2Y C;  2LOL A;  3CMA P;  1VQO P;  2LML A;  3DS2 A;  1RO0 A;  3GJN A;  2CWO A;  3G71 P;  3GKL C;  1EMV A;  1QVF O;  2Z44 A;  2GZI A;  1NQ4 A;  1VQ9 P;  1W2B O;  1M74 A;  2KOS A;  1K73 Q;  2XZ0 D;  3M1M A;  5F2K A;  4PWV B;  1BAJ A;  3CXC O;  2MD9 A;  2PEK A;  1OR5 A;  2K5X A;  3G6E P;  2KWL A;  3H0D A;  1YJW P;  1K9M Q;  1EIA A;  2KOQ A;  5F2N A;  2P9X A;  3CCR P;  1GPJ A;  2JO0 A;  3CCV P;  2AFE A;  2VLN A;  3WBH A;  1A8O A;  3CCS P;  2LIU A;  3B5I A;  5HGO A;  2EG5 A;  2K2Q A;  2NO8 A;  2PEN A;  1KLP A;  3EJD A;  2KGD A;  3I55 P;  2MVU A;  2LL8 A;  1FR2 A;  2FAD A;  3HYB A;  2L9F A;  3H4E A;  2GZE A;  5KP7 B;  1K30 A;  2L22 A;  4R0M A;  2JYL A;  2K92 A;  2PY8 A;  3MGE A;  3DS3 A;  1AYI A;  1Q81 Q;  1YIT P;  1HQB A;  1L0H A;  2JU1 A;  2KGE A;  4CA3 A;  3G28 A;  3NY7 B;  2GYK A;  2MR8 A;  3G1G A;  4NEO A;  4BPF A;  4UHP B;  3CE7 A;  2EHT A;  2BUO A;  2KGA A;  3DS1 A;  2N98 A;  3DS0 A;  4BPH A;  1YHQ P;  1IMP A;  2MR7 A;  2KR5 A;  4XRQ A;  1VQ5 P;  1N8R Q;  1D1D A;  2GDY A;  3CD6 P;  1DNY A;  2VLO A;  2M5R A;  3RG2 A;  3CC7 P;  2LKI A;  4F37 A;  5HVC A;  1UJZ A;  1VQN P;  2X2B A;  2K94 A;  4IPY A;  2AF8 A;  2N5I A;  1VQM P;  4U0F A;  1YIJ P;  1T8K A;  2PEI A;  4QNB A;  3CCL P;  4WYM A;  2AVA A;  2L0Q A;  2KG9 A;  1M6N A;  2JBG A;  2Z45 A;  7CEI A;  1VHN A;  1BXI A;  1YJ9 P;  5F2O A;  4U0B A;  3LMO A;  2XZ1 C;  2GZJ A;  5BS2 A;  3I56 P;  1VQ7 P;  2LIW A;  3Q20 A;  5DCK A;  3H47 A;  5JPA A;  1M1K Q;  2QA4 P;  5KP6 B;  5BS1 A;  4XFY A;  3NTE A;  3CME P;  1YJN P;  1VQK P;  4COC A;  2CG5 B;  3G29 A;  1YI2 P;  2DNW A;  2KW2 A;  1EOQ A;  2VLP A;  1QRJ A;  2VSQ A;  2JGP A;  1ZMB A;  2FQ1 A;  3LRY A;  5EJD A;  2K0D X;  4PH1 A;  4U0E A;  5HV8 A;  2QNW A;  2EFJ A;  1IUQ A;  2ERH A;  2KOP A;  3E2D A;  3G1I A;  1K8A Q;  2N5H A;  1Q86 Q;  2FHS C;  2JU2 A;  5HGM A;  4XFX A;  5HGN A;  2FQ0 A;  4XRO A;  4BPG A;  3DS5 A;  3GZL A;  3GZM A;  2XXM A;  4GR6 A; 
#chains in the Genus database with same CATH homology
 1VKU A;  2KOQ A;  1AF8 A;  2AVA A;  2L0Q A;  4H2X C;  2KG9 A;  2K93 A;  2AFE A;  2PNG A;  2CQ8 A;  2N6Z A;  4HKG A;  2GDW A;  3LMO A;  4DG9 A;  2XZ1 C;  2LIU A;  2K2Q A;  3EJB A;  2GDX A;  1KLP A;  3EJD A;  2KGD A;  2AFD A;  2FAE A;  2KG6 A;  2LIW A;  2CNR A;  4H2W C;  2MVU A;  2LL8 A;  2KOO A;  1HY8 A;  2FAD A;  1DV5 A;  2KGC A;  2CGQ A;  2L9F A;  2FAC A;  5KP7 B;  2L22 A;  5KP6 B;  4R0M A;  2MF4 A;  1X3O A;  2K92 A;  4PXH B;  1F80 D;  2LPK A;  2FVA A;  2CG5 B;  2DNW A;  1HQB A;  2N50 A;  2L4B A;  2MVV A;  2KW2 A;  1L0H A;  2JU1 A;  2KGE A;  2KG8 A;  4CA3 A;  2K0X A;  2MY5 A;  3NY7 B;  2VSQ A;  2JGP A;  2FQ1 A;  2MR8 A;  5CZD B;  5EJD A;  4NEO A;  4BPF A;  2K0Y A;  4H2Y C;  3CE7 A;  2EHT A;  2LOL A;  2LML A;  2KGA A;  2N98 A;  2KOR A;  5HV8 A;  2QNW A;  4BPH A;  2KOP A;  2N5H A;  3EJE A;  2FHS C;  2EHS A;  2JU2 A;  1L0I A;  2MR7 A;  2KR5 A;  1NQ4 A;  4IZ6 A;  2GDY A;  2JQ4 A;  1DNY A;  2KOS A;  2M5R A;  1ACP A;  2ROQ A;  2FQ0 A;  3RG2 A;  2LKI A;  4BPG A;  2XZ0 D;  5HVC A;  5KP8 B;  4PWV B;  2X2B A;  4MRT C;  2K94 A;  3GZL A;  2AF8 A;  2N6Y A;  2N5I A;  3GZM A;  2MD9 A;  2FQ2 A;  1OR5 A;  2FVF A;  1T8K A;  2FVE A;  2LTE A;  2KWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...