2EHTA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
b'SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Lipid transport
total genus 26
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehtA00
2MF4A 2KGEA 2K2QA 2KG6A 2KGAA 1F80D 2JU1A 2VSQA 2AFDA 3CE7A 2CGQA 2CQ8A 1OR5A 2JQ4A 2LL8A 2ROQA 5HVCA 2LMLA 3NY7B 2AFEA 1NQ4A 2FAEA 2MR8A 1L0HA 2LIUA 2LTEA 5KP7B 2KWLA 2L9FA 4CA3A 1DV5A 3GZLA 2N5IA 2XZ0D 3EJDA 2N6YA 1DNYA 2N98A 2L22A 1HY8A 3LMOA 2KOSA 5KP8B 2LOLA 2N5HA 5HV8A 2EHTA 4DG9A 2FQ1A 1AF8A 2N50A 2QNWA 4MRTC 3GZMA 2FADA 2KR5A 2L0QA 2JU2A 4BPHA 2KOQA 4HKGA 4IZ6A 2FVEA 2JGPA 4NEOA 2K0YA 2K93A 5EJDA 2K0XA 4R0MA 2N6ZA 2KG8A 2FVFA 3EJBA 2FVAA 2KOOA 2LPKA 4H2WC 4H2XC 2EHSA 2X2BA 2XZ1C 2GDWA 2MR7A 2K94A 2K92A 3RG2A 2KORA 2CNRA 4BPFA 2KOPA 3EJEA 1L0IA 4PXHB 1T8KA 2MD9A 5CZDB 2L4BA 2MY5A 4PWVB 2FHSC 4H2YC 2CG5B 2LIWA 2LKIA 2KGDA 2GDYA 2AVAA 2M5RA 2MVUA 1X3OA 1KLPA 2AF8A 2MVVA 2PNGA 2KW2A 1VKUA 1ACPA 2FACA 4BPGA 2KGCA 2FQ0A 2DNWA 2FQ2A 2GDXA 2KG9A 5KP6B 1HQBA
chains in the Genus database with same CATH superfamily
1GPJA 4U0CA 3CC4P 2Z46A 2K2QA 1M90Q 2JU1A 2P9XA 1Q82Q 1Z6MA 1YIJP 1RNIA 2LL8A 2LMLA 1A43A 2FAEA 2GZEA 1VQOP 4XRQA 5KP7B 2L9FA 1IMPA 2N5IA 2N6YA 2N98A 4XROA 5F2KA 1HY8A 2KOSA 2LOLA 2N5HA 3DS2A 1YHQP 2PEJA 2FQ1A 1MZ8A 4XFYA 2EFJA 3U43A 4BPHA 1GXHA 3DS3A 1QVGO 2JGPA 2K0YA 2K93A 3GKLC 2KG8A 3GJNA 3M1MA 1EOQA 2FVAA 4QNBA 2KOOA 2LPKA 3H0DA 2EHSA 2M8NA 2MR7A 3CCLP 2K92A 2CNRA 4BPFA 3EJEA 2PY8A 1T8KA 2L4BA 2XXMA 3DS0A 2VLNA 3DTJA 2MVUA 2GDYA 4U0AA 4XFZA 2K5XA 1VKUA 4BPGA 7CEIA 2KGCA 2FQ0A 2Z45A 3Q20A 1YJNP 2PENA 3WBHA 3CCJP 1W2BO 1BAJA 2VLOA 3LRYA 3CD6P 5DCKA 1VQPP 2KGAA 2PEIA 3CMEP 1VQLP 2AFDA 1YITP 2CGQA 3G0VA 1M74A 2GZFA 2ROQA 4COCA 5HVCA 1NQ4A 2PEOA 1L0HA 2LIUA 3CC2P 2KWLA 5EW5E 2XZ0D 3EJDA 1VQ5P 1CEIA 2L22A 5KP8B 1NJIQ 2N50A 2QNWA 2JU2A 2KOQA 4U0BA 1UNKA 2GYKA 4NEOA 5EJDA 1VQ6P 2KODA 2PEMA 1VHNA 2EG5A 2OTJP 3DS5A 2X2BA 2Z44A 5F2OA 3CPWO 3RG2A 2KORA 2L6EA 1VQ4P 1L0IA 3P05A 5HGMA 3RG6C 1Q7YQ 1IMQA 3CCMP 2MY5A 1E0HA 4H2YC 2CG5B 2LIWA 2MVVA 5F2NA 3G26A 2JBGA 1K30A 2XT1A 2DNWA 1RO2A 2DGYA 2QA4P 1Q86Q 5HGNA 4QKOA 2MF4A 2VLPA 3CCQP 4U0EA 1FR2A 2KG6A 1EMVA 2JYLA 2VSQA 2JAZA 3I55P 3CC7P 2PEKA 1Q81Q 1KC8Q 1VQ9P 1GXGA 2M8PA 4COPA 1VQ7P 4XFXA 3CCUP 3CMAP 5HGOA 2JYGA 2VLQA 1VQMP 1ZNVA 1DV5A 3GZLA 3G28A 3B4QA 1DNYA 3HYBA 5HV8A 2EHTA 1BXIA 3HZQA 1K73Q 4MRTC 2FADA 2L0QA 4HKGA 1KD1Q 3G1GA 4IZ6A 2FVEA 2GZIA 1M6EX 1E6JP 1M6NA 1VQ8P 4H2XC 2NO8A 2XZ1C 2XV6A 2K94A 3VRLC 4UHPB 5JPAA 3CCVP 1KQSO 1AYIA 2BUOA 4WYMA 1YJ9P 2BHVA 1KLPA 2AF8A 4GR6A 2PNGA 2KW2A 2PEQA 2OARA 2QEXP 2FACA 2GZJA 1YJWP 2FQ2A 2GDXA 2KG9A 1IUQA 5KP6B 1JJ2O 2KGEA 3I56P 3DS1A 4PH1A 1K9MQ 3NTEA 1F80D 4PH0A 1M1KQ 3CE7A 4GR2A 3CXCO 2CQ8A 1OR5A 2JQ4A 3NY7B 2AFEA 1EIAA 1S72P 2MR8A 3G1IA 2LTEA 1D1DA 3H4EA 4CA3A 3CCSP 2JO0A 3H47A 2M8LA 1A8OA 1QVFO 2GZGA 3E2DA 3LMOA 3OW2O 5I4TG 4DG9A 3B5IA 4IPYA 1VQKP 1AF8A 1YI2P 3GZMA 2KR5A 2E1MA 3G71P 1N8RQ 2K0DX 3G4SP 3DPHA 4M0IA 3G29A 2K0XA 4R0MA 2N6ZA 2FVFA 3MGEA 3DS4A 3EJBA 4U0DA 1ZMBA 2EIAA 2JB0A 4H2WC 2ERHA 1UJZA 2GDWA 2WPTA 1RO0A 1AUMA 5BS1A 2KOPA 2CWOA 4PXHB 4U0FA 3G6EP 1K8AQ 2LF4A 1QRJA 2MD9A 5CZDB 3G21A 5HGLA 4PWVB 2FHSC 3CCEP 2LKIA 2M5RA 2KGDA 2AVAA 1X3OA 1ACPA 1VQNP 4F37A 5BS2A 2ONTA 2OTLP 3CCRP 1HQBA
chains in the Genus database with same CATH topology
2MF4A 2KGEA 2K2QA 2KG6A 2KGAA 1F80D 2JU1A 2VSQA 2AFDA 3CE7A 2CGQA 2CQ8A 1OR5A 2JQ4A 2LL8A 2ROQA 5HVCA 2LMLA 3NY7B 2AFEA 1NQ4A 2FAEA 2MR8A 1L0HA 2LIUA 2LTEA 5KP7B 2KWLA 2L9FA 4CA3A 1DV5A 3GZLA 2N5IA 2XZ0D 3EJDA 2N6YA 1DNYA 2N98A 2L22A 1HY8A 3LMOA 2KOSA 5KP8B 2LOLA 2N5HA 5HV8A 2EHTA 4DG9A 2FQ1A 1AF8A 2N50A 2QNWA 4MRTC 3GZMA 2FADA 2KR5A 2L0QA 2JU2A 4BPHA 2KOQA 4HKGA 4IZ6A 2FVEA 2JGPA 4NEOA 2K0YA 2K93A 5EJDA 2K0XA 4R0MA 2N6ZA 2KG8A 2FVFA 3EJBA 2FVAA 2KOOA 2LPKA 4H2WC 4H2XC 2EHSA 2X2BA 2XZ1C 2GDWA 2MR7A 2K94A 2K92A 3RG2A 2KORA 2CNRA 4BPFA 2KOPA 3EJEA 1L0IA 4PXHB 1T8KA 2MD9A 5CZDB 2L4BA 2MY5A 4PWVB 2FHSC 4H2YC 2CG5B 2LIWA 2LKIA 2KGDA 2GDYA 2AVAA 2M5RA 2MVUA 1X3OA 1KLPA 2AF8A 2MVVA 2PNGA 2KW2A 1VKUA 1ACPA 2FACA 4BPGA 2KGCA 2FQ0A 2DNWA 2FQ2A 2GDXA 2KG9A 5KP6B 1HQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF4 A;  2KGE A;  2K2Q A;  2KG6 A;  2KGA A;  1F80 D;  2JU1 A;  2VSQ A;  2AFD A;  3CE7 A;  2CGQ A;  2CQ8 A;  1OR5 A;  2JQ4 A;  2LL8 A;  2ROQ A;  5HVC A;  2LML A;  3NY7 B;  2AFE A;  1NQ4 A;  2FAE A;  2MR8 A;  1L0H A;  2LIU A;  2LTE A;  5KP7 B;  2KWL A;  2L9F A;  4CA3 A;  1DV5 A;  3GZL A;  2N5I A;  2XZ0 D;  3EJD A;  2N6Y A;  1DNY A;  2N98 A;  2L22 A;  1HY8 A;  3LMO A;  2KOS A;  5KP8 B;  2LOL A;  2N5H A;  5HV8 A;  2EHT A;  4DG9 A;  2FQ1 A;  1AF8 A;  2N50 A;  2QNW A;  4MRT C;  3GZM A;  2FAD A;  2KR5 A;  2L0Q A;  2JU2 A;  4BPH A;  2KOQ A;  4HKG A;  4IZ6 A;  2FVE A;  2JGP A;  4NEO A;  2K0Y A;  2K93 A;  5EJD A;  2K0X A;  4R0M A;  2N6Z A;  2KG8 A;  2FVF A;  3EJB A;  2FVA A;  2KOO A;  2LPK A;  4H2W C;  4H2X C;  2EHS A;  2X2B A;  2XZ1 C;  2GDW A;  2MR7 A;  2K94 A;  2K92 A;  3RG2 A;  2KOR A;  2CNR A;  4BPF A;  2KOP A;  3EJE A;  1L0I A;  4PXH B;  1T8K A;  2MD9 A;  5CZD B;  2L4B A;  2MY5 A;  4PWV B;  2FHS C;  4H2Y C;  2CG5 B;  2LIW A;  2LKI A;  2KGD A;  2GDY A;  2AVA A;  2M5R A;  2MVU A;  1X3O A;  1KLP A;  2AF8 A;  2MVV A;  2PNG A;  2KW2 A;  1VKU A;  1ACP A;  2FAC A;  4BPG A;  2KGC A;  2FQ0 A;  2DNW A;  2FQ2 A;  2GDX A;  2KG9 A;  5KP6 B;  1HQB A; 
#chains in the Genus database with same CATH topology
 1GPJ A;  4U0C A;  3CC4 P;  2Z46 A;  2K2Q A;  1M90 Q;  2JU1 A;  2P9X A;  1Q82 Q;  1Z6M A;  1YIJ P;  1RNI A;  2LL8 A;  2LML A;  1A43 A;  2FAE A;  2GZE A;  1VQO P;  4XRQ A;  5KP7 B;  2L9F A;  1IMP A;  2N5I A;  2N6Y A;  2N98 A;  4XRO A;  5F2K A;  1HY8 A;  2KOS A;  2LOL A;  2N5H A;  3DS2 A;  1YHQ P;  2PEJ A;  2FQ1 A;  1MZ8 A;  4XFY A;  2EFJ A;  3U43 A;  4BPH A;  1GXH A;  3DS3 A;  1QVG O;  2JGP A;  2K0Y A;  2K93 A;  3GKL C;  2KG8 A;  3GJN A;  3M1M A;  1EOQ A;  2FVA A;  4QNB A;  2KOO A;  2LPK A;  3H0D A;  2EHS A;  2M8N A;  2MR7 A;  3CCL P;  2K92 A;  2CNR A;  4BPF A;  3EJE A;  2PY8 A;  1T8K A;  2L4B A;  2XXM A;  3DS0 A;  2VLN A;  3DTJ A;  2MVU A;  2GDY A;  4U0A A;  4XFZ A;  2K5X A;  1VKU A;  4BPG A;  7CEI A;  2KGC A;  2FQ0 A;  2Z45 A;  3Q20 A;  1YJN P;  2PEN A;  3WBH A;  3CCJ P;  1W2B O;  1BAJ A;  2VLO A;  3LRY A;  3CD6 P;  5DCK A;  1VQP P;  2KGA A;  2PEI A;  3CME P;  1VQL P;  2AFD A;  1YIT P;  2CGQ A;  3G0V A;  1M74 A;  2GZF A;  2ROQ A;  4COC A;  5HVC A;  1NQ4 A;  2PEO A;  1L0H A;  2LIU A;  3CC2 P;  2KWL A;  5EW5 E;  2XZ0 D;  3EJD A;  1VQ5 P;  1CEI A;  2L22 A;  5KP8 B;  1NJI Q;  2N50 A;  2QNW A;  2JU2 A;  2KOQ A;  4U0B A;  1UNK A;  2GYK A;  4NEO A;  5EJD A;  1VQ6 P;  2KOD A;  2PEM A;  1VHN A;  2EG5 A;  2OTJ P;  3DS5 A;  2X2B A;  2Z44 A;  5F2O A;  3CPW O;  3RG2 A;  2KOR A;  2L6E A;  1VQ4 P;  1L0I A;  3P05 A;  5HGM A;  3RG6 C;  1Q7Y Q;  1IMQ A;  3CCM P;  2MY5 A;  1E0H A;  4H2Y C;  2CG5 B;  2LIW A;  2MVV A;  5F2N A;  3G26 A;  2JBG A;  1K30 A;  2XT1 A;  2DNW A;  1RO2 A;  2DGY A;  2QA4 P;  1Q86 Q;  5HGN A;  4QKO A;  2MF4 A;  2VLP A;  3CCQ P;  4U0E A;  1FR2 A;  2KG6 A;  1EMV A;  2JYL A;  2VSQ A;  2JAZ A;  3I55 P;  3CC7 P;  2PEK A;  1Q81 Q;  1KC8 Q;  1VQ9 P;  1GXG A;  2M8P A;  4COP A;  1VQ7 P;  4XFX A;  3CCU P;  3CMA P;  5HGO A;  2JYG A;  2VLQ A;  1VQM P;  1ZNV A;  1DV5 A;  3GZL A;  3G28 A;  3B4Q A;  1DNY A;  3HYB A;  5HV8 A;  2EHT A;  1BXI A;  3HZQ A;  1K73 Q;  4MRT C;  2FAD A;  2L0Q A;  4HKG A;  1KD1 Q;  3G1G A;  4IZ6 A;  2FVE A;  2GZI A;  1M6E X;  1E6J P;  1M6N A;  1VQ8 P;  4H2X C;  2NO8 A;  2XZ1 C;  2XV6 A;  2K94 A;  3VRL C;  4UHP B;  5JPA A;  3CCV P;  1KQS O;  1AYI A;  2BUO A;  4WYM A;  1YJ9 P;  2BHV A;  1KLP A;  2AF8 A;  4GR6 A;  2PNG A;  2KW2 A;  2PEQ A;  2OAR A;  2QEX P;  2FAC A;  2GZJ A;  1YJW P;  2FQ2 A;  2GDX A;  2KG9 A;  1IUQ A;  5KP6 B;  1JJ2 O;  2KGE A;  3I56 P;  3DS1 A;  4PH1 A;  1K9M Q;  3NTE A;  1F80 D;  4PH0 A;  1M1K Q;  3CE7 A;  4GR2 A;  3CXC O;  2CQ8 A;  1OR5 A;  2JQ4 A;  3NY7 B;  2AFE A;  1EIA A;  1S72 P;  2MR8 A;  3G1I A;  2LTE A;  1D1D A;  3H4E A;  4CA3 A;  3CCS P;  2JO0 A;  3H47 A;  2M8L A;  1A8O A;  1QVF O;  2GZG A;  3E2D A;  3LMO A;  3OW2 O;  5I4T G;  4DG9 A;  3B5I A;  4IPY A;  1VQK P;  1AF8 A;  1YI2 P;  3GZM A;  2KR5 A;  2E1M A;  3G71 P;  1N8R Q;  2K0D X;  3G4S P;  3DPH A;  4M0I A;  3G29 A;  2K0X A;  4R0M A;  2N6Z A;  2FVF A;  3MGE A;  3DS4 A;  3EJB A;  4U0D A;  1ZMB A;  2EIA A;  2JB0 A;  4H2W C;  2ERH A;  1UJZ A;  2GDW A;  2WPT A;  1RO0 A;  1AUM A;  5BS1 A;  2KOP A;  2CWO A;  4PXH B;  4U0F A;  3G6E P;  1K8A Q;  2LF4 A;  1QRJ A;  2MD9 A;  5CZD B;  3G21 A;  5HGL A;  4PWV B;  2FHS C;  3CCE P;  2LKI A;  2M5R A;  2KGD A;  2AVA A;  1X3O A;  1ACP A;  1VQN P;  4F37 A;  5BS2 A;  2ONT A;  2OTL P;  3CCR P;  1HQB A; 
#chains in the Genus database with same CATH homology
 2MF4 A;  2KGE A;  2K2Q A;  2KG6 A;  2KGA A;  1F80 D;  2JU1 A;  2VSQ A;  2AFD A;  3CE7 A;  2CGQ A;  2CQ8 A;  1OR5 A;  2JQ4 A;  2LL8 A;  2ROQ A;  5HVC A;  2LML A;  3NY7 B;  2AFE A;  1NQ4 A;  2FAE A;  2MR8 A;  1L0H A;  2LIU A;  2LTE A;  5KP7 B;  2KWL A;  2L9F A;  4CA3 A;  1DV5 A;  3GZL A;  2N5I A;  2XZ0 D;  3EJD A;  2N6Y A;  1DNY A;  2N98 A;  2L22 A;  1HY8 A;  3LMO A;  2KOS A;  5KP8 B;  2LOL A;  2N5H A;  5HV8 A;  2EHT A;  4DG9 A;  2FQ1 A;  1AF8 A;  2N50 A;  2QNW A;  4MRT C;  3GZM A;  2FAD A;  2KR5 A;  2L0Q A;  2JU2 A;  4BPH A;  2KOQ A;  4HKG A;  4IZ6 A;  2FVE A;  2JGP A;  4NEO A;  2K0Y A;  2K93 A;  5EJD A;  2K0X A;  4R0M A;  2N6Z A;  2KG8 A;  2FVF A;  3EJB A;  2FVA A;  2KOO A;  2LPK A;  4H2W C;  4H2X C;  2EHS A;  2X2B A;  2XZ1 C;  2GDW A;  2MR7 A;  2K94 A;  2K92 A;  3RG2 A;  2KOR A;  2CNR A;  4BPF A;  2KOP A;  3EJE A;  1L0I A;  4PXH B;  1T8K A;  2MD9 A;  5CZD B;  2L4B A;  2MY5 A;  4PWV B;  2FHS C;  4H2Y C;  2CG5 B;  2LIW A;  2LKI A;  2KGD A;  2GDY A;  2AVA A;  2M5R A;  2MVU A;  1X3O A;  1KLP A;  2AF8 A;  2MVV A;  2PNG A;  2KW2 A;  1VKU A;  1ACP A;  2FAC A;  4BPG A;  2KGC A;  2FQ0 A;  2DNW A;  2FQ2 A;  2GDX A;  2KG9 A;  5KP6 B;  1HQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...