4HKGA

Crystal structure of free-standing peptidyl carrier protein from uncharacterized acinetobacter baumannii secondary metabolic pathway
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
b'NKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVALSVSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine attachment site family protein
publication title Structural and bioinformatic characterization of an Acinetobacter baumannii type II carrier protein.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Phosphopantetheine binding protein
total genus 26
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4hkgA00
1VKUA 4DG9A 2KG6A 2MR8A 2LIWA 2K93A 2KGCA 2LMLA 2N5IA 2LIUA 4H2WC 2FQ0A 3EJBA 3GZLA 2KGEA 3LMOA 2FACA 2K92A 2L9FA 2AVAA 2N5HA 2XZ1C 1HY8A 2MD9A 4HKGA 1L0HA 1T8KA 2FHSC 2MY5A 2L22A 4R0MA 2FVFA 2M5RA 4BPFA 2LKIA 2AF8A 2KOQA 5HV8A 2KORA 2DNWA 3EJDA 2CNRA 2PNGA 2N50A 3GZMA 2KOSA 2KG8A 2MVVA 5KP8B 2KG9A 1NQ4A 1L0IA 2FVAA 4MRTC 2JQ4A 2VSQA 2LOLA 2CQ8A 2N6ZA 2GDYA 4CA3A 1DNYA 2FQ2A 2EHTA 4PWVB 2MVUA 2N98A 2N6YA 2CG5B 2K2QA 2GDWA 2LL8A 2ROQA 2L0QA 2AFDA 1ACPA 4NEOA 3RG2A 2KGAA 5CZDB 1AF8A 2MF4A 5EJDA 2AFEA 2QNWA 1X3OA 2KGDA 2FAEA 2LPKA 2KR5A 2MR7A 2K94A 3NY7B 2FADA 2K0YA 2L4BA 4BPHA 2X2BA 2CGQA 2XZ0D 4IZ6A 2EHSA 4BPGA 2KWLA 3CE7A 5HVCA 2LTEA 3EJEA 2JGPA 5KP7B 4PXHB 2FQ1A 2KW2A 2JU2A 1KLPA 1DV5A 2KOOA 2K0XA 2JU1A 4H2YC 2KOPA 2FVEA 5KP6B 1F80D 4H2XC 1HQBA 2GDXA 1OR5A
chains in the Genus database with same CATH superfamily
2GZFA 4DG9A 2KG6A 3G4SP 2KGCA 3MGEA 3H0DA 2N5IA 4H2WC 1IMPA 2PEJA 1T8KA 1UNKA 2FHSC 2QA4P 1KQSO 5HV8A 4XFXA 5JPAA 3B5IA 1KD1Q 3GKLC 1ZNVA 1K30A 1VQMP 5HGNA 2KG8A 5KP8B 2PEQA 3G26A 3G6EP 1UJZA 2E1MA 1AYIA 1L0IA 2FVAA 1E0HA 3CCRP 1VQ5P 1YHQP 4XRQA 2CQ8A 3CCMP 2EHTA 2PENA 2CG5B 2EFJA 2K2QA 3LRYA 1Q86Q 2ROQA 2XT1A 1VQLP 4GR6A 1YITP 2JBGA 3M1MA 2GZIA 5CZDB 4U0DA 5EJDA 3CMAP 2AFEA 1VQKP 1VQ7P 5DCKA 1QVFO 2K94A 2FADA 2CWOA 4BPHA 2X2BA 1IUQA 2JGPA 2KW2A 1EOQA 2JU2A 1KLPA 2K0XA 3DS1A 5I4TG 2Z46A 1Z6MA 2NO8A 4H2XC 5KP6B 1HQBA 4U0FA 1E6JP 1BAJA 2MR8A 2LMLA 4IPYA 1JJ2O 3GZLA 2KGEA 3LMOA 2GYKA 2N5HA 1VQ9P 2ONTA 1L0HA 1A8OA 2FVFA 7CEIA 1VQ8P 4BPFA 2LKIA 2AF8A 2DGYA 2KOQA 2XV6A 3I55P 2KORA 4WYMA 1QVGO 2GDXA 2PNGA 2N50A 1GXHA 2MVVA 2KG9A 1M6NA 1VQPP 4XFYA 2PY8A 1A43A 1NQ4A 1YJNP 2VSQA 3H4EA 2M8NA 2P9XA 4XFZA 2WPTA 2L6EA 2FQ2A 2N98A 3G71P 1M74A 4U0AA 2GDWA 2L0QA 2Z45A 1AUMA 2GZEA 1ACPA 3DS2A 2VLNA 2MF4A 2PEIA 1YIJP 4XROA 1X3OA 1K9MQ 2KGDA 2FAEA 4QNBA 2KR5A 2K0YA 2KODA 4BPGA 3CC2P 4COCA 1CEIA 2K5XA 3EJEA 5KP7B 4PH1A 2FQ1A 2KOOA 2M8LA 1EIAA 4H2YC 2KOPA 1RO0A 5BS1A 3G21A 5HGLA 3H47A 1OR5A 1VKUA 2JAZA 3G0VA 4GR2A 3GJNA 2LIWA 5F2KA 1IMQA 3I56P 2PEOA 3E2DA 2LIUA 3EJBA 4UHPB 2QEXP 1N8RQ 1Q7YQ 2XZ1C 1HY8A 1ZMBA 2K0DX 3CCJP 4HKGA 3DS5A 4R0MA 2L22A 2M5RA 2XXMA 1M6EX 1GPJA 3HZQA 2CNRA 3CCSP 1FR2A 3GZMA 1BXIA 2BHVA 4U0CA 2ERHA 1QRJA 1M1KQ 3DPHA 2EIAA 2VLQA 4MRTC 2VLOA 4U0EA 2LOLA 2N6ZA 2GDYA 4CA3A 2JB0A 4PWVB 2MVUA 2PEMA 2JYLA 2M8PA 2LL8A 3G1GA 3OW2O 2AFDA 1K73Q 3CC7P 4NEOA 3RG2A 3HYBA 2EG5A 2JO0A 4COPA 1D1DA 2KGAA 3RG6C 3VRLC 3CCEP 4M0IA 3CC4P 2OTLP 2Z44A 3CCUP 5EW5E 2LPKA 5F2NA 2MR7A 2CGQA 2XZ0D 2KWLA 5HVCA 3WBHA 4PXHB 1DV5A 3CD6P 3P05A 1VQ6P 1F80D 3G29A 3CCVP 1NJIQ 3B4QA 3Q20A 3CXCO 2K93A 1EMVA 3CCLP 2FQ0A 3NTEA 2LF4A 2OARA 2FACA 3CCQP 2K92A 2L9FA 2AVAA 2MD9A 3CPWO 1YJ9P 2MY5A 5HGOA 1S72P 1YI2P 5BS2A 1VQNP 2DNWA 3EJDA 3G1IA 3DTJA 1GXGA 2KOSA 1YJWP 1VHNA 3DS3A 1MZ8A 2JQ4A 4U0BA 5F2OA 1DNYA 3DS4A 2N6YA 2GZGA 4PH0A 2GZJA 2VLPA 1KC8Q 1AF8A 1M90Q 2QNWA 4F37A 1W2BO 4QKOA 3DS0A 1RNIA 3NY7B 2L4BA 2BUOA 1Q82Q 2OTJP 1RO2A 4IZ6A 2EHSA 3G28A 2LTEA 1K8AQ 1VQ4P 3U43A 2JU1A 1Q81Q 5HGMA 2JYGA 2FVEA 3CMEP 1VQOP 2PEKA 3CE7A
chains in the Genus database with same CATH topology
1VKUA 4DG9A 2KG6A 2MR8A 2LIWA 2K93A 2KGCA 2LMLA 2N5IA 2LIUA 4H2WC 2FQ0A 3EJBA 3GZLA 2KGEA 3LMOA 2FACA 2K92A 2L9FA 2AVAA 2N5HA 2XZ1C 1HY8A 2MD9A 4HKGA 1L0HA 1T8KA 2FHSC 2MY5A 2L22A 4R0MA 2FVFA 2M5RA 4BPFA 2LKIA 2AF8A 2KOQA 5HV8A 2KORA 2DNWA 3EJDA 2CNRA 2PNGA 2N50A 3GZMA 2KOSA 2KG8A 2MVVA 5KP8B 2KG9A 1NQ4A 1L0IA 2FVAA 4MRTC 2JQ4A 2VSQA 2LOLA 2CQ8A 2N6ZA 2GDYA 4CA3A 1DNYA 2FQ2A 2EHTA 4PWVB 2MVUA 2N98A 2N6YA 2CG5B 2K2QA 2GDWA 2LL8A 2ROQA 2L0QA 2AFDA 1ACPA 4NEOA 3RG2A 2KGAA 5CZDB 1AF8A 2MF4A 5EJDA 2AFEA 2QNWA 1X3OA 2KGDA 2FAEA 2LPKA 2KR5A 2MR7A 2K94A 3NY7B 2FADA 2K0YA 2L4BA 4BPHA 2X2BA 2CGQA 2XZ0D 4IZ6A 2EHSA 4BPGA 2KWLA 3CE7A 5HVCA 2LTEA 3EJEA 2JGPA 5KP7B 4PXHB 2FQ1A 2KW2A 2JU2A 1KLPA 1DV5A 2KOOA 2K0XA 2JU1A 4H2YC 2KOPA 2FVEA 5KP6B 1F80D 4H2XC 1HQBA 2GDXA 1OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKU A;  4DG9 A;  2KG6 A;  2MR8 A;  2LIW A;  2K93 A;  2KGC A;  2LML A;  2N5I A;  2LIU A;  4H2W C;  2FQ0 A;  3EJB A;  3GZL A;  2KGE A;  3LMO A;  2FAC A;  2K92 A;  2L9F A;  2AVA A;  2N5H A;  2XZ1 C;  1HY8 A;  2MD9 A;  4HKG A;  1L0H A;  1T8K A;  2FHS C;  2MY5 A;  2L22 A;  4R0M A;  2FVF A;  2M5R A;  4BPF A;  2LKI A;  2AF8 A;  2KOQ A;  5HV8 A;  2KOR A;  2DNW A;  3EJD A;  2CNR A;  2PNG A;  2N50 A;  3GZM A;  2KOS A;  2KG8 A;  2MVV A;  5KP8 B;  2KG9 A;  1NQ4 A;  1L0I A;  2FVA A;  4MRT C;  2JQ4 A;  2VSQ A;  2LOL A;  2CQ8 A;  2N6Z A;  2GDY A;  4CA3 A;  1DNY A;  2FQ2 A;  2EHT A;  4PWV B;  2MVU A;  2N98 A;  2N6Y A;  2CG5 B;  2K2Q A;  2GDW A;  2LL8 A;  2ROQ A;  2L0Q A;  2AFD A;  1ACP A;  4NEO A;  3RG2 A;  2KGA A;  5CZD B;  1AF8 A;  2MF4 A;  5EJD A;  2AFE A;  2QNW A;  1X3O A;  2KGD A;  2FAE A;  2LPK A;  2KR5 A;  2MR7 A;  2K94 A;  3NY7 B;  2FAD A;  2K0Y A;  2L4B A;  4BPH A;  2X2B A;  2CGQ A;  2XZ0 D;  4IZ6 A;  2EHS A;  4BPG A;  2KWL A;  3CE7 A;  5HVC A;  2LTE A;  3EJE A;  2JGP A;  5KP7 B;  4PXH B;  2FQ1 A;  2KW2 A;  2JU2 A;  1KLP A;  1DV5 A;  2KOO A;  2K0X A;  2JU1 A;  4H2Y C;  2KOP A;  2FVE A;  5KP6 B;  1F80 D;  4H2X C;  1HQB A;  2GDX A;  1OR5 A; 
#chains in the Genus database with same CATH topology
 2GZF A;  4DG9 A;  2KG6 A;  3G4S P;  2KGC A;  3MGE A;  3H0D A;  2N5I A;  4H2W C;  1IMP A;  2PEJ A;  1T8K A;  1UNK A;  2FHS C;  2QA4 P;  1KQS O;  5HV8 A;  4XFX A;  5JPA A;  3B5I A;  1KD1 Q;  3GKL C;  1ZNV A;  1K30 A;  1VQM P;  5HGN A;  2KG8 A;  5KP8 B;  2PEQ A;  3G26 A;  3G6E P;  1UJZ A;  2E1M A;  1AYI A;  1L0I A;  2FVA A;  1E0H A;  3CCR P;  1VQ5 P;  1YHQ P;  4XRQ A;  2CQ8 A;  3CCM P;  2EHT A;  2PEN A;  2CG5 B;  2EFJ A;  2K2Q A;  3LRY A;  1Q86 Q;  2ROQ A;  2XT1 A;  1VQL P;  4GR6 A;  1YIT P;  2JBG A;  3M1M A;  2GZI A;  5CZD B;  4U0D A;  5EJD A;  3CMA P;  2AFE A;  1VQK P;  1VQ7 P;  5DCK A;  1QVF O;  2K94 A;  2FAD A;  2CWO A;  4BPH A;  2X2B A;  1IUQ A;  2JGP A;  2KW2 A;  1EOQ A;  2JU2 A;  1KLP A;  2K0X A;  3DS1 A;  5I4T G;  2Z46 A;  1Z6M A;  2NO8 A;  4H2X C;  5KP6 B;  1HQB A;  4U0F A;  1E6J P;  1BAJ A;  2MR8 A;  2LML A;  4IPY A;  1JJ2 O;  3GZL A;  2KGE A;  3LMO A;  2GYK A;  2N5H A;  1VQ9 P;  2ONT A;  1L0H A;  1A8O A;  2FVF A;  7CEI A;  1VQ8 P;  4BPF A;  2LKI A;  2AF8 A;  2DGY A;  2KOQ A;  2XV6 A;  3I55 P;  2KOR A;  4WYM A;  1QVG O;  2GDX A;  2PNG A;  2N50 A;  1GXH A;  2MVV A;  2KG9 A;  1M6N A;  1VQP P;  4XFY A;  2PY8 A;  1A43 A;  1NQ4 A;  1YJN P;  2VSQ A;  3H4E A;  2M8N A;  2P9X A;  4XFZ A;  2WPT A;  2L6E A;  2FQ2 A;  2N98 A;  3G71 P;  1M74 A;  4U0A A;  2GDW A;  2L0Q A;  2Z45 A;  1AUM A;  2GZE A;  1ACP A;  3DS2 A;  2VLN A;  2MF4 A;  2PEI A;  1YIJ P;  4XRO A;  1X3O A;  1K9M Q;  2KGD A;  2FAE A;  4QNB A;  2KR5 A;  2K0Y A;  2KOD A;  4BPG A;  3CC2 P;  4COC A;  1CEI A;  2K5X A;  3EJE A;  5KP7 B;  4PH1 A;  2FQ1 A;  2KOO A;  2M8L A;  1EIA A;  4H2Y C;  2KOP A;  1RO0 A;  5BS1 A;  3G21 A;  5HGL A;  3H47 A;  1OR5 A;  1VKU A;  2JAZ A;  3G0V A;  4GR2 A;  3GJN A;  2LIW A;  5F2K A;  1IMQ A;  3I56 P;  2PEO A;  3E2D A;  2LIU A;  3EJB A;  4UHP B;  2QEX P;  1N8R Q;  1Q7Y Q;  2XZ1 C;  1HY8 A;  1ZMB A;  2K0D X;  3CCJ P;  4HKG A;  3DS5 A;  4R0M A;  2L22 A;  2M5R A;  2XXM A;  1M6E X;  1GPJ A;  3HZQ A;  2CNR A;  3CCS P;  1FR2 A;  3GZM A;  1BXI A;  2BHV A;  4U0C A;  2ERH A;  1QRJ A;  1M1K Q;  3DPH A;  2EIA A;  2VLQ A;  4MRT C;  2VLO A;  4U0E A;  2LOL A;  2N6Z A;  2GDY A;  4CA3 A;  2JB0 A;  4PWV B;  2MVU A;  2PEM A;  2JYL A;  2M8P A;  2LL8 A;  3G1G A;  3OW2 O;  2AFD A;  1K73 Q;  3CC7 P;  4NEO A;  3RG2 A;  3HYB A;  2EG5 A;  2JO0 A;  4COP A;  1D1D A;  2KGA A;  3RG6 C;  3VRL C;  3CCE P;  4M0I A;  3CC4 P;  2OTL P;  2Z44 A;  3CCU P;  5EW5 E;  2LPK A;  5F2N A;  2MR7 A;  2CGQ A;  2XZ0 D;  2KWL A;  5HVC A;  3WBH A;  4PXH B;  1DV5 A;  3CD6 P;  3P05 A;  1VQ6 P;  1F80 D;  3G29 A;  3CCV P;  1NJI Q;  3B4Q A;  3Q20 A;  3CXC O;  2K93 A;  1EMV A;  3CCL P;  2FQ0 A;  3NTE A;  2LF4 A;  2OAR A;  2FAC A;  3CCQ P;  2K92 A;  2L9F A;  2AVA A;  2MD9 A;  3CPW O;  1YJ9 P;  2MY5 A;  5HGO A;  1S72 P;  1YI2 P;  5BS2 A;  1VQN P;  2DNW A;  3EJD A;  3G1I A;  3DTJ A;  1GXG A;  2KOS A;  1YJW P;  1VHN A;  3DS3 A;  1MZ8 A;  2JQ4 A;  4U0B A;  5F2O A;  1DNY A;  3DS4 A;  2N6Y A;  2GZG A;  4PH0 A;  2GZJ A;  2VLP A;  1KC8 Q;  1AF8 A;  1M90 Q;  2QNW A;  4F37 A;  1W2B O;  4QKO A;  3DS0 A;  1RNI A;  3NY7 B;  2L4B A;  2BUO A;  1Q82 Q;  2OTJ P;  1RO2 A;  4IZ6 A;  2EHS A;  3G28 A;  2LTE A;  1K8A Q;  1VQ4 P;  3U43 A;  2JU1 A;  1Q81 Q;  5HGM A;  2JYG A;  2FVE A;  3CME P;  1VQO P;  2PEK A;  3CE7 A; 
#chains in the Genus database with same CATH homology
 1VKU A;  4DG9 A;  2KG6 A;  2MR8 A;  2LIW A;  2K93 A;  2KGC A;  2LML A;  2N5I A;  2LIU A;  4H2W C;  2FQ0 A;  3EJB A;  3GZL A;  2KGE A;  3LMO A;  2FAC A;  2K92 A;  2L9F A;  2AVA A;  2N5H A;  2XZ1 C;  1HY8 A;  2MD9 A;  4HKG A;  1L0H A;  1T8K A;  2FHS C;  2MY5 A;  2L22 A;  4R0M A;  2FVF A;  2M5R A;  4BPF A;  2LKI A;  2AF8 A;  2KOQ A;  5HV8 A;  2KOR A;  2DNW A;  3EJD A;  2CNR A;  2PNG A;  2N50 A;  3GZM A;  2KOS A;  2KG8 A;  2MVV A;  5KP8 B;  2KG9 A;  1NQ4 A;  1L0I A;  2FVA A;  4MRT C;  2JQ4 A;  2VSQ A;  2LOL A;  2CQ8 A;  2N6Z A;  2GDY A;  4CA3 A;  1DNY A;  2FQ2 A;  2EHT A;  4PWV B;  2MVU A;  2N98 A;  2N6Y A;  2CG5 B;  2K2Q A;  2GDW A;  2LL8 A;  2ROQ A;  2L0Q A;  2AFD A;  1ACP A;  4NEO A;  3RG2 A;  2KGA A;  5CZD B;  1AF8 A;  2MF4 A;  5EJD A;  2AFE A;  2QNW A;  1X3O A;  2KGD A;  2FAE A;  2LPK A;  2KR5 A;  2MR7 A;  2K94 A;  3NY7 B;  2FAD A;  2K0Y A;  2L4B A;  4BPH A;  2X2B A;  2CGQ A;  2XZ0 D;  4IZ6 A;  2EHS A;  4BPG A;  2KWL A;  3CE7 A;  5HVC A;  2LTE A;  3EJE A;  2JGP A;  5KP7 B;  4PXH B;  2FQ1 A;  2KW2 A;  2JU2 A;  1KLP A;  1DV5 A;  2KOO A;  2K0X A;  2JU1 A;  4H2Y C;  2KOP A;  2FVE A;  5KP6 B;  1F80 D;  4H2X C;  1HQB A;  2GDX A;  1OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...