2EHTA

Crystal structure of acyl carrier protein from aquifex aeolicus (form 2)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
77
structure length
77
Chain Sequence
SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title Crystal structure of acyl carrier protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 26
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ehtA00
2N6YA 2KGDA 2KOQA 2KGAA 3GZMA 2MVUA 2EHTA 2FQ2A 2LMLA 2JU1A 2AFEA 2EHSA 2CGQA 2N98A 4R0MA 1L0IA 1AF8A 2LIUA 4MRTC 2MF4A 2XZ1C 3GZLA 3RG2A 2FVEA 2K0YA 4PWVB 3CE7A 2KORA 4PXHB 2MY5A 1VKUA 2KR5A 2KGEA 2K93A 1DV5A 2K92A 1T8KA 1HY8A 2M5RA 4H2WC 2FAEA 1NQ4A 4H2YC 2FQ1A 4IZ6A 4H2XC 2LIWA 2KOSA 2XZ0D 2FACA 2FVFA 5HVCA 2FHSC 2KGCA 2PNGA 2MD9A 2K0XA 2AFDA 4BPFA 2ROQA 2MVVA 5KP7B 2L22A 5KP6B 4BPGA 2L9FA 2QNWA 2N5HA 4NEOA 2KG6A 1ACPA 3EJBA 1L0HA 2JU2A 2N50A 2LPKA 2N6ZA 2GDXA 2KOPA 2LKIA 3LMOA 2CG5B 5CZDB 2KWLA 4HKGA 1HQBA 3EJEA 2MR8A 2MR7A 1X3OA 1F80D 2KG8A 2L0QA 2KOOA 2FVAA 2GDWA 2K2QA 2AF8A 1OR5A 2LOLA 2VSQA 2KG9A 2LL8A 4DG9A 2KW2A 4BPHA 2JGPA 5KP8B 2N5IA 2GDYA 2LTEA 2X2BA 1KLPA 3EJDA 2CQ8A 2K94A 5HV8A 2CNRA 2JQ4A 4CA3A 1DNYA 2FQ0A 5EJDA 2AVAA 2DNWA 2FADA 2L4BA 3NY7B
chains in the Genus database with same CATH superfamily
3DS0A 1D1DA 3GZMA 4M0IA 3CCEP 1K9MQ 2N98A 3G29A 1VQ5P 4R0MA 1AF8A 2LIUA 1ZNVA 2JAZA 4QKOA 2Z44A 3RG2A 4WYMA 2GZFA 5HGLA 4PWVB 3CE7A 4COCA 4F37A 2KORA 1Q7YQ 2KGEA 5HGNA 2K93A 2M5RA 4H2YC 1M74A 2OTJP 2M8NA 3CPWO 1YJWP 1VHNA 2M8PA 2KOSA 2QEXP 2K5XA 2MD9A 1M6NA 2AFDA 1AUMA 2JB0A 2L22A 4U0AA 1YITP 2ONTA 3CCVP 5KP6B 3CCMP 2QNWA 1QVGO 2OARA 1ACPA 3DPHA 1EMVA 3OW2O 3LMOA 3G26A 3U43A 2PEMA 3P05A 2EIAA 1VQMP 3I55P 2FVAA 3G21A 2K2QA 2VSQA 2JGPA 2Z46A 2N5IA 3DS5A 2LTEA 2XXMA 1GXGA 3DTJA 1KLPA 3EJDA 2CQ8A 4CA3A 2FQ0A 5EW5E 2NO8A 2L4BA 2FADA 2JYLA 1RNIA 2PEJA 3I56P 2MVUA 2CGQA 5JPAA 1M6EX 4XFXA 3HZQA 2XZ1C 3CC4P 2JYGA 2FVEA 7CEIA 4PH0A 1E6JP 5BS2A 2KR5A 1W2BO 1DV5A 2K92A 1HY8A 5HGMA 1A8OA 2FQ1A 1AYIA 5F2NA 1VQ6P 5F2KA 2XZ0D 3CCJP 1VQOP 2FHSC 2GZJA 2KGCA 4U0DA 3H4EA 2K0XA 4BPFA 5BS1A 2L9FA 1M1KQ 3CC2P 3G1GA 2DGYA 2N5HA 4UHPB 3EJBA 1L0HA 1IMQA 2N50A 5HGOA 4U0CA 2KWLA 2PEKA 3B5IA 4PH1A 1HQBA 2JO0A 3EJEA 2GZIA 2MR7A 2L0QA 1RO0A 2KOOA 3GJNA 2PENA 1VQ4P 2GDWA 2AF8A 4XRQA 3RG6C 5KP8B 1CEIA 2PEQA 2PY8A 2X2BA 1KC8Q 5HV8A 1VQKP 5EJDA 4IPYA 2N6YA 2KGDA 2KOQA 3GKLC 5F2OA 1RO2A 2EHTA 2FQ2A 3E2DA 2LMLA 3G71P 1KD1Q 2JU1A 1GPJA 2AFEA 1YI2P 3MGEA 1VQ7P 1L0IA 2K0DX 4MRTC 1BAJA 2MF4A 3G0VA 2MY5A 1VKUA 1VQNP 2VLOA 2FAEA 3VRLC 1BXIA 2LIWA 1GXHA 2FACA 1NJIQ 3G28A 2PNGA 2Z45A 5KP7B 1E0HA 2BUOA 4BPGA 3CCSP 4NEOA 4GR2A 1VQ9P 2JU2A 4U0EA 1Q81Q 2LPKA 4COPA 1M90Q 2GDXA 4QNBA 1N8RQ 1VQPP 5CZDB 1UJZA 3LRYA 2BHVA 1F80D 2KG8A 3G1IA 2KODA 3CCQP 1KQSO 1A43A 2PEIA 2LL8A 4DG9A 5I4TG 4BPHA 3CD6P 2K94A 1VQLP 3CCRP 1S72P 4XROA 2AVAA 2DNWA 3NY7B 2KGAA 4XFYA 3WBHA 2CWOA 2OTLP 2EHSA 2LF4A 2P9XA 1YHQP 4XFZA 4GR6A 2XT1A 3GZLA 3CMAP 1UNKA 1K73Q 2GZEA 1MZ8A 2E1MA 3DS3A 3H47A 2VLQA 3HYBA 2GZGA 3M1MA 5DCKA 2K0YA 2XV6A 4PXHB 2EFJA 1T8KA 2L6EA 1EOQA 4H2WC 2VLPA 4U0FA 1NQ4A 4IZ6A 3CCUP 4H2XC 1VQ8P 2FVFA 5HVCA 3G4SP 2ERHA 3NTEA 2VLNA 2JBGA 2ROQA 3CXCO 2WPTA 2MVVA 3CMEP 2QA4P 2KG6A 1QRJA 1YJ9P 1FR2A 2EG5A 2M8LA 1IMPA 2N6ZA 4U0BA 2KOPA 3G6EP 2LKIA 2CG5B 1K8AQ 4HKGA 2GYKA 2MR8A 3DS2A 1X3OA 1Z6MA 2PEOA 3DS1A 3Q20A 1OR5A 1K30A 2LOLA 1QVFO 1Q82Q 2KG9A 2KW2A 3H0DA 1EIAA 1JJ2O 2GDYA 3DS4A 3CCLP 3B4QA 1YJNP 3CC7P 1ZMBA 1Q86Q 1IUQA 2CNRA 2JQ4A 1DNYA 1YIJP
chains in the Genus database with same CATH topology
2N6YA 2KGDA 2KOQA 2KGAA 3GZMA 2MVUA 2EHTA 2FQ2A 2LMLA 2JU1A 2AFEA 2EHSA 2CGQA 2N98A 4R0MA 1L0IA 1AF8A 2LIUA 4MRTC 2MF4A 2XZ1C 3GZLA 3RG2A 2FVEA 2K0YA 4PWVB 3CE7A 2KORA 4PXHB 2MY5A 1VKUA 2KR5A 2KGEA 2K93A 1DV5A 2K92A 1T8KA 1HY8A 2M5RA 4H2WC 2FAEA 1NQ4A 4H2YC 2FQ1A 4IZ6A 4H2XC 2LIWA 2KOSA 2XZ0D 2FACA 2FVFA 5HVCA 2FHSC 2KGCA 2PNGA 2MD9A 2K0XA 2AFDA 4BPFA 2ROQA 2MVVA 5KP7B 2L22A 5KP6B 4BPGA 2L9FA 2QNWA 2N5HA 4NEOA 2KG6A 1ACPA 3EJBA 1L0HA 2JU2A 2N50A 2LPKA 2N6ZA 2GDXA 2KOPA 2LKIA 3LMOA 2CG5B 5CZDB 2KWLA 4HKGA 1HQBA 3EJEA 2MR8A 2MR7A 1X3OA 1F80D 2KG8A 2L0QA 2KOOA 2FVAA 2GDWA 2K2QA 2AF8A 1OR5A 2LOLA 2VSQA 2KG9A 2LL8A 4DG9A 2KW2A 4BPHA 2JGPA 5KP8B 2N5IA 2GDYA 2LTEA 2X2BA 1KLPA 3EJDA 2CQ8A 2K94A 5HV8A 2CNRA 2JQ4A 4CA3A 1DNYA 2FQ0A 5EJDA 2AVAA 2DNWA 2FADA 2L4BA 3NY7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N6Y A;  2KGD A;  2KOQ A;  2KGA A;  3GZM A;  2MVU A;  2EHT A;  2FQ2 A;  2LML A;  2JU1 A;  2AFE A;  2EHS A;  2CGQ A;  2N98 A;  4R0M A;  1L0I A;  1AF8 A;  2LIU A;  4MRT C;  2MF4 A;  2XZ1 C;  3GZL A;  3RG2 A;  2FVE A;  2K0Y A;  4PWV B;  3CE7 A;  2KOR A;  4PXH B;  2MY5 A;  1VKU A;  2KR5 A;  2KGE A;  2K93 A;  1DV5 A;  2K92 A;  1T8K A;  1HY8 A;  2M5R A;  4H2W C;  2FAE A;  1NQ4 A;  4H2Y C;  2FQ1 A;  4IZ6 A;  4H2X C;  2LIW A;  2KOS A;  2XZ0 D;  2FAC A;  2FVF A;  5HVC A;  2FHS C;  2KGC A;  2PNG A;  2MD9 A;  2K0X A;  2AFD A;  4BPF A;  2ROQ A;  2MVV A;  5KP7 B;  2L22 A;  5KP6 B;  4BPG A;  2L9F A;  2QNW A;  2N5H A;  4NEO A;  2KG6 A;  1ACP A;  3EJB A;  1L0H A;  2JU2 A;  2N50 A;  2LPK A;  2N6Z A;  2GDX A;  2KOP A;  2LKI A;  3LMO A;  2CG5 B;  5CZD B;  2KWL A;  4HKG A;  1HQB A;  3EJE A;  2MR8 A;  2MR7 A;  1X3O A;  1F80 D;  2KG8 A;  2L0Q A;  2KOO A;  2FVA A;  2GDW A;  2K2Q A;  2AF8 A;  1OR5 A;  2LOL A;  2VSQ A;  2KG9 A;  2LL8 A;  4DG9 A;  2KW2 A;  4BPH A;  2JGP A;  5KP8 B;  2N5I A;  2GDY A;  2LTE A;  2X2B A;  1KLP A;  3EJD A;  2CQ8 A;  2K94 A;  5HV8 A;  2CNR A;  2JQ4 A;  4CA3 A;  1DNY A;  2FQ0 A;  5EJD A;  2AVA A;  2DNW A;  2FAD A;  2L4B A;  3NY7 B; 
#chains in the Genus database with same CATH topology
 3DS0 A;  1D1D A;  3GZM A;  4M0I A;  3CCE P;  1K9M Q;  2N98 A;  3G29 A;  1VQ5 P;  4R0M A;  1AF8 A;  2LIU A;  1ZNV A;  2JAZ A;  4QKO A;  2Z44 A;  3RG2 A;  4WYM A;  2GZF A;  5HGL A;  4PWV B;  3CE7 A;  4COC A;  4F37 A;  2KOR A;  1Q7Y Q;  2KGE A;  5HGN A;  2K93 A;  2M5R A;  4H2Y C;  1M74 A;  2OTJ P;  2M8N A;  3CPW O;  1YJW P;  1VHN A;  2M8P A;  2KOS A;  2QEX P;  2K5X A;  2MD9 A;  1M6N A;  2AFD A;  1AUM A;  2JB0 A;  2L22 A;  4U0A A;  1YIT P;  2ONT A;  3CCV P;  5KP6 B;  3CCM P;  2QNW A;  1QVG O;  2OAR A;  1ACP A;  3DPH A;  1EMV A;  3OW2 O;  3LMO A;  3G26 A;  3U43 A;  2PEM A;  3P05 A;  2EIA A;  1VQM P;  3I55 P;  2FVA A;  3G21 A;  2K2Q A;  2VSQ A;  2JGP A;  2Z46 A;  2N5I A;  3DS5 A;  2LTE A;  2XXM A;  1GXG A;  3DTJ A;  1KLP A;  3EJD A;  2CQ8 A;  4CA3 A;  2FQ0 A;  5EW5 E;  2NO8 A;  2L4B A;  2FAD A;  2JYL A;  1RNI A;  2PEJ A;  3I56 P;  2MVU A;  2CGQ A;  5JPA A;  1M6E X;  4XFX A;  3HZQ A;  2XZ1 C;  3CC4 P;  2JYG A;  2FVE A;  7CEI A;  4PH0 A;  1E6J P;  5BS2 A;  2KR5 A;  1W2B O;  1DV5 A;  2K92 A;  1HY8 A;  5HGM A;  1A8O A;  2FQ1 A;  1AYI A;  5F2N A;  1VQ6 P;  5F2K A;  2XZ0 D;  3CCJ P;  1VQO P;  2FHS C;  2GZJ A;  2KGC A;  4U0D A;  3H4E A;  2K0X A;  4BPF A;  5BS1 A;  2L9F A;  1M1K Q;  3CC2 P;  3G1G A;  2DGY A;  2N5H A;  4UHP B;  3EJB A;  1L0H A;  1IMQ A;  2N50 A;  5HGO A;  4U0C A;  2KWL A;  2PEK A;  3B5I A;  4PH1 A;  1HQB A;  2JO0 A;  3EJE A;  2GZI A;  2MR7 A;  2L0Q A;  1RO0 A;  2KOO A;  3GJN A;  2PEN A;  1VQ4 P;  2GDW A;  2AF8 A;  4XRQ A;  3RG6 C;  5KP8 B;  1CEI A;  2PEQ A;  2PY8 A;  2X2B A;  1KC8 Q;  5HV8 A;  1VQK P;  5EJD A;  4IPY A;  2N6Y A;  2KGD A;  2KOQ A;  3GKL C;  5F2O A;  1RO2 A;  2EHT A;  2FQ2 A;  3E2D A;  2LML A;  3G71 P;  1KD1 Q;  2JU1 A;  1GPJ A;  2AFE A;  1YI2 P;  3MGE A;  1VQ7 P;  1L0I A;  2K0D X;  4MRT C;  1BAJ A;  2MF4 A;  3G0V A;  2MY5 A;  1VKU A;  1VQN P;  2VLO A;  2FAE A;  3VRL C;  1BXI A;  2LIW A;  1GXH A;  2FAC A;  1NJI Q;  3G28 A;  2PNG A;  2Z45 A;  5KP7 B;  1E0H A;  2BUO A;  4BPG A;  3CCS P;  4NEO A;  4GR2 A;  1VQ9 P;  2JU2 A;  4U0E A;  1Q81 Q;  2LPK A;  4COP A;  1M90 Q;  2GDX A;  4QNB A;  1N8R Q;  1VQP P;  5CZD B;  1UJZ A;  3LRY A;  2BHV A;  1F80 D;  2KG8 A;  3G1I A;  2KOD A;  3CCQ P;  1KQS O;  1A43 A;  2PEI A;  2LL8 A;  4DG9 A;  5I4T G;  4BPH A;  3CD6 P;  2K94 A;  1VQL P;  3CCR P;  1S72 P;  4XRO A;  2AVA A;  2DNW A;  3NY7 B;  2KGA A;  4XFY A;  3WBH A;  2CWO A;  2OTL P;  2EHS A;  2LF4 A;  2P9X A;  1YHQ P;  4XFZ A;  4GR6 A;  2XT1 A;  3GZL A;  3CMA P;  1UNK A;  1K73 Q;  2GZE A;  1MZ8 A;  2E1M A;  3DS3 A;  3H47 A;  2VLQ A;  3HYB A;  2GZG A;  3M1M A;  5DCK A;  2K0Y A;  2XV6 A;  4PXH B;  2EFJ A;  1T8K A;  2L6E A;  1EOQ A;  4H2W C;  2VLP A;  4U0F A;  1NQ4 A;  4IZ6 A;  3CCU P;  4H2X C;  1VQ8 P;  2FVF A;  5HVC A;  3G4S P;  2ERH A;  3NTE A;  2VLN A;  2JBG A;  2ROQ A;  3CXC O;  2WPT A;  2MVV A;  3CME P;  2QA4 P;  2KG6 A;  1QRJ A;  1YJ9 P;  1FR2 A;  2EG5 A;  2M8L A;  1IMP A;  2N6Z A;  4U0B A;  2KOP A;  3G6E P;  2LKI A;  2CG5 B;  1K8A Q;  4HKG A;  2GYK A;  2MR8 A;  3DS2 A;  1X3O A;  1Z6M A;  2PEO A;  3DS1 A;  3Q20 A;  1OR5 A;  1K30 A;  2LOL A;  1QVF O;  1Q82 Q;  2KG9 A;  2KW2 A;  3H0D A;  1EIA A;  1JJ2 O;  2GDY A;  3DS4 A;  3CCL P;  3B4Q A;  1YJN P;  3CC7 P;  1ZMB A;  1Q86 Q;  1IUQ A;  2CNR A;  2JQ4 A;  1DNY A;  1YIJ P; 
#chains in the Genus database with same CATH homology
 2N6Y A;  2KGD A;  2KOQ A;  2KGA A;  3GZM A;  2MVU A;  2EHT A;  2FQ2 A;  2LML A;  2JU1 A;  2AFE A;  2EHS A;  2CGQ A;  2N98 A;  4R0M A;  1L0I A;  1AF8 A;  2LIU A;  4MRT C;  2MF4 A;  2XZ1 C;  3GZL A;  3RG2 A;  2FVE A;  2K0Y A;  4PWV B;  3CE7 A;  2KOR A;  4PXH B;  2MY5 A;  1VKU A;  2KR5 A;  2KGE A;  2K93 A;  1DV5 A;  2K92 A;  1T8K A;  1HY8 A;  2M5R A;  4H2W C;  2FAE A;  1NQ4 A;  4H2Y C;  2FQ1 A;  4IZ6 A;  4H2X C;  2LIW A;  2KOS A;  2XZ0 D;  2FAC A;  2FVF A;  5HVC A;  2FHS C;  2KGC A;  2PNG A;  2MD9 A;  2K0X A;  2AFD A;  4BPF A;  2ROQ A;  2MVV A;  5KP7 B;  2L22 A;  5KP6 B;  4BPG A;  2L9F A;  2QNW A;  2N5H A;  4NEO A;  2KG6 A;  1ACP A;  3EJB A;  1L0H A;  2JU2 A;  2N50 A;  2LPK A;  2N6Z A;  2GDX A;  2KOP A;  2LKI A;  3LMO A;  2CG5 B;  5CZD B;  2KWL A;  4HKG A;  1HQB A;  3EJE A;  2MR8 A;  2MR7 A;  1X3O A;  1F80 D;  2KG8 A;  2L0Q A;  2KOO A;  2FVA A;  2GDW A;  2K2Q A;  2AF8 A;  1OR5 A;  2LOL A;  2VSQ A;  2KG9 A;  2LL8 A;  4DG9 A;  2KW2 A;  4BPH A;  2JGP A;  5KP8 B;  2N5I A;  2GDY A;  2LTE A;  2X2B A;  1KLP A;  3EJD A;  2CQ8 A;  2K94 A;  5HV8 A;  2CNR A;  2JQ4 A;  4CA3 A;  1DNY A;  2FQ0 A;  5EJD A;  2AVA A;  2DNW A;  2FAD A;  2L4B A;  3NY7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...