4HKGA

Crystal structure of free-standing peptidyl carrier protein from uncharacterized acinetobacter baumannii secondary metabolic pathway
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
80
structure length
80
Chain Sequence
NKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVALSVSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphopantetheine binding protein
molecule keywords Phosphopantetheine attachment site family protein
publication title Structural and bioinformatic characterization of an Acinetobacter baumannii type II carrier protein.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 26
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4hkgA00
2KG8A 4PXHB 2K0YA 2JQ4A 2FADA 2LIUA 1L0IA 2KOSA 2JU2A 2LMLA 2KGDA 2FQ0A 2KGCA 1T8KA 2M5RA 1NQ4A 2FQ2A 4BPGA 2GDWA 2EHSA 1DNYA 2KORA 2MVUA 2N6YA 2KGAA 2DNWA 2KOPA 2X2BA 2L22A 3GZLA 5KP6B 2KG6A 2K92A 2KGEA 2MR8A 2CGQA 2FQ1A 3EJEA 2KR5A 2FVEA 2L9FA 2ROQA 2GDXA 2FACA 1VKUA 2JGPA 3EJDA 2K2QA 2LL8A 2CNRA 3RG2A 4BPHA 1AF8A 2MD9A 2FAEA 5HVCA 2K94A 1KLPA 2MR7A 2CG5B 2MY5A 5KP7B 4MRTC 2L0QA 2LPKA 1HY8A 2QNWA 3CE7A 2KOQA 2KWLA 2KW2A 2N5HA 4PWVB 2AFEA 2KG9A 3NY7B 4CA3A 4H2XC 5HV8A 2MF4A 4R0MA 4NEOA 2AFDA 3EJBA 2CQ8A 2N98A 5KP8B 2EHTA 4DG9A 2LOLA 2L4BA 1HQBA 1X3OA 1DV5A 2GDYA 2LKIA 1L0HA 2N6ZA 4H2YC 2FVFA 4HKGA 1F80D 4H2WC 3LMOA 2K0XA 2AVAA 2VSQA 2FVAA 2XZ1C 4BPFA 2K93A 2JU1A 2AF8A 5CZDB 2KOOA 5EJDA 1OR5A 2N50A 4IZ6A 1ACPA 2XZ0D 2FHSC 2PNGA 2LIWA 3GZMA 2LTEA 2N5IA 2MVVA
chains in the Genus database with same CATH superfamily
3E2DA 4WYMA 2JQ4A 2FADA 2LIUA 3NTEA 1L0IA 3CCEP 1YHQP 3GJNA 5HGOA 2Z44A 1M6EX 3I56P 4U0CA 2FQ2A 1FR2A 4BPGA 2EHSA 2WPTA 5F2NA 2KORA 3B5IA 2MVUA 2KGAA 3DTJA 1RNIA 3WBHA 1VQOP 1VQ9P 3CCMP 5BS2A 2ERHA 2KGEA 3G71P 1K30A 1MZ8A 1E0HA 1Q86Q 2M8NA 7CEIA 1Z6MA 1VKUA 2JGPA 3EJDA 2OTJP 2JB0A 5F2KA 1KD1Q 2EFJA 3CCQP 1AF8A 2FAEA 1Q81Q 1K73Q 2CG5B 1EMVA 1GPJA 3DS3A 1HY8A 2N5HA 4R0MA 4NEOA 3H4EA 2JYGA 3DS1A 2ONTA 2LKIA 1L0HA 2PEKA 4H2YC 4HKGA 3MGEA 2K0XA 2AVAA 2OARA 2FVAA 4U0BA 2Z46A 3OW2O 2XZ1C 4XRQA 3DS0A 1M90Q 4F37A 1A43A 1VQ5P 1OR5A 2GZIA 4QNBA 4IZ6A 1VQKP 5F2OA 2M8PA 5HGNA 3GZMA 2BUOA 1GXHA 1UJZA 3CCRP 2PY8A 2VLOA 3CCUP 3DS4A 2LMLA 2KGDA 2KGCA 2PEMA 2M5RA 4XFXA 1NQ4A 5DCKA 1S72P 2PEQA 1VQ7P 1YIJP 2CWOA 2DNWA 3G4SP 2KOPA 2XXMA 1VQ4P 2KG6A 2M8LA 2GZGA 2MR8A 3EJEA 2KR5A 1K8AQ 5HGLA 2EIAA 2L6EA 2L9FA 4IPYA 2PEJA 4GR2A 2FACA 2VLPA 4XFYA 2LL8A 1YI2P 3DPHA 3RG2A 4UHPB 4XROA 3CD6P 2MD9A 2LF4A 1KC8Q 2QNWA 1AUMA 3CMEP 2KOQA 1ZNVA 3G28A 2XT1A 1K9MQ 2AFDA 2CQ8A 2N98A 1ZMBA 2GDYA 2PEIA 2JBGA 2FVFA 3CCSP 4H2WC 3CCVP 2VSQA 1AYIA 3CCJP 5CZDB 2KOOA 4GR6A 4QKOA 1A8OA 2MVVA 2JYLA 3H47A 1VQMP 1Q82Q 1IMQA 2KOSA 2KODA 5I4TG 3G26A 2FQ0A 2GZEA 1QVGO 2GDWA 5EW5E 3G29A 1KQSO 3GZLA 2K92A 3DS5A 2CGQA 2FQ1A 2FVEA 1GXGA 1EIAA 2GDXA 4PH1A 2CNRA 4COCA 3CC7P 5HGMA 1Q7YQ 1KLPA 5HVCA 2K5XA 2K94A 2MR7A 4MRTC 1VQLP 1IMPA 3G21A 1VQNP 2GYKA 1D1DA 4U0AA 3CE7A 4PWVB 2KWLA 2KW2A 2P9XA 2QEXP 4COPA 1BAJA 4CA3A 1YJWP 2MF4A 2EHTA 4DG9A 2LOLA 2L4BA 1X3OA 2GZFA 2N6ZA 3G0VA 1RO2A 3G6EP 1BXIA 1F80D 3CCLP 2OTLP 3Q20A 3CPWO 4XFZA 4BPFA 2K93A 3CC4P 1YJNP 2N50A 1ACPA 1M6NA 2XZ0D 2FHSC 2PNGA 2LIWA 2LTEA 1QVFO 2KG8A 4U0FA 4PXHB 2K0YA 3RG6C 2JU2A 1M1KQ 3CC2P 3G1IA 3CXCO 1T8KA 3M1MA 1YJ9P 1M74A 1QRJA 2NO8A 1N8RQ 1VQPP 5JPAA 2VLNA 4U0DA 1VQ8P 1DNYA 3U43A 1VQ6P 2N6YA 2X2BA 2L22A 3DS2A 4M0IA 5KP6B 3B4QA 1EOQA 3I55P 4U0EA 2VLQA 2K0DX 2E1MA 2ROQA 1CEIA 2JO0A 2K2QA 1YITP 3P05A 4BPHA 1W2BO 3LRYA 3GKLC 3H0DA 2MY5A 2Z45A 5KP7B 1VHNA 2BHVA 2L0QA 2LPKA 2PEOA 3G1GA 4PH0A 2AFEA 2DGYA 1RO0A 2KG9A 2PENA 1E6JP 3NY7B 4H2XC 2EG5A 5HV8A 2JAZA 3EJBA 1IUQA 5KP8B 2QA4P 1DV5A 1HQBA 2XV6A 2GZJA 3LMOA 5BS1A 2JU1A 1UNKA 2AF8A 5EJDA 1NJIQ 1JJ2O 3HZQA 3VRLC 3HYBA 2N5IA 3CMAP
chains in the Genus database with same CATH topology
2KG8A 4PXHB 2K0YA 2JQ4A 2FADA 2LIUA 1L0IA 2KOSA 2JU2A 2LMLA 2KGDA 2FQ0A 2KGCA 1T8KA 2M5RA 1NQ4A 2FQ2A 4BPGA 2GDWA 2EHSA 1DNYA 2KORA 2MVUA 2N6YA 2KGAA 2DNWA 2KOPA 2X2BA 2L22A 3GZLA 5KP6B 2KG6A 2K92A 2KGEA 2MR8A 2CGQA 2FQ1A 3EJEA 2KR5A 2FVEA 2L9FA 2ROQA 2GDXA 2FACA 1VKUA 2JGPA 3EJDA 2K2QA 2LL8A 2CNRA 3RG2A 4BPHA 1AF8A 2MD9A 2FAEA 5HVCA 2K94A 1KLPA 2MR7A 2CG5B 2MY5A 5KP7B 4MRTC 2L0QA 2LPKA 1HY8A 2QNWA 3CE7A 2KOQA 2KWLA 2KW2A 2N5HA 4PWVB 2AFEA 2KG9A 3NY7B 4CA3A 4H2XC 5HV8A 2MF4A 4R0MA 4NEOA 2AFDA 3EJBA 2CQ8A 2N98A 5KP8B 2EHTA 4DG9A 2LOLA 2L4BA 1HQBA 1X3OA 1DV5A 2GDYA 2LKIA 1L0HA 2N6ZA 4H2YC 2FVFA 4HKGA 1F80D 4H2WC 3LMOA 2K0XA 2AVAA 2VSQA 2FVAA 2XZ1C 4BPFA 2K93A 2JU1A 2AF8A 5CZDB 2KOOA 5EJDA 1OR5A 2N50A 4IZ6A 1ACPA 2XZ0D 2FHSC 2PNGA 2LIWA 3GZMA 2LTEA 2N5IA 2MVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG8 A;  4PXH B;  2K0Y A;  2JQ4 A;  2FAD A;  2LIU A;  1L0I A;  2KOS A;  2JU2 A;  2LML A;  2KGD A;  2FQ0 A;  2KGC A;  1T8K A;  2M5R A;  1NQ4 A;  2FQ2 A;  4BPG A;  2GDW A;  2EHS A;  1DNY A;  2KOR A;  2MVU A;  2N6Y A;  2KGA A;  2DNW A;  2KOP A;  2X2B A;  2L22 A;  3GZL A;  5KP6 B;  2KG6 A;  2K92 A;  2KGE A;  2MR8 A;  2CGQ A;  2FQ1 A;  3EJE A;  2KR5 A;  2FVE A;  2L9F A;  2ROQ A;  2GDX A;  2FAC A;  1VKU A;  2JGP A;  3EJD A;  2K2Q A;  2LL8 A;  2CNR A;  3RG2 A;  4BPH A;  1AF8 A;  2MD9 A;  2FAE A;  5HVC A;  2K94 A;  1KLP A;  2MR7 A;  2CG5 B;  2MY5 A;  5KP7 B;  4MRT C;  2L0Q A;  2LPK A;  1HY8 A;  2QNW A;  3CE7 A;  2KOQ A;  2KWL A;  2KW2 A;  2N5H A;  4PWV B;  2AFE A;  2KG9 A;  3NY7 B;  4CA3 A;  4H2X C;  5HV8 A;  2MF4 A;  4R0M A;  4NEO A;  2AFD A;  3EJB A;  2CQ8 A;  2N98 A;  5KP8 B;  2EHT A;  4DG9 A;  2LOL A;  2L4B A;  1HQB A;  1X3O A;  1DV5 A;  2GDY A;  2LKI A;  1L0H A;  2N6Z A;  4H2Y C;  2FVF A;  4HKG A;  1F80 D;  4H2W C;  3LMO A;  2K0X A;  2AVA A;  2VSQ A;  2FVA A;  2XZ1 C;  4BPF A;  2K93 A;  2JU1 A;  2AF8 A;  5CZD B;  2KOO A;  5EJD A;  1OR5 A;  2N50 A;  4IZ6 A;  1ACP A;  2XZ0 D;  2FHS C;  2PNG A;  2LIW A;  3GZM A;  2LTE A;  2N5I A;  2MVV A; 
#chains in the Genus database with same CATH topology
 3E2D A;  4WYM A;  2JQ4 A;  2FAD A;  2LIU A;  3NTE A;  1L0I A;  3CCE P;  1YHQ P;  3GJN A;  5HGO A;  2Z44 A;  1M6E X;  3I56 P;  4U0C A;  2FQ2 A;  1FR2 A;  4BPG A;  2EHS A;  2WPT A;  5F2N A;  2KOR A;  3B5I A;  2MVU A;  2KGA A;  3DTJ A;  1RNI A;  3WBH A;  1VQO P;  1VQ9 P;  3CCM P;  5BS2 A;  2ERH A;  2KGE A;  3G71 P;  1K30 A;  1MZ8 A;  1E0H A;  1Q86 Q;  2M8N A;  7CEI A;  1Z6M A;  1VKU A;  2JGP A;  3EJD A;  2OTJ P;  2JB0 A;  5F2K A;  1KD1 Q;  2EFJ A;  3CCQ P;  1AF8 A;  2FAE A;  1Q81 Q;  1K73 Q;  2CG5 B;  1EMV A;  1GPJ A;  3DS3 A;  1HY8 A;  2N5H A;  4R0M A;  4NEO A;  3H4E A;  2JYG A;  3DS1 A;  2ONT A;  2LKI A;  1L0H A;  2PEK A;  4H2Y C;  4HKG A;  3MGE A;  2K0X A;  2AVA A;  2OAR A;  2FVA A;  4U0B A;  2Z46 A;  3OW2 O;  2XZ1 C;  4XRQ A;  3DS0 A;  1M90 Q;  4F37 A;  1A43 A;  1VQ5 P;  1OR5 A;  2GZI A;  4QNB A;  4IZ6 A;  1VQK P;  5F2O A;  2M8P A;  5HGN A;  3GZM A;  2BUO A;  1GXH A;  1UJZ A;  3CCR P;  2PY8 A;  2VLO A;  3CCU P;  3DS4 A;  2LML A;  2KGD A;  2KGC A;  2PEM A;  2M5R A;  4XFX A;  1NQ4 A;  5DCK A;  1S72 P;  2PEQ A;  1VQ7 P;  1YIJ P;  2CWO A;  2DNW A;  3G4S P;  2KOP A;  2XXM A;  1VQ4 P;  2KG6 A;  2M8L A;  2GZG A;  2MR8 A;  3EJE A;  2KR5 A;  1K8A Q;  5HGL A;  2EIA A;  2L6E A;  2L9F A;  4IPY A;  2PEJ A;  4GR2 A;  2FAC A;  2VLP A;  4XFY A;  2LL8 A;  1YI2 P;  3DPH A;  3RG2 A;  4UHP B;  4XRO A;  3CD6 P;  2MD9 A;  2LF4 A;  1KC8 Q;  2QNW A;  1AUM A;  3CME P;  2KOQ A;  1ZNV A;  3G28 A;  2XT1 A;  1K9M Q;  2AFD A;  2CQ8 A;  2N98 A;  1ZMB A;  2GDY A;  2PEI A;  2JBG A;  2FVF A;  3CCS P;  4H2W C;  3CCV P;  2VSQ A;  1AYI A;  3CCJ P;  5CZD B;  2KOO A;  4GR6 A;  4QKO A;  1A8O A;  2MVV A;  2JYL A;  3H47 A;  1VQM P;  1Q82 Q;  1IMQ A;  2KOS A;  2KOD A;  5I4T G;  3G26 A;  2FQ0 A;  2GZE A;  1QVG O;  2GDW A;  5EW5 E;  3G29 A;  1KQS O;  3GZL A;  2K92 A;  3DS5 A;  2CGQ A;  2FQ1 A;  2FVE A;  1GXG A;  1EIA A;  2GDX A;  4PH1 A;  2CNR A;  4COC A;  3CC7 P;  5HGM A;  1Q7Y Q;  1KLP A;  5HVC A;  2K5X A;  2K94 A;  2MR7 A;  4MRT C;  1VQL P;  1IMP A;  3G21 A;  1VQN P;  2GYK A;  1D1D A;  4U0A A;  3CE7 A;  4PWV B;  2KWL A;  2KW2 A;  2P9X A;  2QEX P;  4COP A;  1BAJ A;  4CA3 A;  1YJW P;  2MF4 A;  2EHT A;  4DG9 A;  2LOL A;  2L4B A;  1X3O A;  2GZF A;  2N6Z A;  3G0V A;  1RO2 A;  3G6E P;  1BXI A;  1F80 D;  3CCL P;  2OTL P;  3Q20 A;  3CPW O;  4XFZ A;  4BPF A;  2K93 A;  3CC4 P;  1YJN P;  2N50 A;  1ACP A;  1M6N A;  2XZ0 D;  2FHS C;  2PNG A;  2LIW A;  2LTE A;  1QVF O;  2KG8 A;  4U0F A;  4PXH B;  2K0Y A;  3RG6 C;  2JU2 A;  1M1K Q;  3CC2 P;  3G1I A;  3CXC O;  1T8K A;  3M1M A;  1YJ9 P;  1M74 A;  1QRJ A;  2NO8 A;  1N8R Q;  1VQP P;  5JPA A;  2VLN A;  4U0D A;  1VQ8 P;  1DNY A;  3U43 A;  1VQ6 P;  2N6Y A;  2X2B A;  2L22 A;  3DS2 A;  4M0I A;  5KP6 B;  3B4Q A;  1EOQ A;  3I55 P;  4U0E A;  2VLQ A;  2K0D X;  2E1M A;  2ROQ A;  1CEI A;  2JO0 A;  2K2Q A;  1YIT P;  3P05 A;  4BPH A;  1W2B O;  3LRY A;  3GKL C;  3H0D A;  2MY5 A;  2Z45 A;  5KP7 B;  1VHN A;  2BHV A;  2L0Q A;  2LPK A;  2PEO A;  3G1G A;  4PH0 A;  2AFE A;  2DGY A;  1RO0 A;  2KG9 A;  2PEN A;  1E6J P;  3NY7 B;  4H2X C;  2EG5 A;  5HV8 A;  2JAZ A;  3EJB A;  1IUQ A;  5KP8 B;  2QA4 P;  1DV5 A;  1HQB A;  2XV6 A;  2GZJ A;  3LMO A;  5BS1 A;  2JU1 A;  1UNK A;  2AF8 A;  5EJD A;  1NJI Q;  1JJ2 O;  3HZQ A;  3VRL C;  3HYB A;  2N5I A;  3CMA P; 
#chains in the Genus database with same CATH homology
 2KG8 A;  4PXH B;  2K0Y A;  2JQ4 A;  2FAD A;  2LIU A;  1L0I A;  2KOS A;  2JU2 A;  2LML A;  2KGD A;  2FQ0 A;  2KGC A;  1T8K A;  2M5R A;  1NQ4 A;  2FQ2 A;  4BPG A;  2GDW A;  2EHS A;  1DNY A;  2KOR A;  2MVU A;  2N6Y A;  2KGA A;  2DNW A;  2KOP A;  2X2B A;  2L22 A;  3GZL A;  5KP6 B;  2KG6 A;  2K92 A;  2KGE A;  2MR8 A;  2CGQ A;  2FQ1 A;  3EJE A;  2KR5 A;  2FVE A;  2L9F A;  2ROQ A;  2GDX A;  2FAC A;  1VKU A;  2JGP A;  3EJD A;  2K2Q A;  2LL8 A;  2CNR A;  3RG2 A;  4BPH A;  1AF8 A;  2MD9 A;  2FAE A;  5HVC A;  2K94 A;  1KLP A;  2MR7 A;  2CG5 B;  2MY5 A;  5KP7 B;  4MRT C;  2L0Q A;  2LPK A;  1HY8 A;  2QNW A;  3CE7 A;  2KOQ A;  2KWL A;  2KW2 A;  2N5H A;  4PWV B;  2AFE A;  2KG9 A;  3NY7 B;  4CA3 A;  4H2X C;  5HV8 A;  2MF4 A;  4R0M A;  4NEO A;  2AFD A;  3EJB A;  2CQ8 A;  2N98 A;  5KP8 B;  2EHT A;  4DG9 A;  2LOL A;  2L4B A;  1HQB A;  1X3O A;  1DV5 A;  2GDY A;  2LKI A;  1L0H A;  2N6Z A;  4H2Y C;  2FVF A;  4HKG A;  1F80 D;  4H2W C;  3LMO A;  2K0X A;  2AVA A;  2VSQ A;  2FVA A;  2XZ1 C;  4BPF A;  2K93 A;  2JU1 A;  2AF8 A;  5CZD B;  2KOO A;  5EJD A;  1OR5 A;  2N50 A;  4IZ6 A;  1ACP A;  2XZ0 D;  2FHS C;  2PNG A;  2LIW A;  3GZM A;  2LTE A;  2N5I A;  2MVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...