2FQ1A

Crystal structure of the two-domain non-ribosomal peptide synthetase entb containing isochorismate lyase and aryl-carrier protein domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
KLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Isochorismatase
publication title Structure of the EntB multidomain nonribosomal peptide synthetase and functional analysis of its interaction with the EntE adenylation domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq1A02
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2fq1A01
1DV5A 2WT9A 1X9GA 4L07A 2FVFA 2N5HA 2A67A 2KG8A 2LMLA 2LIUA 3O91A 3PL1A 1YZVA 2FVAA 2GDXA 2CGQA 3LQYA 2KOOA 2FADA 2LTEA 2FVEA 2KR5A 2K2QA 2KG9A 4H2YC 1NQ4A 2LL8A 2M5RA 3S2SA 2FQ1A 1NBAA 1NF9A 4HKGA 2MR7A 2JU1A 4BPHA 1L0HA 2FACA 4DG9A 2CQ8A 5CZDB 5KP8B 2K0YA 1F80D 2L9FA 2MVVA 2VSQA 2KORA 2KGCA 2FAEA 4H2XC 4WGFA 4CA3A 5HV8A 1IM5A 3EJEA 3KL2A 2N5IA 2JQ4A 3O94A 3UAOA 2L0QA 2MR8A 2XZ0D 5EJDA 2K92A 3OT4A 1X3OA 3O92A 2N50A 5KP6B 1KLPA 2KOSA 4NEOA 1J2RA 3MCWA 3EJDA 4H17A 3R2JA 2LOLA 2KW2A 3V8EA 5HVCA 3RG2A 2MF4A 1HY8A 2FQ0A 3EEFA 1L0IA 2KGAA 2MY5A 3TG2A 2AVAA 2AF8A 2PNGA 1DNYA 3HU5A 4MRTC 1ACPA 2ROQA 1NF8A 2KWLA 1YACA 3O90A 2H0RA 2L4BA 2MVUA 2N98A 2KG6A 1OR5A 4R0MA 2WTAA 2QNWA 1HQBA 2LIWA 2KOPA 2N6YA 3EJBA 3TB4A 2FHSC 5KP7B 4BPGA 2GDWA 2B34A 3TXYA 3CE7A 3GZMA 1T8KA 2JU2A 1VKUA 3R77A 1XN4A 2XZ1C 3GZLA 2AFDA 4WH0A 2N6ZA 2FQ2A 1AF8A 4PWVB 4PXHB 3OQPA 2EHTA 2K0XA 4BPFA 2MD9A 2GDYA 2X2BA 2DNWA 2LKIA 2CG5B 3HB7A 4L08A 2JGPA 2K94A 2AFEA 2EHSA 2L22A 3IRVA 4IZ6A 2CNRA 4H2WC 2KGEA 3LMOA 1ILWA 2K93A 3NY7B 2KOQA 2LPKA 3O93A 2KGDA
chains in the Genus database with same CATH superfamily
3RKSA 2O2CA 1YZTA 1MXFA 2BFPA 2RGRA 1Z5ZA 5DBEX 4YXFA 2ZBUA 2JAQA 1KS2A 1G8YA 3VQTA 3EC1A 4Z1MA 1JZQA 1DOAA 1EFAA 5K3AA 2DERA 2XBMA 4JEIA 4LCJA 1W8DA 3VR6A 2F67A 2X86A 4IYJA 5AKJA 4ZI5A 2NV6A 2TMDA 2BZ1A 1NXTA 1P1HA 3MILA 3OEED 1TJYA 3PGVA 3DNPA 2QYOA 3PKJA 4BLOA 4D9NA 4DIUA 1J0EA 1XQYA 1XZGA 1UKYA 5HJ7A 1X7YA 4MRNA 1CQZA 2JU1A 4BPHA 2B4TO 2AQIA 3B6KA 2HK7A 4QO8A 1E4YA 4JLMA 1PV2A 1NFQA 1E0AA 2L9FA 3LCJA 2I9KA 3UUEA 3H5IA 3WVNA 1VECA 4DF3A 1KU0A 3UB4A 5K7SA 2QN7A 3IX7A 2HSZA 4QU5A 4EYSA 4C0XA 1U0GA 4Q02A 2G0NA 4C0KA 5ES4B 4ZVQA 2Z45A 5I4TG 2I80A 3IT0A 1UBMS 4I3FA 4R6XA 2OXIA 4ENTA 5K8UA 3S1SA 1VQ5P 1TUBB 3DBVO 5J5AA 4EEXA 1PSZA 5I7EA 4D9IA 2V65A 2O8FA 5I8PA 1VYVA 1LDBA 2OV1A 4QWWA 2PUAA 1L6RA 3AIKA 3BJZA 4CM1A 4BO6A 1E89A 4N40A 1G1MA 4U0BA 4OMDA 1AUXA 1RIIA 6ABPA 3W3AA 2BVNA 4NMXB 5TDHA 3HCOA 3A1UA 3TD6A 4RIFA 4YN3A 3REGA 1WY5A 3DHVA 3GMSA 3VR4D 1Z7YA 1VCIA 4PU0A 1F60A 4C4PA 3W5AA 2DYKA 3E3NA 4FQ8A 1AIPA 5CB4A 2QZZA 1V3VA 2ZIEA 3TG2A 3NTLA 1KGSA 1UBCA 3A06A 4J8PA 3KYJB 4BVHA 3U1BA 5ARDA 1KYXA 1FYWA 3AEXA 3BHMA 4Y2PA 4BNMA 3OTOB 4ZAXA 2MMCA 3FFXA 1NLZA 4Y6RA 5F2EA 5AJWA 5A02A 1YB7A 5B30A 2CCGA 1XTUA 2A0WA 3D7SA 4LISA 2AKYA 4BQOA 1W36B 5K0NA 4HGOA 1WV1A 2PUBA 4LYFA 4US0R 4L0MA 1SUDA 2DX7A 1JE0A 1ZUHA 2FA9A 1JIQA 1U04A 1IH8A 3HJNA 1GPBA 2D1QA 4G07A 3O4HA 2FHSC 1CUYA 4G2NA 3O8BA 5K0BA 2QJTA 1WZ2A 3KJIA 1DJMA 4RMIA 1ZK3A 2O2HA 2J32A 3ELYA 3ZW8A 5IT5A 2GCOB 3X1WA 3OM8A 3AUYA 3PHJA 4EVIA 4Z9YA 2FW9A 1D6NA 2FMIA 4O2RA 5K3SA 4EFKA 2WABA 1NSYA 2FG6C 3H4EA 3B6ZA 3EDOA 4C22A 2GDZA 4HEJA 2VF7A 4HLDA 3QF4B 3E9ZA 3TBKA 1HG0A 2A0XA 1I7DA 3F9IA 4QGAA 4KE9A 5A0FA 1KO7A 4NMHA 1AHIA 4PANA 1Y3DE 2GX6A 3QITA 4CDRA 2YWBA 3KDPA 4O3MA 4F2GA 3RARA 1M8GA 4HGNA 1WHSB 5IT4A 4YCMA 4AN0A 2C9CA 4L15A 2NP7A 1WDWB 3OPQA 4PZ0A 4BY9E 5IDQA 4BP1A 1RADA 1RWQA 1VLJA 4B7UA 4CKXA 1VHWA 4QUBA 1JB1A 5JD5A 3ANMA 2I4OA 2VOJA 5TRTA 1GGNA 1CUIA 1VHDA 5COBA 2YHBA 3S27A 3ZDCA 2PXAA 2EERA 2XI4A 3ODGA 4OBBA 1ZBQA 3C70A 4LFBB 3GJZA 3H9JA 1C29B 3QX8A 2W2PA 3ED1A 3F5DA 4YRGA 1WMEA 2X13A 3OTHA 2WKQA 2IT1A 4GLLA 1HK7A 2C1XA 4XQ0A 4AKTA 1BJTA 1GSHA 1ZGJA 1U4SA 4V38A 5HILA 2NAFA 4HVTA 4TSRA 5EHQA 1Q82Q 3P4UA 3WGQA 2EDAA 1E1RD 4LOAA 4HDRA 5ALQA 4B3IA 3KZVA 3M6UA 4HQ6A 5JSUA 4LX8A 2GHIA 1KJ8A 5CA1A 4OAPA 2FSVC 2FZKA 4I5GA 3GJ0A 3GWZA 4FFRA 4WDQA 3ZK7A 3RG6C 1UOQA 1GNSA 3PT9A 4JLVA 1EFVB 3H99A 3IP6A 4ZAYA 1AHHA 1VFNA 3VNBA 3HDHA 5F7XA 4MS1A 5ESDA 2D3WA 1P39A 4H2XC 6NULA 1SCDA 3FR8A 2W4IA 1SD2A 4MQ4A 2C2ZA 3AZQA 2F64A 3MJRA 3UWMA 2VTDA 2WE7A 4Y3UA 2C59A 1W59A 2CNKA 3PKZA 1USWA 2VQ3A 1U1CA 5SY4A 4B6SA 3QKTA 5C3UA 3OKFA 4LRXA 1U0LA 1X3SA 1YMQA 4GL4A 2GLXA 4MS4B 4JZKA 1ADJA 4CKWB 1K08A 2XVYA 2IEZA 4RSHA 3CJQA 4KMSA 4RVCA 1MENA 1NBWB 1QYCA 1A4UA 1A95A 1KFJB 1V3TA 3CX8A 2J9XB 3NVAA 1TAQA 4RE6A 4UNSA 3WIBA 3D8UA 1JSLA 4BUJA 4F71A 4TMXA 3EX7C 4H59A 2Q2VA 2V4ZA 4IF4A 3BXPA 1OZ0A 1OYWA 3KUKA 2X1HA 3DR3A 5EIAA 3TCNA 4W9MC 2BYTA 10MHA 1ZRSA 1U28A 3WHKA 3EPRA 5I3ZA 3EZNA 4XCVA 1WF3A 4TWZA 5C0OE 1DAMA 1JDVA 3WDKA 4R40A 4FHZA 3RUHA 3N70A 4CVNA 5KCMA 4C3UA 5CDHA 2JS7A 2G5PA 5FBKA 1M1YB 3PX7A 3OTGA 2VG8A 4GAEA 3Q88A 5JJLA 2ICAA 2WHRA 4LE2A 5FYQA 1C0EA 3KHUA 2C00A 4W8GA 3D7KA 4PVCA 1Z6GA 1RLUA 4AYTA 4LSMA 1BE8A 4GI1A 5HTKA 2YWEA 4FD2A 1KMCA 1L7BA 4P7BA 4CKCA 4XRGA 5KOJB 4ID3A 3ZGZA 1SVMA 4H1VA 3AHEA 4L50A 1AQYA 1RWPA 2E37A 2BBOA 1AXEA 2O1EA 2QG6A 4FQ7A 4BO1A 5G0TA 3DWFA 1UXGA 2D4AA 3DMFA 5DH9A 5HVNA 3PG5A 4HEA6 4BO8A 3NRJA 1LTQA 3OA0A 2FB9A 4NOJA 3T1YB 2JGDB 2CDCA 1LBSA 2FMFA 2ZQ5A 2W70A 2E2WA 3R09A 3MWDA 3PUYA 4W5HA 4WSOA 1N5LA 4PC2A 3UOWA 3F4BA 5IH7A 1UBNA 1QR6A 2EWVA 2Q62A 5ELXA 2ET6A 7CEIA 1H8EA 1VDMA 1JQLB 2AXPA 3DBLB 1U8TA 4HI0E 3SP1A 2RAVA 2ZROA 3ZHVA 4C05A 2PAAA 2ZWOA 1QTQA 4X61A 3V7FA 2FEPA 1DJQA 2GCNA 1EK5A 1H6CA 3M4YA 3E8XA 5G0UA 2WU4A 3TIFA 1Q7RA 2H54A 4BWGA 5F1OA 2G4VA 1YC2A 4Z0HO 1Y9JA 4NULA 3V2UA 4JCOA 1L4FA 1MC4A 2BMDA 4HKTA 4Y6QA 1QP0A 4NKRA 5AVSA 4F56A 2FZCA 2HRZA 1Q1QA 1RWVA 3MGEA 4LGYA 4K8RB 4QU8A 2IYNA 1GKLA 4MPJA 5ALXA 2HOQA 1UPTA 2WWIA 4LVOA 4OXIA 5DOZA 4B7CA 5H80A 4PG8A 2DRIA 2PL5A 1KVUA 2GK3A 2Z6QA 4MVWA 3HKDB 4IDHA 5LNK1 4FBLA 4BLUA 3VOBA 2BZ0A 2OV8A 1N0IA 4YJ3B 4CM4B 1RAIA 5LMCA 3CMEP 3DP7A 3UH1A 4X3OA 4RKQA 2AKEA 4KPUB 1NL3A 2I54A 3B9PA 4O59O 1YR8A 3WI7A 3FPHA 4DJDC 3BCSA 4QPCA 3V9PA 5KS2A 3PD0A 4FBMA 3RTBA 4P80A 4GM1A 5LMNB 3JQ7B 4IIYA 4A8JB 2CBGA 4RPJA 3F5MA 2QX4A 1JNYA 2WYWA 5EZYB 4LFCB 1ECFA 1I6WA 4IFTA 3D6FA 3D6AA 4D0GA 4BP9A 5C8XA 1GUBA 2FKAA 1XAJA 2X1VA 1ZS9A 2YV4A 3WQQA 4L72A 3SDSA 2XVMA 2AOUB 2Z04A 4RD2A 2CXPA 2VWQA 2CC2A 3B7WA 3FIUA 3HEMA 4I0WB 1CBUA 1RXVA 3OE4A 1DELA 1PG0A 2Q2OA 2YXDA 4LJ4A 2PA3A 4LWZA 3TFWA 1BGXT 3VI4B 2ZB4A 2IHVA 1KQGA 1FFXB 4CIYA 4UQOA 3OEHD 3MK31 5ABPA 1QUEA 1DO8A 1XTBA 2O2DA 4I4LA 4IV0A 1AQIA 5IAOA 4HZIA 4DA8A 1W2HA 2Z3VA 1HMYA 2PKEA 2QN6A 3EA4A 2QM3A 5DWQA 4KG7A 4LXIA 4MIYA 1N92A 2J9FA 2XUJA 3BXZA 4PSUA 1YVDA 4W9NC 4NG5A 4JBLA 3NMUF 1FDUA 1WVMA 3IQIX 1Z3IX 1YB1A 1PNTA 4G1FA 4UHFA 3M6WA 3RS2A 3BJRA 1RWMA 1ECLA 3IA2A 2QTBA 3QWFA 4GUDA 2QVZX 3RYFB 4I08A 5IT0A 2O14A 4RJ2A 3QKRB 3PEYA 2P4EA 2W6JD 2EF0A 3JAKA 2ZRAA 2IXAA 3VSEA 1GRRA 1NQAO 2O8FB 1A2BA 2FSGA 3VH2A 3DDSA 4CTMA 1QFSA 2YMPA 4ZHQA 3D4BA 1G6OA 3IBYA 4W1QA 5FOWA 3PNVA 3ZCQA 4A26A 2FN3A 4LPSA 5EE0A 1GHTA 1EJ0A 1OY1A 1MJHA 4FNGA 4HTFB 3VR0A 1UBRS 2AJ8A 3KXDA 3VMMA 5AQ1A 1VCNA 5JVDA 1FFYA 4DRXA 2X15A 4IVQA 1TCCA 2V98A 4FN5A 1PX0A 2JGPA 3RTAA 2O0HA 4HPJB 2QRPA 4IKEA 2Q6IA 1PT9A 5D85A 2CJYA 3SEAA 1U9IA 3JQDA 2OYRA 4EJ2A 3UWSA 4Z2AA 1W73A 3H5LA 3ND6A 5F3RA 1W4LA 2PFGA 5K2MA 1D07A 2X42A 2I4LA 3EGIA 3H2GA 1LPAB 3UK0A 3THXB 4MI6A 4Q00A 4XDZA 3ZIUA 1ZP6A 2DWUA 2NU6A 4KFSA 1FJXA 5ERYA 5FO1A 2BWJA 3B7PA 1N5JA 3SPXA 1OF1A 4BVFA 4WK4B 4QECA 1TZCA 1KEUA 2WTXA 1FX0A 3FR7A 4NBVA 2A9RA 3ADBA 4UPVA 4TOIA 3I5UA 4KAJA 2FPLA 1V3QE 4JLBA 1NDUA 4G4IA 1WB9A 3QSGA 2GZMA 2C9ZA 1HDYA 4S2UA 3H4IA 4K26A 1RYHA 4BV8A 4MWZA 1CY7A 5B3KA 4FW8A 1GZDA 2R7AA 2Q1XA 3A1TA 2AG8A 4R9NA 2QLMA 3UA3A 1QYRA 1SPBS 3QTBA 4RYLA 4AKSA 3DXYA 1NY6A 1CUFA 2I78A 2PLWA 4WKCA 3TL6A 5L6LB 2MR7A 1Q15A 1Z35A 3RTEA 2BM9A 5BN3A 4IR7A 4W9RA 4C5AA 4LMRA 1IOLA 1JR3A 2P9QA 4MV4A 2OB2A 4DILA 2G4CA 4I55B 5ES3A 2JZOA 4X24A 3H3JA 3NFYA 2E4WA 2YN2A 1WCWA 3U3JA 5L7WA 1N2CA 3DB2A 5A3JA 2UKDA 4IUCS 1ENZA 2HLPA 5IC4A 3JD2A 1TTPB 4EUSA 5JLAA 1UBJS 2JB9A 1CY2A 2XCIA 5HIIA 4B2YA 2FHSA 2EQ5A 4R9RA 4W5NA 1J70A 1YB6A 4DWOA 5T4EA 2YJTD 4BEVA 3SNKA 4EZBA 5TY0A 2N50A 1EVEA 1LSOA 1U3GA 1WZEA 3GO4A 4JUAA 1CERA 1Z6XA 4L6IA 3TRHA 1N57A 2LOLA 1XL0A 1E9SA 2MSLA 2ZXFA 1SOAA 1NBMA 1JQBA 2R6GA 3K9LA 3NIDB 1LI5A 4IH1A 4R69A 2HA5A 4MQ6A 2VLNA 4UHKA 1TX4B 3T3GA 2NQTA 3BXXA 2RSLA 2CJFA 3PQDA 1ZCBA 2IUUA 4IX9A 3U37A 1Y5RA 4HDRB 3PPYA 4HYQA 4Q7JB 4QGBA 5KDLA 2OPHA 4D3SA 4EI7A 1AK9A 1O0SA 2WDZA 4RIHA 4EFLA 1SVIA 3MD0A 1F5NA 3JVUA 3LX8A 2NO1A 4NBKA 4AY3A 4YV1A 1LI7A 4MUNA 3ML1A 4GT1A 1QZTA 1WY7A 2AEJA 3KLMX 5T7BA 3ZVMA 4QG7A 2QTVA 3R3XA 4MS1B 3QRWA 5F9MA 1X42A 4P2GA 3SJZA 4CETA 2CF6A 3IT3A 1L7DA 2NOAA 3ODPA 5KQSA 4LDZA 4UHHA 2IU3A 5HTOA 4D3XA 2F1HA 3SYTA 2C5BA 3QKWA 2ONCA 1WDKA 2OTCA 2RJ3A 3L8GA 1AO0A 2ZI4A 4LDQA 1ZD2P 2VHCA 3DKVA 3R77A 4FJ2A 1XN4A 1XCPA 5J1SB 1VL5A 1ZU5A 1CUXA 3NHYA 4J4HA 1KZ6A 4LBVA 4Y2RA 4KPYA 1JPVA 5T57A 3WWZA 4U7GA 3TR6A 5BW5A 4URXR 1B8PA 4J0CA 4AMUA 3DOOA 5JCPA 1RQ2A 5KVAA 4DPMA 2BFBB 2IHZA 3D4LA 4RWZA 1NDQA 5K0EA 2J3DA 4KN8A 4NBTA 5A05A 3ZQKA 2XCSB 2V6IA 3TW0A 1T9HA 1HNNA 2FQXA 3ITNA 3LL7A 3BCRA 4WZAA 4YLEA 1J2JA 1A0OA 1Y4UA 2R85A 3WSTA 5T67A 3RVPA 4FE4A 4PPQA 1XRNA 2VH5R 3E81A 2D7CA 3EGCA 3KTAB 2I2XB 2H48A 3MRSA 3SBXA 3WWOA 3KJEA 3I6BA 4BNLA 5E3HA 1QYDA 4MPRA 4UVGA 2PS1A 4M9RA 2OOKA 5GM1A 4KQFA 4L7QA 4W5QA 221PA 3X3HA 4AZ3A 2Z8YA 2C4UA 2CNNA 4MGIR 1AG9A 2DHQA 3A3OA 5KOHA 1IVNA 2DU8A 4U0FA 1UBLS 1E6KA 5AUQA 3AEQB 3X1ZA 1IZZA 5H68A 1JJ7A 1QLWA 2QMEA 4I4TA 3T15A 4Y2UA 1VHQA 4A5OA 3PENA 3HBFA 2B20A 2HFJA 2BDTA 2KBEA 5CA0A 3GEMA 3RFFA 2OKCA 4MWBA 1SIWA 3BQMB 1EWKA 2IE8A 4KQIA 2HWUA 4QDOA 2G04A 3WGHA 1HEIA 5IUJC 4X20A 1WCV1 5GV8A 4AX8A 3WFJA 2YN0A 2B1IA 3H2KA 2WTBA 3ET5A 3MS7A 4II3A 5GZ6A 4BN0A 4D9GA 4KLCA 4QXRA 1M0EA 2PU5A 1T5DX 4QYMA 4MO9A 5F33A 4A6XA 5H3CA 1T5LA 2G88A 1GA1A 5CEJA 2J3KA 1OTHA 4QOSA 2KORA 4LTDA 3JALA 1YL5A 3RVJA 1LU9A 4MQUA 3ZWBA 3AX6A 3D54D 3FPJA 3V7UA 3OCVA 4CF4A 5K0SA 1PS0A 4I4NA 3ZCXA 1J23A 1CX9B 3NDIA 3PQ6A 5EQTA 1Z7GA 1CS0A 2ZUUA 4GZ3A 1RHQA 1P1RA 3HACA 1NQOA 2IY8A 4OLHA 4KWCA 2RE8A 2JIBA 3TSZA 1MNQA 3KELA 5THKA 3QX3A 5TSDA 5KU1A 1Q0PA 3RAFC 4GRIA 4ZYVA 1C30A 1NNI1 1WXWA 4IHJF 5K0FA 3B85A 2JAWA 2QTAA 2FAXA 3Q41A 2G63A 5HVCA 2P4UA 1JXAA 2E82A 3H75A 3CF4G 4ZOAA 2CFSA 4GPIB 4GO1A 4RORA 4HSEA 3T94A 1WPQA 1UWKA 3EAGA 3KQWA 4Q9IA 4GR6A 2D5CA 3OOYA 4FOPA 3WLQA 2IIBA 2GR9A 3PFIA 1DCFA 5IAEA 5EI5A 2CDRA 4WLEA 1SJ9A 5JBNA 2G9UA 5K05A 2XWBF 5CH5A 2Y77A 2ZAIA 2ZIZA 4HQLA 4RD1A 2AN3A 4B3HA 1SUEA 2CE7A 4WBSA 5DRTA 5IBRA 1AUVA 3LF1A 5D3KA 4KR7A 1GQYA 3HZZA 3D1JA 4OB8A 3T4XA 1YR3A 3PDUA 3IYLW 3ONFA 1ONBA 1YZFA 3STWA 5BV8A 3IVAA 3GCZA 1GDHA 3ETCA 5A9TA 2WY2D 3FSGD 3ZBQA 4KVFA 2O2GA 1YF3A 1Y3FE 1Y82A 3VC3A 3KYIB 5E8RA 4U5QA 3UJCA 2CJWB 4XXHA 2WV9A 4DMUB 1TZMA 3I1YA 4KK4A 4TTSA 1S5PA 1OTYA 5CYOA 5I8ZA 2X9GA 1GQQA 1OXVA 1NGSA 1ZN8A 3B53X 1EIZA 5BV2P 4J0GA 5CXXA 4FGUA 3CU5A 4MYRA 3FUCA 4IQFA 4ALIA 4ZC1A 3BHJA 2H7YA 3D3EA 3DEJA 3HWX1 2A94A 3K8QA 5AW6A 2A58A 1P6XA 1IHOA 1VHLA 5G53C 1W7AA 5DLDA 2XB8A 1ZC4A 2Q0SA 3CZAA 3UYLA 4ZA2A 5E9WA 3OZUA 2CG5B 2YMLA 3CSDA 4QEKA 1HNWB 1DEAA 4HV4A 1BDIA 4S12A 2VTEA 1TOAA 1OV4A 1B26A 3JR7A 3BKXA 3NHBA 3WRXC 5H4GA 3DBIA 5J2UA 5IKMA 1E2DA 3QG1A 5HK9A 3CF0A 3QENA 1P9LA 1DC8A 1XKLA 1QH0A 3TL2A 2IVZA 1NYTA 4C7JA 5HJEA 1ITZA 1CRQA 4X3PA 1FC0A 3HJHA 5EPOA 4LHEA 3QFSA 1L5GB 3WLEA 1ZKDA 2PKQP 3W6OA 3ZC3A 3W4IA 3R44A 2P41A 1TLTA 1CDOA 2N75A 2W2QA 3IIEA 1VSBA 3D1LA 3EG9B 2PT6A 3BL5A 1ULTA 2IPOA 2B5WA 2VJLA 4OA8A 5FWNA 3IIJA 3K92A 3PD1A 4M1ZA 2CCKA 1EDZA 1NRJB 2G25A 4PZ9A 3RCBA 4J29A 3H83A 1NJIQ 4BMYA 3P32A 3C45A 1U2SA 1YQUA 3T9EA 1Q2UA 1ZPDA 4H31A 1GG9A 2CLCX 2QRUA 1CEYA 1SKAA 1Q6YA 5E0OA 4C7OB 1CY0A 2GBCA 2IF0A 4LNAA 1FEZA 2HU7A 4W9NA 3N2KB 3D3KA 1M66A 2VT6A 5CGZA 3G0IA 5DV9A 3R24A 7REQA 2O7NA 4X85A 2ZQYA 4HF7A 3G5TA 3FVQA 5DIZA 3C5CA 3DYVA 1LF0A 1Z5GA 4ZDKA 2Y71A 1M6WA 5AK4A 3V4LA 3LBNA 3N74A 4M9SA 2GN8A 1PT6A 3SX0A 3ZKWA 1YR2A 2V9CA 4CQMA 2GJ8A 1JLKA 1NJGA 1KDYA 1KK2A 2D54A 2BFFA 1YZNA 2GBPA 3IXQA 3O84A 3ZZ1A 2G1PA 2WF5A 4JI8B 1UPCA 2YHSA 1FX0B 4MV9A 3B82A 5HQ3A 5K09A 2ZR0A 1SEVA 3CZMA 3FBWA 4XX0A 3ER8A 1VG1A 3MWLA 4AX4A 3PWZA 3RG2A 2HA0A 3E3MA 5TPZD 1ZCZA 3L8ZA 1VBKA 4W5TA 1XLVA 4I5FA 3AVTA 4IGAA 1ZNVA 4INOA 5I9NA 1NXXA 4MRTC 1E3DA 2GN6A 2ZYDA 1Z13A 2F6RA 3LGAA 3KKEA 1FNCA 2ZRBA 4BLRA 1MPXA 2OM2A 3U4AA 2YHIB 4OOEA 1JKJB 1B74A 4MMXB 4GKKB 4C6TB 2LE0A 1EHIA 1JKMA 2BMJA 2V5VA 1VGQA 3IP8A 3IOEA 1J56A 3G2QA 3OF5A 1XHLA 1CWUA 4R3WA 2DMRA 4XE5A 4BU1A 1U2TA 1V2HE 2G3YA 2PL3A 5A6SA 3AF2A 2GCGA 1JG4A 1H94A 4MXDA 3ASUA 4L6CA 4N12A 5FA8A 8GPBA 5TX7A 4LGCA 4BNFA 2Z5LA 3DONA 1N2CB 5E6RA 3WOHA 4G0YA 2G83A 3JQGA 1U63A 4HGYA 4C29A 3AWDA 3EXFA 3W2IA 1YBHA 4NSNA 5I7WA 2QW0X 5EP3A 4LIPD 1HEUA 4NBWA 2WR8A 4RK0A 2POCA 1RE0A 4LF8B 1WCIA 2P1DA 2YDXA 1MGPA 2Z2ZA 3Q11A 5JTTA 2ZYGA 5HPYB 4WERA 3A10A 5EMLA 1XPOA 3SZ3A 2V6FA 1JQDA 3L0YA 1AUMA 2B3TA 3HMQA 1PUJA 3KJNA 4L5IA 4E30A 3BTVA 1Y37A 4OHCA 4YEDA 4AO8A 1ZJ5A 4DLYA 1JTVA 1E69A 3PNQA 1P0MA 3M83A 4A8PA 1RQGA 1HQYE 2NAPA 3TOCA 5HKKA 2RCNA 2VDVE 3T95A 2DM6A 5BR8B 1A4RA 3BM5A 3NUZA 4EF6A 2CXRA 3W2TA 4XZ3A 1UFRA 1EM6A 2QTVB 2YJGA 5KJEA 3TG8A 2AZXA 2VNAA 4UHJA 1CY8A 3BSFA 1Y89A 4UM8B 3REQA 3T7SA 3V4PB 2WT9A 2WJJA 2J5RA 1AD2A 1D1PA 4L5YA 3FXAA 1XQVA 2ORED 1AQ6A 5DIFA 5FL7A 5IF9A 2PZLA 4GE0A 3ETLA 5LUAA 1JA0A 4IBOA 1UC5B 1YHYA 4BQPA 3OTQA 1N6IA 1NXWA 1F51E 1OLUB 1ZIPA 5KJFA 1MEEA 3NHFA 2LW7A 1E3WB 2VT7A 4P6VF 2Y9MB 3U4CA 3ZOKA 2KG9A 1CFJA 5JC8A 3DMGA 3FOZA 3TECE 2SBTA 5I7UA 5U4QA 3REFA 2OK7A 3TTXA 4G97A 1SQ5A 3GNTA 4JBYA 1EG7A 2J6BA 3OVMA 3BFPA 4U5XA 3VKHA 1IMJA 3QI2A 2QM8A 3GNLA 4JI2B 3BTUA 4KBYA 3RC9A 4PLGA 5KOYA 1EA7A 2ZGVA 4K05A 4QUIA 3UHJA 3IOCA 1R0RE 2C2HA 1BCRB 2XNSA 3COSA 4RJIA 4HAIA 4TVSA 2HR1A 2EFEB 2ATVA 4LBZA 4QRHA 1I1NA 3SF8B 2ZIXB 1FDRA 1XQWA 3GVHA 3X43A 3CWQA 3O31A 3DKIA 5EINA 4AZ3B 2L42A 3RC8A 3WZLA 3BWCA 3JZIA 3I4CA 4DW8A 1OXKB 2F1KA 2ZTLA 1Z4IA 1XNGA 3SSNA 5KOHB 2BFCA 3HM9A 1NONA 2WTUA 1PLKA 4YBZA 5FTNA 1F12A 1BYIA 5JMTA 4IZIA 2B94A 2HMWA 4DJTA 4JVNA 4IH9A 3TLXA 4B84A 1QAQA 1NI4A 1A3CA 1SEPA 2EHDA 2Q9AA 4DS3A 1G6Q1 2WVAA 4IDBA 3I76A 2XIJA 3GQBA 5JPIA 4XKJA 4O4JA 2NP6A 5JEEA 1EFTA 1T1GA 1T4CA 4MIOA 2BI7A 4E31A 2FH5B 4I50B 1ULBA 5EJMA 2E4VA 1QH8A 1YK0A 2Y0CA 3I0NA 4X20B 3KJFA 4XUCA 3WNZA 1JAIA 2I99A 1IHXA 3L43A 1KZ9A 1XTJA 4UNIA 4LV5B 3V4SA 5AXDA 2JI7A 2ZW9A 1QB7A 4DCUA 1EGMB 1LX6A 1VMIA 3L01A 3WP0A 4ZK2A 1T4MA 2J67A 3SEZA 1FDIA 3ZNQA 5JNVA 2GFQA 2WD7A 4EBBA 3QLEA 3OJCA 4Q3KA 2DFLA 5BWCA 4CI9A 1CUZA 1SKQA 1Q1BA 3CGGA 3WGMA 2ZJ4A 2VDJA 1JIJA 4BNYA 3DS1A 2DT8A 2JBGA 4QAJA 3OZ7A 3HSYA 2HBQA 1NKTA 2X3YA 4Y9UA 5EPUA 5JCOA 2VK2A 1DBVO 3L0PA 3IA7A 3Q3HA 5D7BA 4P4GA 4OQPA 3TOSA 4E5MA 5JS1A 3DLAA 2XMQA 3A9RA 4MKHA 5A5VA 1YL7A 1VQNP 2O8DB 2H4ZA 3CVOA 2ZSUA 2EJBA 1D1DA 3OZWA 5COQA 3U3MA 2Z5VA 3HZRA 1Z8FA 1USIA 4REMA 1YIOA 2VF2A 3AJEA 4XLZA 1PWHA 5G1PA 5CYPA 4OHRA 1GGHA 1YZGA 3D0OA 4ZQGA 1RVDA 4C01A 4Z5XA 5IHPA 2LCFA 1Q86Q 4EL5A 3M4XA 3PC2A 3H5RA 4EHHA 1X7ZA 2BFDA 4B3MB 3CC4P 1AY0A 3GEIA 2VKTA 1K2VN 3AUKA 2XXMA 4H2WC 4Q1FA 2W98A 3TTVA 3EVBA 4CKYA 2FUG6 2CGEA 3B3QA 3DAHA 4UCXA 4TS4A 1DC7A 4FCCA 1E5DA 1JT2A 1ARZA 3QWIA 1SC4A 2LPKA 1SCKA 3D0QA 5FPQA 1NV8A 4PLHA 4GLBA 2Y05A 3DL2A 5AM2A 2ZYVX 1Y63A 1M2OA 1XCLA 1T2CA 3AU9A 4G84A 4IJUA 4UM7A 4NIMA 2UV8A 3QVKA 4FFWA 5CX1A 2JAUA 3F3YA 1M2GA 3CKYA 3BXGA 4V1CB 3OQHA 3B6JA 2PH3A 3R3JA 4DXDA 3PGLA 1FRFS 3GOQA 3O2QB 4HUJA 4QDTA 4P81A 5EIHA 1OXUA 2GDXA 3L1VA 4GR2A 4U63A 1WB4A 3OZVA 4KV9A 3UVEA 1OPXA 3CJRA 4FZ3A 4TTTS 4RDXA 2G40A 2J0EA 2PT5A 1RPJA 1GAWA 1V43A 2AE1A 3G1IA 1SH7A 5IVKA 5I7RA 4U0CA 1ZI8A 4N9QA 1BCSA 3E9DA 1F1JA 4HH0A 1IXSB 2J3QA 4Q37A 2Y1WA 4M7OA 5TMDA 1YVEI 4H7EA 1R0WA 2Y1OA 3HFJA 4U8GA 5IK2A 3DDZX 2HYIC 3ICEA 5J2UB 3RC1A 1LZLA 4J9VA 1UWVA 3HVIA 4F2WA 1FYVA 3ZY3A 4X54A 4E1BA 2O3UA 1ISJA 4LEIA 3T4PA 5CLJA 4AQYB 2EKPA 2GM9A 1GGVA 3K9BA 1NLMA 1SHZA 2W6NA 4WFIA 2AWNA 3OFKA 1P2TA 4JI4B 1Q44A 3FDFA 4MJ7A 4NJMB 3FJYA 4UM9D 1N1GA 1YNSA 2A59A 4PO8A 4XTRA 1B23P 3EJDA 1GL9B 4J4TA 3ZV6A 3KWFA 1LLUA 2BISA 2D2EA 2QQ5A 1PUIA 1NBIA 1OAOC 4GF5A 4D99A 2JJ2A 2JVKA 1TQ6A 2A14A 2ZWPA 1Y9DA 3IEIA 3MTAA 2JCVA 2AQKA 3MQFA 4GI3A 1JEOA 1AGNA 1E2PA 4PONA 5DYTA 4WBNF 4WY5A 2MSNA 5CITA 4MVJA 1GGEA 5FR2A 2ROQA 1K6MA 4FM9A 2AI2A 3IEVA 4E88A 5LQCA 2ZUTA 3HR4A 8OHMA 4FFBB 2GZDA 2PRSA 2GHQA 1Q6ZA 2JFHA 4I3GA 1EWTA 1HFEL 2CFCA 2D0IA 4PCLA 3UAVA 1LS1A 2RI1A 3HYSA 4JJAA 4P35A 5ENVA 4BEJA 4MDYA 1JR6A 5AM1A 7REQB 2R87A 5ERGB 1IIBA 4JODA 1HNZB 3FJ1A 3H1BA 5IP5A 4RDHA 4YCAA 5ITWA 1AZLA 1VKOA 5B7NA 2JD1A 4AP5A 2BCGY 1V9SA 4FWBA 4CGYA 1VKUA 1QHXA 1T2DA 1P31A 2NXEA 3KTOA 3R0IA 3T1NA 5DTQA 1YS7A 1UKAA 4JEUA 4B2LA 5KQLA 4RE5A 3V1KA 1Y80A 2HA3A 3A6FA 5HQ3B 5MN5A 5MN4A 2ZDHA 3OP1A 2XQVA 4YPFA 3VPHA 1TXGA 1BHSA 3HVHA 3CURA 4L08A 3I39X 3TZHA 3UJBA 2AD1A 2JJ1A 4MWOA 4UOZA 1A77A 3CC2P 1XZAA 2AQ8A 2QQGA 3K20A 2JCBA 1RXYA 1NNLA 1VLVA 4FYJA 3ZEIA 1NIPA 3L7YA 5JBQA 2QTZA 5EN4A 1D6MA 2WHPB 4MARA 5DDIP 4WHMA 3OP4A 2C1EA 3COVA 4ZDWA 2R25B 1MC1A 1ZHFA 3NIBA 3ROGA 4JP1A 1IOZA 5DM0A 2OE2A 4DQVA 4YMHA 3WFZA 2BGUA 1AKQA 2J4FA 3BFVA 4DUGD 4MEBA 5A6SB 5M7EA 2Q1SA 3T34A 3QV2A 4LAFA 4YFYA 1FFHA 4G1EB 4AY4A 2C2XA 3RABA 5LD2C 2I8AA 4R51A 2IWHA 4JU9A 3WK6A 2DULA 4BE4A 1YBFA 2NO9A 2C8JA 1MGOA 1LPMA 3EXFB 1A96A 4WZZA 4B4UA 3A4VA 2FGKA 3I6ZA 4GWGA 4ZZ3A 2GZSA 2ZJ3A 1WJGA 4PYRA 4IDCA 5C81A 3T1HB 3GLFA 1RPZA 4G65A 4FC6A 4IMRA 3OO1A 4A91A 2AFVA 2FZEA 5CTAA 2VCHA 5FOQA 1SN7A 1OVMA 4W8OA 1C1HA 3SKYA 3HRKA 1S3IA 4RPGA 1RMYA 4N3AA 5DM60 5HOEA 2XB9A 3WY9A 3UK1A 1W5EA 3H42B 4D6XA 1ESDA 3B9QA 2IYWA 1QQBA 2OO5A 3WAJA 5K1ZA 1GCGA 1Q74A 2IYXA 3FTNA 3GRKA 1Q1AA 1SELA 1U0FA 3FRHA 3HXTA 3D4IA 1DAIA 1KK0A 3OF2A 3PUZA 3UGQA 1C7QA 3A6KA 3HHEA 2CL6X 3KHSA 1N6HA 1WMDA 2K92A 1UMDA 2G70A 4HFRA 1KKLA 1MX5A 1UIRA 3DXZA 5EQJB 3NOQA 1UZAA 4D44A 1RM0A 3IAXA 1K63A 1M2EA 4D3YA 1PEDA 4UZFA 3R9WA 1W2BO 1R3DA 3FFAA 3JRWA 3OIVA 4ECEA 1V8BA 3ZWWA 4RTQA 1PZFA 1SA0A 1GKUB 3VBCA 4K5QA 3HL4A 4AIIA 1F2UA 2XNHA 2A1TR 3TF5A 4TL8A 4F4CA 1PRYA 2HH9A 4LYGA 2ZSFA 2ACVA 5J40A 4YDQA 2F1RA 3VAAA 5A4FS 1ECPA 3E2PA 2Q7DA 4EW3A 3O9MA 3MMPA 5T8KA 821PA 4DR5B 3K73O 3KJXA 1A1SA 3C3PA 3ND9A 3HYRA 4F4JA 2ZM5A 3MOSA 4B43A 1OH6A 3DE0X 1JDPA 1Z56C 3SF0A 1SR8A 3DZKA 3VNQA 4G8CA 1GADO 3T9AA 3R5HA 4BNJA 1OB2A 5AT1A 3JQEA 1ZNXA 1YFJA 3R20A 4QUAA 4I99A 5HP4A 2XRZA 1DDGA 4AJNA 4CI0B 3DFIA 3TQCA 2CB0A 3GDWA 3ONWA 1CY4A 1E8MA 2PGXA 3CX4A 4M4SA 1T9GR 3GZLA 3VZRA 1WZUA 4WY8A 4B46A 4DSOA 5BW4A 4IG4A 2V3VA 1SOUA 4U1RA 3S5JA 3O26A 1JN0A 2RI6A 3BS4A 2H4WA 3DE5X 2K0XA 3AR9A 1Z15A 4AJHA 1FP6A 3CW9A 4JOCA 2OFFA 1MR3F 3ILSA 3PFCA 2DNWA 4PHFA 2BFNA 4PO3X 1TZ2A 2XXAB 3G8YA 3K2IA 4DKXA 5KI6A 1YMVA 1T4CB 5C18A 1DWOA 5I5GA 3DFMA 3ETEA 2JLWA 1QH8B 3DZIA 1TCAA 2PLAA 4UPDA 1VBMA 1TO2E 1NJ8A 2JGIA 3CPEA 3ZDQA 3K05A 3PNLA 4PLWA 2ORYA 1VI2A 1XZMA 1UJMA 1KFKB 1PHRA 1XU4A 1QTNA 4JJGA 3RTGA 4BLTA 5BSKA 3ZK8A 1RZRA 1NKVA 2JEZA 1ZGCA 4ZEMA 5DCYA 2G17A 2J4DA 2NTVA 1XCOA 4UARA 1BE1A 4C3ZA 1GNLA 1OA0A 2R60A 3HBJA 4RACA 4WKBA 1Z0JA 2ZRQA 4R84A 3FGPA 3N2YA 1Z0UA 4URHA 1FBTA 3PIDA 4V0ME 1Z83A 1DNPA 1NE7A 2HEGA 2ZJBA 2CEAA 5JXJA 5DNAA 1EEHA 1WS6A 2CGQA 2UZ1B 1UNKA 1C0LA 3WIUA 4EAAA 4RVOA 3I28A 3HZQA 5EP2A 4MPDA 5G0WA 621PA 2CK3D 1OBVA 3TZCA 2NYVA 2X0NA 2RHRA 1Y1TA 2YMQA 3ZDAA 2Z56A 3COWA 3Q7QA 1LUAA 2NUPA 3DLTA 1KPGA 1C7RA 2V6GA 3OE1A 5TQJA 3LCUA 4R8VA 5DB4A 4PIPA 1UXOA 2EARA 2WJHA 1XD8A 3H04A 3N7AA 4MICA 2PZMA 2QX9A 3RRMA 2H1IA 3LQKA 4C03A 2O7RA 4EF4A 1TZKA 5BUQA 2X2PA 2BFDB 4PN7A 3F8TA 1F48A 1PD1A 4F5ZA 3MPUA 1MRSA 4DYVA 3ICQB 1GNQA 5G4KA 2H16A 1RI2A 3OM0A 4TQ9A 4QSMA 2CV2A 3HJTA 2QWXA 3VZBA 3M4ZA 3ZGLA 7ABPA 4PO1A 1ZD3A 2VHEA 4EELA 1UQTA 3DVSX 5EXDA 3V4OA 2NVOA 4JKOA 3NEAA 4UBLA 4F72A 4MW5A 4DDTA 3KEGA 2C0PA 3HVRA 3PKIA 3QH4A 5CX1B 2I65A 5DX1A 4M1SA 4QATA 2EIHA 3RFVA 3QY9A 2ODQA 3CCVP 2FJUA 5EWLA 1FVOA 4RA9A 3NCHA 2ZT5A 4P4NA 1WLSA 2Y27A 3OJOA 1A5SB 2Y1EA 3F3SA 3P0IA 2I7CA 2W2XA 2WWVD 3P9ZA 4QBHA 3HCRA 3HU5A 5LXTF 3OQMA 4PGHA 1Y8QB 2GEUA 4PYLA 2Z1NA 3L6DA 4DM7A 1MJGM 2LKDA 1LPOA 2C5FA 2BE9A 1GKKA 4OUDA 3TOXA 1JQ3A 3QVSA 3U4HA 1Q7TA 3EWAA 4TKZA 4WECA 2QBYB 3RE1A 3WJAA 2Q2NA 3GX1A 5JH7F 1NU6A 2XA9A 2HK9A 4LHYA 4YC7A 1JJVA 2A2ZA 2FFJA 3CX6A 2K0DX 2PXHA 4WXMA 5LA6A 1P7CA 3TLKA 5DO9A 1BFDA 1A9XB 4TV9F 2FR8C 5CVCA 4M87A 2ADFA 2O6HA 4F7DA 1FU7A 2Z98A 1UDRA 3DWIA 1XP5A 2O8BA 1O9BA 1E1CA 5EIOA 1E63A 3GGJA 2WIGA 4WKOA 3GUUA 3KWMA 3CUSA 3V4RA 2HK6A 1BMQA 2R751 4B17A 1Z12A 3HNPA 3H5WA 1KAHA 3O3MB 3KIPA 4MV0A 4QJ4A 5DLEA 3TLEA 2VP9A 2ZJ5A 1KMMA 1VJGA 4UE6A 3LFTA 4QHYA 1UJ5A 1ZJ4A 2VJOA 3EGXA 3X2SA 3U3OA 4O8CA 1G98A 4PY2A 3OU2A 3O21A 1ZJWA 4NEHB 3BQ9A 3TR0A 1QQ7A 2FLKA 4ALKA 5L3QA 3AERA 1WXQA 3N86A 1S3FA 3CZ5A 1FUKA 4I1RA 5EXPA 4RSRA 1IN5A 1E0SA 2VF8A 2XUFA 1I4LD 4PPGA 1DHRA 2C2WA 2Q5OA 1U9JA 4BO2A 1OA1A 4RPLA 2DUWA 1GAXA 4F3CA 3L05A 3GDFA 3VGPA 1R4MA 4UEQA 5JRDS 2QA4P 4K9NA 5L51A 2ZYWX 4HX9A 3WYFA 3LX5A 1HE3A 4PYQA 4NCXA 3TOVA 4EVRA 4ARBA 2FLWA 1JWLA 2LDBA 4YP5A 1NF2A 1E9CA 2VSFA 2O57A 5BSHA 2WZDA 1I7SB 3GLSA 1V11B 3KR9A 4NTZA 3LFUA 4IUYA 4EY8A 2OBXA 3QEKA 1TA9A 5KKCA 3ENNA 2IYOA 1RI3A 4CCWA 1EFDN 2J9YB 1FS4A 1XDBA 4OP2A 4DMMA 2QVXX 1Z6YA 2IY9A 5D84A 1OLOA 3SXUA 3VZQA 2A1UB 3CKMA 4UFNA 2XNDD 4ND6A 3UOAB 4IRUB 2G5GX 1CUWA 1Q7GA 5TPWB 2FETA 2QUKA 3PPXA 4CLXA 1E96A 3DLIA 4YPVA 4BC0A 3ADPA 1R4NB 1E4EB 1ID1A 4N9WA 1UBHS 2QA5A 2ZS7A 2AHOA 1FSZA 2EL9A 2EJUA 3KB8A 4IOLA 4RNCA 1XMSA 4XYGA 2B8JA 4WFJA 3UT6A 1UAGA 5IHXA 1OD6A 1IUPA 2I4TA 4MV7A 4JQZA 4KN9S 2RH4A 1CT9A 4FLMA 4MR7B 1JYEA 4W1RA 3SXJA 4YT2A 1GL6A 4ZO4A 4BFWA 1IJKA 2F9LA 2AT1A 3KSMA 3MCWA 1QE5A 3Q1LA 1N0UA 1HETA 3N53A 2UYGA 4H1HA 4YRAA 1EM8B 2ZE8A 4EG1A 4MA4A 1ECJA 4DPKA 2OB1A 3KT3A 4HNSA 2R86A 4FNOA 1TVCA 5HA5A 1N9GA 2PHZA 4IXMA 2XQKA 4DLNA 4MI3A 3IT2A 4Q9JA 3RSFA 1AUQA 3OC0A 4LS3A 2DF8A 4WJLA 3RS0A 4X3CA 1SRRA 4ITUA 1JHAA 4M9QA 5MHTA 4AJOA 1Q12A 3UEOA 4S3MA 1MB9A 3ELDA 4NMLA 4J94A 3I58A 2Y9PB 3UMCA 3WA7A 9LDBA 2C8VA 3GLGB 4O5AA 3EMKA 5F4BA 1JHYA 1PDVA 1XDDA 1C9MA 4JFAA 3IOBA 3MA0A 5BWMA 1EYZA 4YP1A 1L5WA 3JU3A 2WPDD 1RRPA 4Z3KA 2Y93A 3AXSA 3BWXA 3IB6A 2O5RA 4EA7A 4ZQFA 1NV9A 1I30A 1Q92A 4I8DA 5FFFA 3UW1A 3FMVA 1RYYA 5THQA 4U0AA 1JZTA 1RYFA 3I9V1 3P0HA 4O4LF 4S24A 4YYEA 5HUQA 1G8PA 3NTQA 5F64A 2MD9A 3U61B 4G24A 4TTQA 5C80A 5CLLA 4LXYA 3ZUPA 4NZYA 5AIAA 1OI3A 5K3OA 4Y9SA 1CB0A 1UINA 5HF6A 1SHJA 2NO0A 3V8NA 4O4IF 1G20B 3LT0A 2GXQA 1IL0A 4DTIA 5L40A 4GR5A 2QMQA 4QDJA 4IVRA 4I3HA 1V4BA 4JY7A 4UKDA 1DEOA 4GEGA 1X86B 1XLTC 1A9TA 2WWXA 2IGBA 2XD9A 3C97A 3MTGA 3P52A 3G4SP 4IPYA 1AT1A 3PFWO 4XSGA 3LPLA 4Z8XA 5FKJA 2VAPA 2B8NA 3OBIA 3ONNA 4BQQA 4YP0A 3AINA 5FWXA 2SCUB 1T8YA 4D6PA 1TFUA 1AKNA 1XQXA 3A36A 3FWYA 1YB5A 4MLDA 4FYWA 4PSKA 1LRJA 4CM7A 4I19A 4OBWA 3W1WA 3A0RB 3PHLA 2RGAA 2YWCA 3ONVA 4BO7A 1E6JP 2WJVA 1SWWA 3NBFA 2A67A 3HU1A 4OIFA 4DQ0A 4XA8A 3TRJA 3DTYA 2GPYA 4HNQA 4G0MA 1G291 5EUMA 2VPIA 3M6LA 1EJ2A 3CIFA 4YJ2A 3CG4A 3G2IA 2BPOA 5ALKA 2QRLA 5F3WB 2FCRA 3JWJA 2ZIAA 1KYZA 3DMYA 3S1AA 1WKCA 5GP1A 3MINB 4XWYA 1NVBA 3RHZA 3IAHA 5FL7D 3DDWA 2IDJA 3BILA 2W0SA 3F5FA 3JPWA 2PANA 2Q5HA 4M89A 4TTRA 3VYTB 4EG6A 3T3PB 1APBA 4MQBA 2NX2A 1WETA 4KQMA 4A2WA 3E9YA 4IIJA 3VPGA 2D7JA 3HY3A 2Q50A 2QJFA 2Y0EA 2XV6A 3G2JA 1JILA 1YSCA 3JARA 5IKXA 1ZIXA 2DETA 1WQ4A 2WUFA 4I6EA 5HDBB 4BLSA 4BV9A 1XSEA 1E2HA 2BKEA 4MVCA 2WUVA 3N5KA 4FBGA 3Q20A 4BQNA 4BWVA 5EMKA 3VRHA 3N2GB 3W77A 3HDTA 4CIAA 4EATA 3ACBA 2LKCA 1XYYA 2W22A 1WUTA 1YRYE 5FPPA 1KIAA 3EY9A 4NEOA 1EDDA 2V9ZA 2HWWA 1U7TA 2Q46A 3I23A 4II2A 3WL7A 1IJEA 4RELA 2YWDA 1RHRA 1RSZA 3T3IA 1N2OA 3WWPA 2LPMA 3WBJA 2GJAA 5TLSA 4CT0A 2H85A 4ZZ2A 2J6IA 4M83A 2YQ4A 1G5TA 1N5OX 4GZLA 4TKUB 1LVGA 1G16A 3HDGA 2J33A 4HZUA 3GYGA 4K0RA 4RL6A 3VHXB 4PSDA 2DBQA 1ZM2A 2WNIA 4EYEA 1ZVVA 3G28A 2NYRA 4FNAA 4RMNA 2GEVA 4X6YA 1A2KC 4EG5A 2FYTA 2QRVA 5IARA 2WF6A 3G9ZA 5TMBA 4N03A 5G4KB 5HBRA 3L0ZA 4RJJA 1UKZA 2H7VA 2OVFA 4ILEA 1R6AA 1L5KA 2CY0A 4BPGA 1VLMA 4GI5A 1YHZA 2XB6A 4KFTA 2YCLA 3F96A 1G7SA 5COAA 2RAPA 3CH4B 2ZRJA 5F52A 2OFOA 2XKJE 3N8NA 2QRJA 3O2SB 5KYWB 2SKCA 2CE2X 4LFAB 3VPAA 1E5VA 1I14A 1T3GA 3WRWA 4ECAA 5D5HA 2EHTA 1XTQA 3FNGA 3GEBA 3SKXA 1DC5A 4NZOA 4A4DA 5DBFA 2WMDA 5EWLB 3K94A 4CQJA 4BQFA 4C0SA 3WG9A 2NYAA 2HLDA 5K03A 1VJDA 3IRVA 3K0AA 1DO0A 4OPMA 2V0GA 1OBHA 3HB5X 3U6BA 1XQ9A 3I3SR 2J31A 4KX3A 5F9FA 1KO5A 4OHFA 5IVDA 1OI4A 4IZHA 3W9UA 3D6VA 4DCGA 2Z58A 1PBTA 4QPZA 3RLIA 3IL2A 3UMYA 4MV1A 3QE0A 4QHSA 4J07A 2NO8A 1IB6A 3N39C 3M49A 4I5EA 2W42A 3UV7A 3D7MA 4I9HA 3VU0A 1IUKA 1TA0A 1RDFA 3MYRA 5BYKA 4C2TA 3QOFA 2BEUA 5LA6B 2RHMA 1DQNA 1P7WA 2BSXA 2JFWA 1R16A 2HWKA 1U9ZA 3CUKA 2IXBA 3GD7A 3I1FA 3QU9A 4D02A 2W0MA 3PYMA 2VZ9A 3BDIA 4WJZA 5DBGA 1YA4A 1BEUB 4TXLA 2O8BB 1J00A 3RYIB 4KO1S 2Q2WA 2EF1A 1MA3A 3NT4A 2EGUA 3RVMA 2R5WA 2GK4A 1QE0A 2D1YA 4D9KA 3QOYA 3VBEA 3RSHA 1XROA 5CCEA 3TNLA 5CZDB 3CF2A 2HU2A 2WI8A 5FV4A 2CVZA 3PR1A 4I5IA 2J0UB 4DQDA 4DY6A 1NUPA 1R8JA 3LWDA 3EGVA 4G56A 2IRWA 3H17A 3OC6A 1LDMA 4QREA 5F51A 4G1UC 3PGA1 4FOOA 3AERB 1Y0BA 3I04A 5M29A 1ENYA 2OO3A 2NSJA 5F2OA 4GUAA 4Z8YA 2TYSB 4PRYA 3SIXA 5IX8A 1NI5A 1SG0A 5IJ0A 2Q41A 4JAVC 2XAUA 4HYYA 2W6ZA 4H0FA 3HP4A 2UVQA 4AF7A 4EUFA 5HR5A 5FV7A 2JC3A 1SBZA 3EEBA 2CBZA 4QSHA 3VDNB 2CL0X 1PW7A 1GKYA 4IDPA 1Y6GA 4EKNB 4NPCA 1PEYA 3LKDA 3OKAA 4UMVA 1RKUA 4OGFA 4D97A 5JE8A 3CFYA 4D9JA 5BW8A 2CLFB 2ZT8A 5BNTA 1DE0A 3R1IA 3HVUA 3OZIA 1RPNA 3BC1A 3HNRA 4JD5A 2O6LA 4PRZA 4C87A 4RM3A 4XWAA 1W47A 4CF3A 3ILHA 1V37A 1IYZA 4RY2A 3WMXA 4BRZA 4CCYA 4X9XA 4Q9DA 4NLLA 1QOPB 4C07A 4KE7A 5EOVA 4OBEA 4HK4A 3PJGA 1HPLA 4O29A 4DV5B 4HGZA 2OR3A 3GJ3A 4UBMA 1QAOA 4POOA 3GLUA 2G9QA 3P27A 3ORFA 2IP2A 2BKVA 3TPFA 4JNKA 5CHEA 4ZFNA 3OX2A 4R1NA 3CVYA 1P61B 4FHCA 2H57A 4JBXA 1Q0QA 4L02A 4U9IS 2CLHB 1T9DA 1OFGA 3I61A 3PDIB 1T9KA 3EASA 2IUTA 5FIUA 1B0PA 4KQGA 5F7ZA 1OT3A 1P4SA 2YWXA 4D81A 2GD2A 2H3EA 4MCAA 2WSLA 3VISA 3WGTA 1EESA 1LTKA 2HNKA 2HADA 3PLNA 2HF9A 3VR3A 2Z6AA 4BFCA 3F1KA 3CCEP 4G6ZA 4P7JA 1Z25A 2OUKA 3O8NA 2CWWA 4PPNA 2VT2A 5D5QA 3T9DA 1RQNA 1OH7A 1YDMA 3V8PA 3E7PA 3LBYA 3B6IA 2GN0A 1Q0ZA 4MR8A 2C4NA 1EEXB 1JVNA 5TC4A 4UAUA 4G0WA 1F0KA 3WLJA 4MVJI 1Q1NA 1FRZA 4MUIA 3IH5A 4E4RA 1GM5A 4XIYA 1SHKA 1QU3A 1E9VA 3SXPA 3HRHA 2FPUA 2YUTA 3KFXA 3OJEA 4R8SA 3DNFA 3E1GA 5AM4A 4ZCRA 5G0VA 1SY7A 3HUTA 5C1OA 3T1TA 3PFHA 1XMJA 2DBVO 3OLWA 2OZEA 3AR6A 3A4LA 1SBHA 4QU0A 3ZBUA 4FMCF 4ZMSA 2LNDA 2AN4A 4R9SA 2OCAA 1JQAA 5BS1A 1ETHA 4B8ZA 5J9FA 3GFFA 4BFVA 1NNSA 1JMVA 1EVQA 1K97A 1EB8A 1DJPA 4XYEA 4NZPA 1RJ9B 2VKQA 3R0QA 3V42A 2AK2A 5LD2B 1IN4A 3I12A 3D6TB 1H8HA 1TVKB 2IEBA 4JT8A 5BVHA 1GDTA 5EUBA 3PPIA 1ACLA 4H3VA 3CVWA 2H31A 2BCJQ 2I4MA 3L4BC 2G72A 4ND7A 1NW6A 5E6UA 4ANFA 3DE7X 4IW3B 4W1PA 2WB2A 1PNOA 3P9KA 2DOKA 1N2IA 6Q21A 2QUIA 1H5QA 2BD0A 1Z3CA 3IERA 2E6KA 3N05A 3PQ2A 4QYWA 3T1VA 3FN4A 3WE7A 2WJPA 1OZFA 3T5DA 2W2TA 3ZV7A 4CU2A 1D1TA 4JZYA 2P9HA 3HXMA 5JZVA 1I4EB 4LF6B 1JHXA 4MUYA 3N28A 4IO1A 2PGLA 3SM3A 5FWXB 1VL1A 3EGEA 3O94A 3Q8WA 4YRDA 2L0QA 2WWRA 4U7JA 4EHNA 4EOGA 5DULA 3QOXA 3C15C 3WIDA 4BKQA 5GWXA 1RWNA 1L5FA 1L5YA 1XKQA 4P1ZA 2J5BA 3PTLA 2NO7A 3WO1A 4KRXA 3NAQA 3LIPA 1QK4A 4ZU6X 3KE9A 3TUZC 1GTSA 2AS0A 3OIYA 2H2HA 4OJNA 1YZUA 4FTWA 1TKBA 1BFUA 2V6JA 3TKAA 1Y8RB 5FJIA 2Y4NA 3N2ZB 2YJNA 3VHQA 3QELB 4NL4H 1V47A 1SIBE 3HKCA 4JI0B 4DUYB 1JDJA 4WNAA 2O54A 1U4OA 2CYCA 4O2BB 3K1TA 2R1UA 1N7HA 4QLAA 4CEIA 1I4TD 2CDNA 3S1AB 4CKBA 2IOQA 2J5KA 4UW9A 1F8YA 3ZQ4A 4K6FA 5JMWA 4EYOA 1C1DB 2A0FA 1WXEA 5A4KA 2GUGA 5GVRA 4MAAA 3VNAA 1I7LA 3AHGA 5K6RA 3UXYA 2FPXA 4QNMA 5EHXA 1AXRA 3L8DA 5JO0A 1B93A 2F8LA 3G6EP 4F5DA 3JQ9A 3Q3EA 5DKFA 2POQX 4KN5A 3JARB 4XVQA 1AU9A 2XE7A 4M7RA 5DYWA 3GKLC 3W8EA 5E38A 1T8KA 1QDLB 1ZH6A 2DT5A 2IU6A 1A71A 1WDLA 4X5OA 3TQRA 1SKMA 1IMQA 1Q84A 1P7YA 1QIGA 1UP4A 3OFND 4MAMA 5L7YA 3HL0A 1LDEA 3SEFA 1F3OA 5KMGB 4KIUA 1LWNA 4IX1A 5AJUA 4P0PB 3GUHA 2G4LA 2V7UA 3LUBA 3LYUA 2IFTA 1QC5A 1NP3A 2QZSA 4MKIA 4M0FA 1T9AA 2AK3A 3PQ7A 3CVXA 2PUEA 3DD5A 1RVV1 3KJZA 3RH0A 5L4SA 4PWYA 3O74A 4Y7DA 1R0ZA 1AHNA 1UFVA 2BFMA 1J8YF 2C61A 1DKQA 4X7PA 1EIAA 1EPUA 1NPTO 1SUPA 4PM4A 5K6TA 3F8WA 2P2NA 3J81A 2FHPA 3TQTA 3TQSA 3NY7B 4JXXA 4F6RA 4KIGA 1PKXA 3WBKA 1KIFA 5ILGA 2C5HA 4OHWA 4TRJA 4RPIA 4ZVMA 3ZWAA 3UT5A 1WQ3A 5I9SA 3BGWA 4U7DA 4JITA 5KTNA 4FIZA 4XD2A 1QXSA 2QRVB 4OXKA 5DZSA 4GGPA 4AUNA 4UQLA 4W6QA 3O38A 2W93A 2Z1MA 3E48A 5CFLA 3OFVA 4GC9A 4KGDA 5B36A 4CU5A 3PGJA 2D3TA 2NPOA 4L5BA 5GONF 4BZXA 1GPH1 1Z2NX 2EJWA 4DLKA 4N0DA 4OQMA 4K6CA 1TMYA 2XTZA 3VVLA 1SVLA 3K7EA 3RJ5A 1NYLA 3PEFA 4JC4A 3GJSA 5EHIA 4DVJA 5ICEA 1MRNA 1RLMA 1SRQA 3MLEA 2PUWA 1T2UA 2R7KA 1Z4JA 2WDPA 2F43B 3OEWA 4X91A 3IVCA 4UHEA 4OI1A 5FUMA 3GDHA 4RK1A 3UMFA 4E5PA 1Z4LA 4PSAA 1C2YA 4YUWA 3IDAA 1T3ZA 4HEQA 3CCUP 5CAEB 1K9MQ 4CBVA 3QUTA 1ZK2A 2FWAA 2OILA 2WE8A 4X71A 4HXGA 4F6LA 2P75A 3GDOA 2IF2A 4E0BA 1O6BA 3IEPA 3PUIA 2XOXA 3ONDA 2C9DA 4DRZA 3JQ6A 5ALTA 4DG8A 4DFDA 4ZO6A 5LR6A 3KQMA 3VC1A 4V3BA 3M33A 3CLUD 4OXQA 4M21A 1F8XA 1XWIA 2NO6A 2FR1A 2XMSA 4E4TA 4E2WA 3S81A 2BTEA 1AKVA 2HMTA 3CPSA 4X8HA 5M2QA 2EX4A 4QFMA 3H5AA 1YQGA 4N39A 4B7XA 1JKXA 4M0UA 1EFRD 1TAUA 1KI2A 4FOLA 4EDFA 4HRYA 4MUKA 1IAVA 2E48A 2ZDGA 3ROFA 3ECSA 4RTNA 4XWTA 3KB6A 3UPDA 1R5NA 2JGLA 5JAOA 2W6ID 3D43A 3ZHRA 5DTRA 4ARUA 3ULKA 2BF4A 3Q87B 3HY4A 1G5IA 1R0YA 4ND8B 1X1RA 1R6XA 2R0QC 4PCVA 4M1EA 1K6XA 4BVEA 5B57C 2YW9A 3QE4A 5E4TA 4H60A 2R2AA 3N0XA 2QMUA 4IG9A 4Q7LA 3W34A 2QTCA 1RE1A 3QP9A 4TT8A 4X97A 3PVCA 4NS4A 2XY4A 5B4TA 4ITRC 4OM7A 2X14A 3IUMA 1VSTA 3HP1A 4OBXA 3H7IA 1YDHA 4M0KA 3NJ8A 2GCPA 4NH4A 4R5MA 2FUKA 4ZQHA 3CCQP 1DKPA 1K3UB 2YNMA 3CZQA 3GAZA 2QNWA 3U7QB 3BMCA 5KNCD 3U5TA 1L5RA 4LMBA 1E32A 2C7QA 5DNEA 2GZFA 1Z06A 1T0BA 2AJLI 3BEDA 2NTEA 4B2PA 1N6LA 1DBPA 2PS0A 4TKMA 3V6MA 3CE7A 1E3TA 3CMMA 4G5QA 4ZYZA 5LZ4A 5EMMA 1UC8A 1J97A 2YVAA 1E9FA 3AV3A 1EK6A 1KO4A 3Q8KA 2DHCA 4KFCA 4F37A 2P6PA 3FCCA 1MD9A 4Z2YA 2Q0QA 9MHTA 2IXGA 1D6JA 4DSZA 1QANA 1SKYE 4YRIA 2JGFA 1K9VF 3DNMA 4MR7A 3RT9A 3SC4A 5C32A 4LYEA 3A1NA 5JXWA 1E2QA 3UOGA 3PBKA 1I2BA 2XUIA 4WLUA 5LP1A 2Y6UA 3ED5A 4PSCA 2WVJA 5SV2A 5GIOE 2OVBA 5C2JB 3HO1A 3IKMB 1YJWP 3DBHA 4BV2A 3C39A 5KTPA 4IZ6A 1JSRA 3CCMP 1RBYA 1Z4KA 3PEWA 3GPBA 5F7OA 1ULZA 4XRRA 1RQLA 1WX1A 4INZA 4WGGA 1IXKA 3KYDA 1RC1A 4N6OA 1UMBA 2AFIA 4COKA 2HK8A 2R2GA 4I36A 4TTJA 4GXRA 1E2LA 1SC1A 1FP2A 3Q9SA 1P6UA 5EY5B 1M6NA 5ALJA 4MQFB 1E2JA 4TXHA 3M4JA 3HY6A 1EG2A 3IAM1 4HO1X 4Q3DA 3BB4A 4TROA 3SAJA 3SIPA 5JRZA 2GQ0A 3EYAA 3HPQA 5E3JA 5H9VA 4CLOB 3KZNA 2XF2A 3L04A 1DDOA 2WFZA 4DIKA 3FPCA 5E9JA 1XJWA 1H2HA 1ESEA 2B2XA 2BUCA 4YJKA 2VYFA 4DLXA 1WMAA 1Z28A 4JLNA 3BE5A 3W06A 5C1PA 1ZMOA 4E21A 1FRVA 3QEMB 1YCGA 2G82A 2VJQA 1HFJA 2C2BA 4KSYA 4R9UC 1Z36A 2CLDX 5E7MA 1D9XA 2C58A 3C6BA 2X0JA 3PNSA 2ASVA 3DJFA 2V4MA 5CYFA 2J45A 3TTYA 5JIBA 2CUZA 1GUYA 1C80A 3C4QA 5ALIA 3KWJA 4RHFA 3UKDA 4EFDA 4YR7A 4V02A 1W85A 3OLVA 2I1QA 4BXOA 1YITP 3M6MD 1QUFA 2AJDA 4KQKA 4NJOA 5EJ4A 5J4KA 3O82A 4FR5A 5BT8A 4V0NA 4TXNA 1PWXA 4JA2A 1TRKA 4DLUA 4OJQA 3C6YA 2JHAA 1UT8A 4OQFA 4ZOLF 2FCAA 4LRYA 3SFTA 2ERHA 1FOEB 3PEEA 3Q5EA 3HB0A 4CR8A 5ED4A 3DEFA 1N6OA 4PPYA 4M8NE 5AUPB 5L7TA 4NJEB 2XRMA 4RKRA 1P4GA 4PAGA 2ZJFA 1SOWA 2PO5A 2OV6A 2Y3IA 1ZO8A 5B58T 4RPKA 1CDEA 3PTZA 2VZEA 3VKWA 3QE9Y 3SLGA 3K5PA 1EOQA 1NDHA 2PX8A 4BMZA 1K3TA 1QO0D 1QR2A 3OLXA 4UBKA 4DB2A 1BW9B 2MINA 3QPUA 1IC6A 2KGAA 1W46A 2PZAA 1QWOA 3LYAA 1Q0TA 1NJ1A 2X40A 1FMTA 4YTEA 3VR6H 3ADOA 3UBMA 4IOJA 3K5HA 1L4MA 3KR1A 5DNYB 3RT7A 4YWJA 1N9KA 1JLHA 1UF9A 4O1MA 4YFVA 5FTMA 2V7VA 1KERA 2AN9A 2PQ2A 2O8CB 3TSCA 2H0QA 3OJLA 1HX7A 1WE2A 5FBHA 1IVSA 4MYSA 2PJZA 4P3KA 2PAFA 3KPYA 1QH1A 3LL4A 4X45A 3BJMA 4US2R 4R7GA 3VR2A 1L9XA 4J1TC 4JUBA 3WWCA 5KYXB 1A5AB 3DOFA 2HV9A 2NU7B 2GFIA 2P8SA 3CPHA 4N5NA 2COEA 1CDDA 1EBUA 3FMOB 3PQ5A 1PLLA 2P4QA 4WV3A 2ZAOA 2NLOA 1NT2A 2QKYA 3CWCA 3MJEA 3AUUA 1NOJA 4PR3A 1PGQA 3MT0A 4BC1A 5LLTA 3ECAA 3C74A 4JJ6A 4LYJA 2P2YA 4LZJA 3K5WA 2QB5A 3ABRB 3I45A 1KK1A 1R50A 4ZYXA 3V4VB 2WAXA 3IKJA 3L0IB 1RM3A 1X1BA 4UUNA 3VOTA 1Y3IA 2FRDA 4J2TA 4W5WA 3W3AH 3GLIE 3R8FA 1OFIA 2K6GA 2IDZA 1RLOA 2P3SA 1YQEA 2YUIA 3GOHA 1DXYA 5D5PA 2I2BA 2XUOA 5PNTA 3T1OA 3UZUA 5H02A 4F93B 3OQNA 3OURA 9ATCA 2Q6TA 4QKOA 1R8YA 4HN4B 4L4SA 4CKBB 3U81A 1ONNA 2GCEA 5EMNA 2R1TA 1Z0ZA 4TGLA 2VS1A 1G2IA 4P34A 1KDZA 4CW7A 2FPPA 1AUOA 1GSIA 4PV7A 5C8YA 2DBYA 1BWPA 3CNQS 3QLTA 4EBFA 1J2TA 5A7HA 3LOPA 4EO4A 1BHQ1 1K5HA 4CFZA 4HG2A 1GLNA 1T13A 2XHEA 1GN9A 1IAQA 5ALFA 3IAS1 3FKSD 2ZIFA 2OZLB 4M98A 1B6SA 5LWQA 4AKHA 3GRPA 1TIPA 2H2AA 2I1LA 4FEAA 1M2NA 3SYLA 5CLIA 2I2CA 1V2GA 2H8KA 4HGRA 4Q3NA 3FETA 2YIDA 3LDFA 4H7IA 3PWSA 5B7QA 4F12A 4H2YC 4ACBA 1E2MA 4ZVRA 1ZX1A 3FFTA 4CRWB 2BKLA 3ESRA 3DTVA 3V32A 5F1PA 2AIRA 3UN1A 3BD7A 3O75A 3RHFA 4N0QA 2OV3A 4UOEA 2JFZA 5KX5A 3IJEB 1JFSA 1FYDA 2VF5X 1FW6A 4YXWD 4LOLA 3B9BA 4BLQA 2RFLA 1AMOA 5FWDA 5FI1B 3I56P 5HGMA 2CFTA 2FX3A 3KAJA 2ZVDA 1YC5A 4IDDA 1PFUA 2PWYA 4N8SA 4H2DA 1FDSA 2QZPA 4S1VA 3RSZA 4F6RB 4IOMA 3RUEA 4Z1MD 1IY9A 2Q28A 1LY1A 4ZCLA 3EISA 4RZXA 1WOMA 2B4YA 3JYNA 3O8OB 2ZPTX 1TE2A 3A26A 3BZBA 3L18A 4KYUA 4UTZA 2FF7A 3AW9A 3AT1A 4NZ9A 1P5FA 3RSCA 4CGZA 3U80A 2H2DA 2PZJA 4G0OA 4RVUA 1KDOA 3SC6A 3W2FA 3CR8A 3VYSB 1J21A 3WLOA 3WLKX 1BD3A 1KSFX 2AJCA 3I4FA 4RAOA 3SQMA 3GRRA 2XQFA 2ZB7A 1JIVA 4PS1A 2EEPA 3OF3A 3KJQA 3G6KA 4KMRA 1FLNA 4DEXA 5IC6A 1ATZA 4R7ZA 3G0BA 4LJ8A 2ZTUA 1JHDA 2GRJA 5AJZA 3WWEA 5CLFA 4A7PA 5WRFA 5SY6A 3IP3A 5E1OA 4PZCA 3JYHA 1TK2A 1NN0A 4HNGA 2E1MA 3FCOA 2GSWA 1XU9A 5A7FA 2Q5LA 3KV3O 1NNUA 1A7JA 5F5NA 5I4CA 1NSTA 5JD3A 3ZD9A 5IXJA 1GTMA 5HBGA 3R75A 4C89A 3CZPA 5AW2A 5KUTA 3LRXA 3CZ4A 3GT3A 4K2AA 2X5KO 4ZANA 3I9NA 1T8TA 2SHKA 1PWEA 1WWKA 1ZQ9A 3W3AD 3HKBA 4DGSA 1G8KA 2OGZA 1YAJA 3S3TA 4YONB 2O05A 3BBPA 4OHYA 3AJ9A 1G4HA 3ONEA 1ICIA 5LL6P 4H08A 4YJFB 1R0LA 2P4HX 4KPFC 4A2QA 4UEJA 5D3ZA 1EHCA 1AKWA 1HOTA 3IMCA 4CIBA 2ZYIA 1X74A 2DGDA 5DM2A 5JYDA 4YVFA 2JLZA 1TVEA 5JW6A 1XF1A 2R97A 3PQFA 3R0ZA 5T3UA 1QRSA 4DCOA 1H0KA 2QTGA 3I5AA 3QPBA 3OA2A 5GM2A 3RANA 1SBYA 3U7FB 4MDFA 1HDRA 2OCDA 4QDZA 1U4NA 5JALA 2C2OA 4E07A 4Y6SA 2DQZA 1KP2A 3OZGA 1B00A 2QAJA 3A58B 2Q3DA 4JEMA 2VP6A 1CK4A 1RKBA 4HYEA 2IDKA 5D6OA 3BF8A 5KKAA 1XOIA 2J5XA 3TW8A 3SNHA 2FDCA 2KGEA 1EUCB 3HWSA 1ZYUA 1T5SA 4GWKA 2IEIA 5B1SA 3RVNA 1NLFA 4Q4LA 2BBWA 4FYMA 5AI0A 1J8FA 1U3DA 3BIOA 2QROA 1G3MA 3SZOA 4NK5A 1LNQA 1F8UA 1I6MA 2I62A 2YV3A 3BMCB 3SC2B 4LRWA 5AK5A 3WWDA 4HWTA 4X6LA 1U99A 2KG8A 2JJMA 2MMGA 1V1MB 1IXRC 1G5FA 1UKBA 3L7MA 5ALYA 3SMQA 2R1VA 2ZIVB 3FNRA 3GFRA 4GM4A 1CRPA 4RS3A 1V35A 4KYVA 5ILOA 1GYRA 2K2QA 2OTLP 4YACA 1Z82A 4JQSA 2FZWA 4F7WA 1CVIA 2D62A 3OQBA 4W5JA 4RVDA 4QTUB 1YRAA 4Q4JA 4R2JA 3RYTC 1NBAA 1F2TB 2A5YB 2B8WA 4G2TA 1EXWA 2BZGA 4MB0A 2FW8A 1DKOA 2HDOA 5EKXA 5HOQA 1XK7A 4L75A 1XHEA 4FXOA 1GPJA 5CCBA 5JNWA 2HX1A 3E23A 3DBHB 1HV8A 2IYQA 4DADA 2PM8A 1Z5VA 1IONA 1H1LA 1L4NA 4QNRA 1WLYA 4QQRA 4WW0A 2HT1A 4PBSA 2PZGA 2I1WA 5DX0A 3ZWPA 1VPWA 4PZPA 4GBJA 1LW6E 2BH2A 4MDHA 4HWGA 1T2NA 1JSZA 4PBRA 4HLQB 3K70D 3U7JA 4IIEA 4BB5A 2MTBA 4DJAA 2E87A 1QGZA 3GFPA 4D4IA 5CT5A 2YOFA 3VZSA 1EUDA 3ISTA 4QRIA 1YU9A 4TS1A 2GASA 4MW1A 3GRAA 1CNMA 5K8TA 1THZA 1NVTA 1W52X 4JLJA 3I01A 4AC9A 2DPYA 3GWGA 3I8XA 3M1YA 1ILEA 2EG5A 1NN5A 3KXLA 3DT8A 4IS3A 1VM6A 2PGNA 4Q21A 1C0KA 5KQMA 4HBZA 1B0ZA 2B1GA 2OBNA 4N5MA 3TTWA 1ZN2A 2JI4A 2JIDA 4FHGA 4FZJA 4A3SA 1ACPA 2Z6UA 3FCEA 1OTXA 3AP2A 3R40A 4RQAA 1GD1O 1NX9A 1KY5A 2R6CA 3TSWA 5DOVA 4LDJA 4BNUA 2I9PA 1HF3A 3OQIA 1N2ZA 4LHXA 4QUKA 3TGWA 4QDUA 3ZIDA 4CN8A 2FY8A 4ISCA 1X13A 2VQ6A 3OE5A 4RQUA 2REOA 3AFMA 3H05A 3LBAA 1T6BY 4MWDA 4QFBA 1SXJA 1N36B 5KHOC 5CIWA 4WADA 2AC7A 3BORA 4P86A 3WLFA 5JAUA 3RUIA 4ZVUA 2Y1DA 4UHPB 1DMRA 3U3ZA 1NJ2A 2VP3A 2W5UA 3C8ZA 1PJAA 2YWHA 5A4MS 1W94A 5BUSA 2DUNA 5ARCA 3EIOA 4JELA 5JU6A 1ZINA 3KV1A 4HDKA 1Z6AA 1OLXA 3G9XA 4NYMQ 5EQDA 3RIGA 2WZQA 3CMAP 2GEFA 1GDDA 5B2ZA 3JWIA 1YUNA 2J48A 5HZHA 1VRCA 2XTJA 3FPSA 1R8XA 2PMFA 1JPJA 2ZKLA 1A9PA 3KOZA 3OPXA 1Q0LA 3GXOA 3IP1A 3UKOA 5E7IA 2WFLA 4BJ5A 3TXXA 2QLJA 1UK6A 4P4LA 3HWRA 1J4AA 4RVSA 4GMHA 4P92A 1QQ6A 3ZBTA 1BE0A 2WTEA 4QVIA 1VQMP 1SC6A 1UODA 4NU8X 4B4KA 2FEOA 4HRAA 1XBTA 1VG9B 3TJMA 5J63A 1N8NA 3E5RA 2HUNA 3E61A 3FY4A 4U9HS 1RACA 1CIJA 1VQ9P 2V74B 3B1XA 3LCCA 4LGMA 1I2ZA 3VX3A 2GZIA 4O4HB 1BMDA 1SC9A 4U2EA 5TGZA 3GGPA 1OXBB 4LRQA 1Y5NA 2XGGA 2R6DA 1KSJA 1XELA 1XF9A 5BN1A 3TZQA 1QKKA 4GQIA 1DT3A 2H00A 2O2IA 2VHWA 1QNFA 4MP3A 1M34E 3CXRA 3MTDA 3UH0A 2PJDA 2X7XA 1Y81A 3VYUB 2IXDA 2YWRA 4AU1A 3KYCA 2YIVX 4ENQA 3HA3A 4AROA 2CT8A 1SB8A 1H8ED 2EBWA 1JFVA 1QIIA 2YBEA 3RWMB 4R2HA 3FKJA 3Q1KA 5LKAA 1TZBA 4NYJQ 1FP4A 4OLFA 3IEMA 3EXIA 3BN3A 2ZSDA 3HXKA 4A16A 5A5GA 1CY6A 4BRUA 2BGJA 4CV1A 3T3EA 3QMMA 2PCJA 4HAXA 3ZCRA 2FZLA 1G2OA 4D5GA 3LRPA 1VRVA 2EQAA 2YJ4A 5HJ5A 2R4TA 4UUOA 1PJCA 1ZMTA 2EZ8A 1RJGA 3EJEA 5B2EA 4IVPA 3NC0C 2XADA 2KI5A 5LB4A 2HIGA 2KMLA 2B7CA 2QTFA 4LCEA 4UREA 3WGLA 5K0GA 3V33A 5C8YB 1AURA 1DAEA 3C8HA 3UMBA 2V6BA 4QOIA 3U3DA 2OT3B 3L77A 1NPYA 2V7QD 3HJBA 4HNAA 3O8QA 1GPUA 3IUEA 3QLVC 2IP4A 2ZWVA 2I33A 4ARZA 3F8SA 4GOOD 3RIMA 2HCTA 2RGEA 1M1KQ 2MSKA 4N4AA 4RY9A 5FNVF 1QZUA 2PDAA 5A2QA 1L1FA 3IPAA 5KNBA 5I7FA 3TPCA 2YYSA 3L0DA 2NVUA 4ZGGA 3D3WA 4HH4A 4B3BA 2QG9A 5A3VA 3SQDA 1G64A 1W0KA 3LPDA 1S6YA 4R2WA 4QJIA 3WC4A 2CXHA 4TXJA 1SNYA 1VB3A 1Y6QA 1F17A 1GAJA 1U0JA 4KRGA 3L46A 1EA5A 2NUAB 3ZBPA 5KX5B 4YMSA 1ZICA 2VNJA 3EJ6A 3FZEA 4A15A 1OH5A 2RGDA 4INJA 1KSHA 4FFDA 1SXGA 1E58A 2Q5IA 3PDCA 5EJ5A 3I6YA 2YS6A 5U4XA 5KQGA 3X2EA 1OKKA 4X63A 1FXUA 4KYIB 5FA6A 4BEWA 4R1UA 1H3EA 2WA1A 4C6SA 2X0RA 4G37A 4D4JA 1ISHA 3LA8A 3P1JA 3BFKA 4HDMB 1VL0A 2UZ3A 4DAOA 3DC7A 3K8YA 4EMUA 2QLFA 3L0SA 2QM0A 3F47A 2ZFUA 2B82A 2I76A 2W6PA 1ECGA 5L3ZA 3UB2A 5JDCC 4P7FA 1DQYA 3GLHA 4PYNA 2J85A 1C8LA 2P3LA 3G17A 4BZQA 1NC1A 3K9WA 3N87A 2QLLA 4B74A 4HBGA 3D6UA 4B6JA 2CYAA 2H9YA 3KE8A 4L0QA 1F9AA 5E6SB 4BFTA 4DJEC 1KY2A 1TMGE 2QD5A 2XXJA 3EUFA 3PZBA 4TYQA 1SUSA 2NZWA 2ZI6A 3RLFA 5EESA 1NUTA 2YL2A 3A6GA 4LZWA 3QGMA 4IH4A 4ZGBA 3SOZA 2A9OA 1TYZA 3WYBA 4RCZA 8ATCA 1AA9A 1P9RA 1PU2A 3NHJA 4KTTE 4MRPA 4DV3B 1VI5A 1Q0SA 2BE7A 1FFAA 1L1QA 1YXMA 1FDTA 1TU3A 1JTEA 3FWZA 1ZA1A 3G26A 2PBZA 1E1QA 3DEKA 4HWPA 3VHRA 3FYSA 3R3ZA 1EDEA 1RXIA 3AM1A 2QGZA 4W5RA 1I3CA 3KXKA 2N5HA 2IYAA 3HKBB 5CVDA 1N4AA 4FYYA 2NSYA 4GYYA 3W6UA 3UC9A 3CUWA 2EC5A 3PXCX 1NA5A 4R1PA 1YZVA 3ZW9A 3MSCA 1RI5A 4B6PA 2IIVA 3AHDA 2PX0A 3I42A 1SU7A 3LQYA 1N2XA 4PXAA 1EK0A 5DX8A 5DYNA 4AJ4A 2FADA 5GPBA 2FEXA 4A0HA 2AV6A 1PTJA 2I22A 1JHQA 1NTRA 1BDMA 3OMWA 4GSYA 4M9UA 4ZP1A 2BR4A 4YREA 5KVQA 2XV1A 3EVFA 1IRXA 5E7JA 1UK8A 2E0IA 3FRJA 2D8AA 4HDQB 2AWOA 3CCBA 3TZLA 5C5IA 5IYZA 1L1RA 3R7FA 4RKYA 3MAJA 5BPFA 1COWA 3WISA 4AG6A 4D43A 4L27A 3N8DA 1SIUA 3P4YA 3RVQA 1SUBA 1Z0FA 5EP4A 3TL3A 2OESA 3FMPB 1L5LA 4X44A 3TW8B 3N5CA 1GZ5A 5JJKA 4B75A 1HTTA 3KHKA 4HQKA 4GPEA 3E9MA 2I0FA 3FOCA 4PLCA 2E49A 1HYGA 1N6RA 5DGXA 1DMSA 2MCFA 4WI1A 1KZ1A 3QVVA 3H18A 4P5DA 2NU9A 4IYRA 2I6UA 3ZDFA 5KJ1A 2J5QA 4P5PA 5HGJA 1EDBA 3CVJA 4IHQA 3EN0A 4L0CA 4I1IA 5FF9A 4JYMA 1UKEA 3PEVA 4GPBA 2FWPA 4HDOB 5HG0A 3O4IA 1VYUA 4B2IA 1JR3D 3PXXA 5H83A 4O2AB 2LP4Y 4M6WA 5AW0A 1L7RA 2HF2A 1YS6A 3E8MA 4YT4A 1D4ZA 4ZI7A 3CRRA 5FLXA 3K0CC 2OQ2A 3W8FA 5CB6A 3EXHC 5IAKA 2V1UA 4WLOA 4G0VA 3DZFA 3PIIA 2KWLA 2YXLA 1TD9A 2O4CA 1F5SA 1Q0UA 1JSCA 1JHUA 3A4TA 1N0HA 1E9BA 3GEHA 2OG1A 1C4KA 2HQOA 3DL4A 4PG7A 4YJ3F 5K3FB 4WXHA 2H4JA 3D2BA 2VEOA 2AXEA 4HDNB 2CVQA 1JJFA 2WSSA 3DW3X 1TA4A 1Y3AA 3S4YA 4BNHA 1NKSA 1WUHS 3WMWA 4FYIA 3TNYA 4CF6A 2ZYSA 1L7OA 2Y6VA 1X1CA 3A14A 4D98A 4E4YA 2C7BA 4KCGA 4UDOA 4EGJA 3KPUA 4HNVA 5M34A 4YH1A 1E3EA 3I6IA 3LBFA 4MW6A 4R01A 1GGMA 1EUDB 2VRWA 1XQ1A 4RSGA 1FFCA 1EK1A 2IC5A 3C7CB 3LJKA 1ZAYA 1H2RS 4LRSB 4C4TA 4G81A 3CH5A 1ORIA 4P3NA 1C50A 5BVGA 2B30A 3GR6A 3P05A 1P2SA 2I67A 3DV0A 2G28A 3NHSA 4LXTA 3RIYA 4XD7A 3SX2A 2IP1A 2EHSA 3ENWA 4QYXA 1F38A 4O8ZA 4XROA 5KSPA 5CD1A 4I6JA 3LT2A 3BFXA 2ZBFA 2NSDA 3IV9A 2ZSIA 3GK3A 2YDYA 3TR5A 1M6HA 5CLGA 1BEEA 1HOXA 5FUVA 3IQZA 3KKOA 2X2OA 2X6TA 2V5AA 1UPUA 2AG1A 3AETA 1OAKA 3AB7A 5BNFA 3ANTA 2BTOA 4NYIQ 4RHYA 1PW5A 1NPDA 1VCOA 2C99A 2R11A 1A4XA 1U7XA 1YCFA 3U44A 4YALA 4ARIA 4KNWA 4I9UA 1CULC 4GKBA 1QTRA 3B5IA 1NULA 4MZDA 5A5DA 4FQ5A 1JG7A 2WQ7A 3AM4A 2DLCX 1GKIA 2H08A 1DX9A 3JSXA 3LW8A 3N76A 4G8DA 4RXTA 4NYMR 1HORA 3G1WA 4MS3B 1CUAA 4PZZA 2X19A 4EI2A 1GZSA 3BL8A 3BMNB 4F8YA 3MELA 3VH3A 3H8JA 4IJMA 3FPAA 3L1UA 1M1NA 1OLXB 1XK6A 2QZJA 5K51A 4AW9A 4EPWA 2JK1A 3QVGA 3INNA 1HLDA 3E2IA 1QHFA 2HHAA 3TNJA 2Q6OA