2FQ1A

Crystal structure of the two-domain non-ribosomal peptide synthetase entb containing isochorismate lyase and aryl-carrier protein domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
KLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isochorismatase
publication title Structure of the EntB multidomain nonribosomal peptide synthetase and functional analysis of its interaction with the EntE adenylation domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq1A02
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2fq1A01
1T8KA 1NF9A 2GDWA 2LIWA 2XZ1C 1DV5A 2N98A 1HY8A 2AF8A 2MF4A 4PXHB 1IM5A 2K2QA 2CGQA 2L4BA 2FADA 2N5HA 2KORA 4CA3A 2KGCA 1KLPA 2B34A 3PL1A 3EJEA 3HU5A 3R2JA 3LMOA 5EJDA 2L22A 3S2SA 1VKUA 2H0RA 2KGDA 2FQ0A 1OR5A 2N6YA 4WH0A 2K92A 2WT9A 2GDXA 3UAOA 3MCWA 1AF8A 4H2XC 2LOLA 3O92A 2KG6A 4BPGA 2JU2A 4H2WC 4NEOA 1XN4A 4DG9A 4H17A 2FVEA 2N6ZA 3EJBA 5HVCA 5KP6B 3OT4A 2LIUA 4L07A 2KR5A 2FVAA 2LMLA 4BPHA 2LKIA 3IRVA 2PNGA 2N50A 3TB4A 2DNWA 4WGFA 3CE7A 1NF8A 1YZVA 3EJDA 2FQ2A 3O94A 2EHSA 2JGPA 2FQ1A 2KOQA 1F80D 3HB7A 4IZ6A 2GDYA 5KP7B 2EHTA 2KOOA 2X2BA 1ACPA 1L0IA 3GZMA 4L08A 1X3OA 5HV8A 2L9FA 3O90A 3V8EA 3RG2A 2FAEA 2L0QA 4BPFA 2K93A 2AVAA 2MD9A 1NQ4A 2KW2A 2AFDA 3R77A 2LPKA 2CG5B 2MVVA 2JU1A 2MR8A 2CNRA 3TXYA 4R0MA 3GZLA 2FACA 2WTAA 2KOSA 3KL2A 2K94A 3LQYA 2FHSC 2N5IA 5CZDB 2LTEA 1J2RA 2ROQA 2K0YA 2MR7A 2KWLA 2VSQA 2JQ4A 2M5RA 2AFEA 3O91A 4PWVB 4H2YC 2FVFA 1NBAA 2MY5A 1YACA 2QNWA 1ILWA 3EEFA 2LL8A 4HKGA 2KGAA 2KGEA 4MRTC 2CQ8A 1DNYA 1HQBA 1X9GA 2KG9A 3OQPA 2KOPA 3O93A 5KP8B 1L0HA 2MVUA 3NY7B 3TG2A 2XZ0D 2K0XA 2A67A 2KG8A
chains in the Genus database with same CATH superfamily
2AF3C 3R09A 1QOZA 4MO2A 3YASA 1CSEE 1I7DA 2BZGA 4LE0A 4MX8A 1FXUA 4GMHA 3LLSA 2QTWB 4ZV9A 1Y48E 2OXEA 3PBKA 4ZJYA 1CPYA 1QQ7A 3WQBA 2R1VA 5FAKA 1IM2A 3FDXA 4F9FA 2DR3A 4RHYA 5C1BA 3GCGA 1C3JA 3ADKA 4GGMX 3KVNA 2DT8A 3NFRA 3RPEA 5KI6A 1SBHA 2JGJA 1W5SA 1J22A 2N75A 3TIGA 7GPBA 1E1RD 1MQSA 1UC9A 1ZOSA 4Y8VA 4D9BA 1DRWA 3DM5A 3O1JC 4L50A 2PY8A 1IUPA 4WH0A 1O03A 2A57A 4QYSA 2WQZA 5ANRB 2FWBA 1L8LA 2EGHA 3Q3EA 4XFYA 5BSFA 1YR7A 5DHTA 4DMUB 4K81B 1INLA 3HXTA 1IMQA 2NAPA 1HDYA 1QCYA 2FW1A 3OHPA 4MRRA 3T7RA 1HE4A 1I13A 5FOXA 4A0FA 5KJCA 5L53A 1NX9A 4WDQA 1KS2A 2Y1LA 2Y4OA 4I5FA 1MGPA 2Y9PB 3KUKA 5H70A 2MMCA 3KOMA 4A3SA 5AMXA 3CLUC 5AOVA 4D4LA 5CITA 1DGQA 1AZSC 3OJEA 4OB8A 3FIUA 1U0SY 1K4KA 2VNSA 3GMDA 3NTQA 3ICPA 2PV7A 1O4VA 4QBIA 3FE2A 1T34A 5CFQA 1RI5A 5ADHA 1S3IA 3N8IA 3MWEA 4PEVA 3SIRA 1LDBA 1UWCA 2DFLA 3FZEA 3OQ1A 3VPAA 4ARCA 4FYIA 3E58A 3KT6A 1RJEA 1Z47A 2AFIB 1D4AA 2PXXA 4YJ3A 4ZDWA 3ZCVA 5K7SA 5HFNA 3PU6A 4QG3A 4FHDA 1ZIXA 2BE9A 2ZI9A 4BLRA 2HYIC 1V8FA 4MRPA 2RARA 2VP4A 3EXEA 2MWMA 4TTJA 2HJVA 1H5UA 4V1CI 3W5AA 2OAGA 4RL6A 1P80A 3WHLA 5K0EA 1N0IA 4K40A 1L8QA 2OCPA 2YFYA 3I9V1 2D1RA 2XUZA 3NOOA 4Y6SA 3GCXA 4ZRMA 1L5HA 1BVHA 1GKLA 1JQEA 2PKWA 4N5MA 4K3UA 5B3JC 1K7SN 3RS9A 3RRYA 1ZU5A 3NC1C 4JB2A 3ZHTA 5I8PA 5JNVA 4M7PA 4MQFB 1NKVA 1T13A 2Z8XA 5FKJA 3HJRA 3IXMA 2BY4A 3L46A 4MPJA 4OYRA 3TIXB 2ASVA 1T25A 2BGNA 3TTYA 3BWEA 2QN6A 1R66A 1D4OA 2C5AA 1MOSA 4W5WA 4NE2A 3ZLBA 3IB3A 4O4HB 2JG3A 1M6VB 1MP0A 4PIVA 4ZJPA 4O2LA 1SQSA 3MYYA 5A1JA 5BWMA 1XMXA 3I52A 4P38A 4RGYA 1EFVB 3V1UA 1K8ZB 2I7XA 3D1LA 3HFGA 2EKZA 2A3RA 2VSQA 2II6A 2UZ1A 3NH9A 3V42A 4IQ4A 1FA9A 3TNJA 1I0IA 3LL4A 2WF6A 2G9UA 4U7JA 3HMQA 5EW5E 4ZOBA 4M8LA 2OQ2A 4KMOA 1HKHA 3P27A 1AGRA 4FDMA 1VKRA 1YS2X 2ZS9A 4LK3A 1MV5A 4TLEA 3ECSA 4HHEA 1BG6A 2GS9A 3GOHA 5K6AC 3HM9A 2WE7A 3AYZB 1VHDA 4NU8X 1IJFA 4WBXC 4DLLA 2JLWA 2LWIA 3V46A 1WW2A 1MU0A 3CSDA 3UWSA 2P40A 3IUMA 1LI5A 4AO8A 3ZVRA 2DFVA 2IVFA 3IV6A 4RVHA 4IXWA 1WR8A 2Q62A 5JAZA 4Z53A 2HMSA 1KETA 1TJ3A 2PBRA 2IU4A 1FLVA 2X6TA 3EB9A 2V9CA 4TRRA 4UEWA 4KR2A 1ZOPA 2W2MA 4CYMA 2IPOA 3E18A 4XLZA 4RE6A 2IWRA 1GDTA 2NMVA 3DKRA 3CC7P 1UZAA 2CLIB 2FN8A 3OZEA 4YREA 1LC0A 2B4QA 1EE1A 3FCSB 3N2LA 5BV2P 3A9CA 2O2IA 3E8MA 2XRMA 3AUYA 4RK4A 1P7ZA 4XDYA 2ZJ2A 3TTTA 5EHNA 1DMSA 1TT7A 5DOVA 4FNMA 5D1HA 2X77A 3M1AA 3CF6R 1UM9B 1AQUA 4YDSA 4AUEA 3QFTA 3QP9A 5HUJA 1RAAA 1E2FA 1Z6AA 5K6RA 4MP3A 1ZJWA 2R85A 1XA0A 3GO4A 1UINA 1ZIDA 3NPAA 2HLHA 2J9FB 2JYGA 3M2PA 3MJEA 3QIAA 4A82A 2P6PA 3JQAD 2OO5A 2RSLA 4N3GA 5CCEA 1M7HA 3IILA 1C4WA 5HJEA 4QTYA 2VBIA 1JDSA 3G1IA 3QKRB 2EZ8A 3M34A 5CA1A 5JD3A 1CULC 2FE4A 3NHYA 4ZAZA 1KI6A 3K96A 4E21A 5BW4A 2JLYA 3G8CA 2HFJA 4TL6A 1O3YA 3JPYA 3DDNA 5DCKA 2XZTA 5EKSA 5LQDA 4PYRA 2B4YA 3FR7A 2H1LA 1E2LA 5K0TA 3SC2B 4DUPA 4MUGA 2H4WA 4XPZA 1M1YE 4HFNA 4UVGA 1KNQA 5BVGA 5J47A 2AN3A 5LJIA 2WE8A 4OYLA 2ZQZA 1G8SA 1ZD8A 3DZ8A 1VKJA 1V1MA 4HBGA 2AMVA 3VYUB 3PF9A 5JYEA 9LDTA 2ZRJA 3TL3A 1H4QA 2FSVC 4IRUB 2W8ZA 2PS1A 2ZWVA 5AXDA 4NAVA 4G5FA 4DXAA 2A35A 4GYWA 2GZ3A 2C7QA 5HV8A 1EPUA 3H5LA 4HEA6 5ESDA 1L4NA 3TGLA 3BS4A 3LF2A 2AL7A 1ZC3A 1WUKS 2YZKA 1YMUA 2OAQ1 4C1BA 3V2UA 5GZ1A 3BQNB 1WUHS 3SYRA 2R1VB 4NONA 1AKEA 2CMFA 1UZLA 5JAIA 4LMAA 4RTMA 1TYDE 1G6Q1 4ACAA 1RWVA 1AKRA 1R16A 4TMKA 3TZKA 5F3WB 4U5XA 4D9IA 2XAUA 3O4RA 3S81A 4FFPA 4I5GA 5A02A 1WF3A 2VJCA 2WSYB 2WTEA 3BSSA 3W1WA 1Q3TA 1YDHA 5KWVA 1OC2A 5JTTA 2N46A 3NGXA 3RTGA 3ZHUA 3RVOA 1E0SA 3BYZA 1BVYF 3PRHA 4JT9A 4NLLA 2QX4A 1FW8A 3MA0A 4HAWA 1M1XB 4KJXA 4QDZA 4AU1A 1JS1X 4GR5A 4JLVA 2FI1A 4LRYA 2VUHB 1K9SA 2JQ4A 1X2BA 3E23A 3ELDA 4CLDA 4RD3A 2WHYA 4UD2A 1ADBA 2GT1A 3L07A 4HFMA 3S28A 1EFCA 1H94A 4DA7A 4KMRA 1VJDA 2CB0A 4U4AA 3PXGA 1J0EA 4CIDA 2QMHA 4BMDA 4Y6OA 1DJQA 2PU7A 1J0BA 3M9XA 2LF4A 4JJKA 5LQRA 2YV3A 3L92A 1WZEA 5EXSA 2OR3A 3DEAA 3WBFA 4AROA 4TYWA 1M74A 3GRCA 4B2YA 2OENG 4DSUA 1WZNA 2PL3A 4XGQA 1I4TD 2I2FA 1SGWA 1ODSA 1SB8A 4Q9AA 3OKFA 4W7IA 2HWXA 3MWEB 4N5DA 2W6JD 4LJ8A 2HK6A 5HKOA 3R20A 2B0CA 2JZOA 4YJ3B 5EFOA 3SX0A 1N5MA 2YWCA 1F2VA 2QP3A 3GL9A 5EVCA 1ZVQA 3ZIDA 2ZJAA 1OJLA 3EXEB 3I1FA 1GSHA 1QVAA 5FTNA 2JAOA 5JD6A 2ZUDA 3LBNA 3E2MA 3UT0A 1FR2A 4JJAA 1W87A 1XFAA 2C9YA 1L5HB 1P8AA 1REQA 2DYKA 2EEPA 4RDHA 3ULKA 3ZR4B 4QXRA 1BOFA 3DAHA 4NBLA 1ZD9A 3WKAA 3BBLA 3OBIA 4XTRA 3W7VA 1WHTA 3C3PA 1DXHA 3EWSA 1GYQA 1ND6A 1NN0A 4JJZA 3HR7A 2QTVA 5EOVA 1HSZA 2FZGA 1R8XA 1XIVA 1T8SA 1URPA 1SUWA 4BBJA 2ZJZA 3JWIA 3AEXA 2CK3D 4JSYA 4JVMA 5EMKA 5IUKC 5ICEA 5K03A 3CLUD 3VNUA 4O4JF 3FSGA 1E79D 4Z49A 1DIBA 3K09C 1JR6A 3OUUA 1Z45A 4WN9A 5SZHB 2QG6A 4JFAA 2FYTA 5J4VA 2I65A 3ID6C 5DW3A 2DUNA 1TC2A 2EYUA 2BMJA 3NJ8A 3VDXA 3AUAA 4Z4IA 1K66A 2GJKA 2X9LA 1I4EB 1XROA 3DOEA 2XHZA 3E27A 3JQRA 3SJCA 4BRUA 6AT1A 4N3BA 4JUBA 4FLFA 3JCZA 3MLAA 4ALKA 5ES4B 1DWPA 1R4MB 1ZKMA 2EJTA 2WD8A 3H2BA 4D9GA 3S2GA 5DLDA 1QE0A 4MP6A 3K71B 3C3EA 2V0NA 3NTUA 2X15A 3WO1A 2X4IA 3G7UA 2VR1A 3HB7A 3EZYA 4IDDA 4UAJA 1C9DB 2J8ZA 1TKBA 3P5BA 1ZX1A 4EUKA 3B7PA 1GCAA 2FUG6 2HA7A 2R4TA 4K9NA 5M04A 4CN9A 1HFEL 3A6PC 2WJAA 1JU4A 2P9ZA 4IXMA 4ZAYA 5U4QA 2X0DA 3Q10A 3QLUC 2GSWA 4HZGA 2NU8A 2GRUA 3CS3A 2XBMA 4WBSA 4PF1A 5E6SA 3CW9A 2JI6A 3EC7A 3NHSA 1IN8A 4LSWA 4E1AA 2PJUA 3AI3A 1UFKA 2R7NA 2CZGA 3CZRA 5C4GB 3GDHA 4EY7A 3ZD9A 4P2BA 1VSUA 5EMNA 4Z0PA 4WRRA 2Q5IA 4LJ4A 4E11A 2NUBA 4V3CA 1Y3CE 1DQPA 4AT1A 3A2NA 4Q0MA 1CB0A 2BBOA 2QA4P 3ZY6A 4BRWA 1WPXA 3GNLA 4LWZA 4NCBA 2ZBFA 3OCVA 4KLRA 1M73E 1UEIA 4WA8A 2W42A 2GXAA 3FTCA 1G41A 3ILYA 1Q0RA 3IIMA 3EEYA 2ZRKA 3GARA 4KMMA 2JJQA 2QQGA 4H6WA 4DIKA 5DYYA 2F55A 3PIIA 4QQ8A 3H5TA 2QVLA 1FFWA 1QGDA 4TM7A 4UUPA 4CI0B 4AJ9A 1E7RA 1TKCA 4LY3A 2BFFA 2WNHA 1YA6A 1F2UB 2B5VA 2PUDA 5G3ZA 3D8TA 3WICA 3MTQA 2PWZA 4RVOA 4D56A 3PHCA 3U0BA 2FWIA 3RBZA 5CA1B 3AVQA 3B2QA 1KI6B 2I66A 2QT9A 3DD1A 3EHEA 3MUEA 4S1WA 2XCLA 5HGNA 4QODA 4UNIA 5JCJA 4ZZ1A 2I29A 2F4VB 5IWAB 1PGJA 1H0RA 1NKSA 3O31A 5T4HA 5BV1A 3QJGA 3WJAA 3HP4A 1BVUA 3ZNNA 3R74A 3PKZA 4F93B 5I4BA 4RKQA 3TEMA 1QQ5A 5BVGB 1SXJB 4RK6A 4Z4GA 3JATA 2GKOA 1T8RA 1V1MB 2DPXA 4XOIA 4AN0A 2ISQA 1Z35A 4EATA 1FDVA 3FZYA 3NRCA 2W6ID 4B7ZA 3PQ4A 3MJFA 4NFYA 5K6AA 4PGAA 5F64A 1RW4A 3F5SA 5AOBA 5AD1A 2C94A 4KR6A 2OCYC 3GLQA 1ETHA 1P2DA 5EJ8A 2JH8A 3GT4A 4I4TF 3CLRC 1B93A 3VKVA 1IDN1 1X7ZA 5CH8A 2JGEA 4X1KA 2WT9A 3KAQA 4TSFD 4BLSA 3IIKA 2YCBA 2Z43A 1YZ3A 2WZBA 3BRWA 1DEKA 4PC2A 4BVLA 1AURA 4AECA 2N1MA 2H59A 1B23P 1G18A 2SNIE 2HIAA 2I9KA 2HMVA 3F6RA 3PRJA 4QO7A 2VDOB 3VDQA 2MU1A 4MRNA 2GJ9A 4G0MA 4TS4A 2Q5QA 4DWJA 4EF5A 3RHTA 5I5EA 1UAAA 1I2DA 2NQTA 1HLGA 5JHGB 5LU9A 4MIEA 4JB3A 4YRDA 2J3HA 3SQNA 1U5BA 2PMFA 1RMYA 2LW7A 3OF2A 4H7KA 4PCUA 1SKAA 2BMAA 1C14A 5KSWB 5F5LA 3O94A 5A3RA 4PO1A 2AI1A 2IEYA 5FXMA 3MTDA 1UBFA 2VKTA 4MVJA 3REFA 1K5GA 1FMTA 1XMSA 3OD1A 4YH1A 3ELUA 1K6MA 5DYTA 1V7ZA 3WTBA 2VP6A 2F3PA 4MUJA 4ZQGA 3TPFA 1WBJB 4CL0A 1DVRA 3ZEAA 4QUGA 3C6ZA 1IZZA 1MV8A 4TMVA 1GXGA 3TD9A 2ECPA 2FAEA 3DBVO 3DZBA 3EJWA 3H2JA 1FUUA 3KUUA 1GNRA 4LGMA 1Z5PA 3C4JA 2MCFA 2YL2A 3UXMA 4DJ5X 4LXGA 1PL7A 2XV1A 3G88A 3S5UA 4CT4B 1NR5A 3K8OE 5GPBA 4IWNA 4JI6B 2WJGA 4C7VA 1REQB 5GIOE 2VDMB 4KO8A 5I3CA 2BGTA 3U7GA 1T5BA 2FMKA 2GYUA 3P2EA 4YBZA 1WHTB 1JA9A 1J9GA 3A6ZA 4XE5A 4BNXA 2CHVA 2VF8A 2QTVB 4GLOA 1KKMA 4WKBA 3TDMA 2P7IA 5CHYA 3KQUA 1K6EA 1SKBA 2FW8A 2C00A 3AF3A 3ZI4A 5C0OE 1RAEA 3MT7A 2G83A 3OZFA 3N0WA 2NV2B 1YI0A 1TQ8A 2BP7A 3R0ZA 3JY6A 2DFPA 4U3JB 3MEQA 4XUCA 5AHWA 3I8OA 1ZEJA 1BOOA 4ABYA 1F8XA 1IG3A 2UZAA 4WN9B 4PLFA 1BHQ1 1TM2A 4GOMD 2GEFA 2YHIA 5IAKA 5JZOA 3E3NA 2I6UA 1CUGA 1K06A 1UPXA 1QYRA 1TK2A 1TCCA 3L0ZA 2I9PA 1C9MA 2XNKA 3QVUA 3FMPB 4J0CA 3ZZMA 1BWSA 3K15A 2JVJA 4BNUA 5DSTA 1Q0ZA 1NLFA 1EUYA 4H6PA 2J9YB 2ZJYA 4B33A 5K8JB 3PQ8A 5B1DA 3CX6A 1RPAA 3AR7A 3RUDA 3WV5A 1I2CA 3BK2A 1JI0A 1N1MA 2RGCA 1WDMA 1UIRA 2AQHA 2CYAA 3AFIA 3AG5A 4IDQA 4RD6A 4U5QA 3BL5A 2DOKA 4R81A 1I0LA 3IKTA 3JQ8A 1QIJA 2P2CA 4EPXA 1EK6A 5L8VA 1PQYA 2FN3A 3WGHA 4F46A 1HYQA 3RVLA 3AFMA 3JQGA 2AXQA 4HMOA 1EUCA 4HWOA 4M1OA 4YAFA 1ZVVA 3RWBA 2JGDA 3DDHA 1G3UA 1K75A 2W71A 2FSPA 4EG4A 1N2CE 4G0ZA 5EPUA 1ZICA 2IUFA 3LGSA 4U0JA 1JAZA 1Y6QA 1YJXA 1NPTO 3VA7A 3KLMX 4OU5A 1IWOA 3L4BC 4MHSA 4BNYA 4QRIA 5B58T 3AR3A 3ZXYA 2XT6A 2O6LA 1XA4A 6YASA 1YQEA 2A7QA 5KSYA 1CUJA 2DBQA 3NCTA 4FDTA 3EIUA 4JASB 2WMDA 5KZMB 3ITEA 3UTDA 3ZWWA 1C7QA 1CR4A 2RIRA 1GL9B 3UW3A 4B87A 4IUBS 1VKOA 2UXBB 3N6XA 2CHQA 4NNPA 3F46A 1RZRD 2FEAA 4RYDA 5KYYA 1IVYA 3EJBA 1GU1A 2DUJA 2CL6X 2G08A 2G80A 1W75A 3PX2A 3SBDA 4C2UA 3ZVKA 1FU4A 2FSSA 2P9XA 1Z37A 1DTEA 2B21A 2BFFB 1JDPA 2H3EA 2ZXEA 3HJBA 3NKLA 5ALDA 3IT3A 5HW0A 1C3OB 1JLKA 4Y6PA 1U2DC 5LB2A 3FBTA 3H1AA 1Q3KA 1WP9A 1ZD2P 5AI0A 2QUHA 1DZIA 4DNOA 5IJ9A 1FXWA 1ZIPA 2JFQA 5KAPA 1ZKDA 4RSMA 4KTTE 4F71A 1BKSB 3EZ9A 4H1VA 2FE1A 2FW6A 3ZGVA 1TYZA 1LZKA 3GX1A 2YMLA 4M1SA 3RM3A 2PKRA 3OFNA 1XZAA 3SAJA 3G0CA 3DAGA 1T9DA 2WZCA 2Z8YA 1C7RA 5I5GA 4DGSA 4MCJA 1ZSVA 5G0SA 4MA5A 2GYVA 4B5KA 4LN1A 1OXTA 1VLJA 2OGTA 5ICCA 1B2RA 4JH0A 5B7QA 4KPGA 3LI2A 2D5LA 4WD3A 2DR2A 4M86A 3IP6A 4IDCA 4GSYA 5BW8A 2JCGA 3LPMA 3OQIA 5ALXA 3T7IA 1Y1PA 1P39A 1YNOA 3ZBQA 5JS8A 1BTOA 4PYJA 1BIFA 2IPMA 1EDDA 4AULA 3CO5A 4PZLA 3GJ4A 2XWSA 2XYGA 4JT2A 4AJLA 1PJAA 3M5PA 4WWHA 4NOKA 5C4IA 4BUJA 1NKTA 4AZ0A 1ECJA 1THGA 4FKMA 4O08A 3RREA 2ZXUA 1X7ZB 3NORA 2QMQA 1PD1A 4X1KB 1L5OA 4FJ0A 2ONKA 3S1AA 4ARAA 4EI9A 3OIDA 1SCJA 4W9RA 2VOEA 3QUAA 3NBUA 5FUQA 4DADA 4XWYA 3SBOA 4HEQA 3TK1A 2NACA 1JHVA 2QVXX 3LUHA 5JBNA 4DV1B 1EWKA 1PNOA 2CCKA 2DY1A 4JKYA 4B3DA 1TYBE 2ZBQA 5AM4A 5JATA 2Q2VA 1K8QA 2PKCA 3KOYA 4EKNB 5SYNA 2ZRNA 1M90Q 3FI0A 2I3DA 4UW9A 3GDWA 3IO5A 3K3PA 4MWOA 5ER6A 3W8DA 2NP7A 3MCTA 2NU9A 2JIOA 4J3JA 3HJAA 1YUNA 1UNKA 5CK4A 4XGRA 1XCBA 3HNOA 5C1DA 2WLSA 3GP3A 4X3CA 4US1R 4TUYF 3T3GA 4DZZA 4YUWA 4DM3A 2FGJA 2QX9A 1FVFA 4BLVA 2XZOA 3CLRD 2PQMA 1F8GA 2P68A 1F6DA 1MVNA 4CM9A 1XZBA 3I0MA 4F38A 1IATA 1QC5B 2Y1DA 1CUWA 2GZJA 3KTFA 2V3CC 1G8JA 2ZUWA 3W79A 2N5HA 4M9ZA 2IYVA 1WX1A 4Z2AA 2GAOA 3TRJA 1ZNQO 2KHZA 1T4DA 1M2WA 3ILSA 1LRKA 3F3SA 3M4ZA 3DJFA 4B3CA 3LQRA 3NR2A 4GXRA 1UMDA 2NXWA 3B48A 1DBIA 2LCFA 4AZVA 4MHTA 2J0UA 4EGAA 1K8YB 1HYEA 1LLFA 1NVFA 2IIVA 1DPGA 2RI0A 3BB4A 3M6AA 3TJZA 3ZU5A 1E4VA 3VC7A 3VR3A 2QPOA 1E0AA 2Z2JA 1KD1Q 4JL8A 4C5BA 1MAWA 2A5DA 2J5KA 2WG0A 4MR7A 3JQBA 4D5GA 2E4AA 2NSHA 5J1TB 3VSCA 4BVHA 2GSDA 1KYYA 2O2YA 3I2HA 3AR4A 4B79A 2PEJA 2NSJA 3ZHBA 5G40A 1W4AA 1SBCA 2O2EA 4GRAA 1X1EA 3G6KA 2BP7B 1Z6QA 3HXPA 3G2LA 3CLVA 4LBVA 4XDGA 3VHLB 1ORDA 3LHSA 1GFWA 4NHEA 4LY6A 4ZMRA 5EE3A 4UTXA 2YHIB 2QJWA 1QNLA 1JT2A 1YZNA 4X20B 2VDNB 4CM5A 2XSZA 3BFXA 1LPSA 3IELA 4IPYA 3L8EA 1ZJJA 2V7WA 3OZRA 5HBRA 4URXR 1QRUA 4CLEA 2V6MA 4KRGA 4C0HA 1QPGA 1JLSA 1XHEA 1RU3A 4ALNA 1RT9A 1Z4NA 1KORA 2YQZA 1Y81A 2ATIA 3GLSA 3L79A 4NOJA 2BEUB 4C6TA 4CM6A 4EY5A 1HT1E 1UQTA 1I1NA 1MTZA 3N2ZB 3JQ8B 4OLHA 2F9MA 3NWEA 1Y9ZA 4UHJA 4YP1A 5DGIA 3ZDZB 2REQA 2ZE8A 2RKWA 5I7SA 3JQGB 1TGYA 1H2RS 1EUCB 3A4LA 3HEMA 1GLGA 3L6CA 2JGDB 2D74A 3R0JA 5I3ZA 1SH7A 4P08A 1BQ4A 3OWOA 2AJTA 3SXUA 3ICVA 4IIJA 4Q1DA 4UM5A 2FKNA 4WSOA 3C41J 2NZWA 2CJYA 2I54A 3DF9A 5IKXA 2E87A 1WCXA 4FMPA 4IICA 3PNQA 1M1ZA 4LDNA 3DOUA 1JAXA 1XNHA 3KV3O 4CEIA 1I7PA 4GXTA 4ZDIA 3B70A 2C98A 2ZSHA 5EPOA 1KO4A 2JHCA 3N59A 4CU2A 3OQMA 1J56A 1N6OA 1AGYA 2AG1A 1XCJA 4U63A 1HQKA 2LTEA 1R0XA 2PN1A 3H87A 2IHUA 3H9CA 3F9CA 5KIAA 3A1TA 4WVFA 5FNVF 3W8NA 1MGOA 1SEVA 1ZISA 3PFKA 2MYUA 4GIBA 3EIFA 5JZMA 3C5EA 5KYYB 1HYHA 1U0FA 2XQVA 4DCMA 4JOBA 2IH4A 1ULZA 1N5OX 1BC5A 4NV3A 5ALUA 1YD7A 3NALA 4QXPA 1BGVA 2PENA 3EEFA 1JG3A 5JAHA 1QIHA 1VG1A 4KNWA 3UIEA 1NTOA 3D2AA 2ZREA 2BM8A 3GZJA 3ECCA 1IU9A 3OU2A 5FA8A 2P0EA 3N2NA 4B4VA 4X95A 5KP8B 3PQ6A 5IJ9B 1FQKA 5FF9A 4A91A 4HVAA 5BSRA 3AFHA 2QVBA 3F5QA 1EMVA 1VI5A 2GPJA 3H83A 2CD7A 2QRPA 3P0JA 3BICA 3T3HA 4HATA 4DBLC 5J23A 4DDWA 2W2OA 5JG7A 1N8TA 3BZUA 4BFTA 3EA5A 4MP8A 2BSQA 1U9IA 4GH5A 1Z6TA 1ESZA 1OAOA 2KORA 1FQWA 4HYYA 5CH3A 3VOAA 1NBHA 1KK1A 4ONEA 2FQXA 2ZSEA 1MFZA 5DHFA 1QYVA 3CTMA 2QRNA 3MCZA 4OHBA 4PZZA 5G3YA 4ETMA 5CG1A 1TEZA 2O0JA 4E08A 4DSZA 1N5JA 1L5QA 2I8AA 3OQIB 4RORA 5AI8A 5JMPA 3V7WA 3WMRA 5LOVF 5T4FA 1AJEA 1U2EA 3TR5A 1NZJA 4YCNA 2XV6A 3W77A 3OE7A 3X1WA 3CPWO 4Z1OA 4TVBA 5EERA 4AJ4A 3SFTA 3DS3A 1C50A 4W8GA 3KKKA 1KIFA 4MV4A 2OBXA 4AJJA 1AQNA 4HVLA 3CVUA 4MGIR 2FUG1 4IUCS 2GZSA 3ZZUA 1E32A 2X1HA 1NJ1A 2J0VA 3B1VA 3C14C 3GEBA 1NMZA 2NTEA 4JX8A 2IXFA 2QRKA 3IJRA 5HVCA 1DAEA 4MCIA 4MW2A 3S1AB 4X65B 3IRVA 2W2LD 4H60A 4QFCA 2J3MA 3WMXA 1E2JA 4DLPA 1U9YA 3DE6X 3MIZA 621PA 3HKDA 2QRZA 2K4MA 4DWWA 4J90A 3FB4A 1M1UA 3K9NA 1R5JA 1FRVA 4QFMA 4U9UA 1E0DA 1WPQA 4JJ8A 4U2FA 5HDQA 3S8MA 1LBEA 2CE7A 3P2IA 1TO1E 5CXQA 4AICA 2W6NA 3NVMB 5FTMA 3ZE6A 2Z5VA 3HXQA 3O75A 4MUMA 4GL4A 3I8SA 3WIBA 4CN8A 3CUEF 4BFUA 1LTQA 1TZMA 1O2DA 2CNWA 3HCWA 4GPIB 3GJZA 4IEIA 4QTUB 4RCYA 3REQA 1OXKB 4LQ4A 4P98A 1ZITA 5JPAA 3DCJA 5FPSA 3BIWA 2CNRA 2FR8C 1E9CA 2TSYB 2J85A 4G5SA 3T5MA 4CLRA 2QJRA 2FP3A 1UWKA 4FR2A 1Z13A 2J0UB 1QVVA 2Q9AA 2VDWA 2JFUA 1QTNA 2IYSA 4EMUA 2NSYA 4WLFA 3DZFA 1BX3A 4PO9A 2YJNA 1LLDA 3IHKA 5DTMA 1X87A 2SECE 3CVWA 4FBGA 4MR7B 3W7BA 4CG1A 4DQ0A 3HTXA 1DX9A 3AOEA 4EY8A 3MC1A 4OYHA 4KRFA 4UHKA 2WIFA 5DT9A 3TSZA 3DS1A 1NW7A 2X0RA 4ZRNA 2BYTA 3AF5A 2CFOA 2JFOA 2YBEA 1CZUA 3G02A 4TYNA 2QIPA 2ZRAA 3N76A 3CEMA 4TN1A 5TJHA 3M6LA 2WSBA 3A3NA 1RBQA 3V8QA 4BNGA 3QXJA 4J6FA 2HO4A 2MYTA 3NYQA 2A5LA 4ALMA 2E4XA 3NHFA 1E1QA 3CPEA 4LVOA 1VQOP 3UMVA 3BL8A 3NUZA 1USWA 4LMBA 4A2CA 4KQ2A 5KNLA 3H1FA 1OPRA 1XLTA 2ZE5A 3AV0B 3PDIA 1SU8A 3OEEA 1FNNA 2WG2A 5ADUS 4C6TB 3I5MA 1QXSA 2WWWA 2XMSA 3N1UA 1E9SA 4EOGA 4HL6A 2DHQA 4N5NA 4M88A 1ZW1A 2REQB 3HYRA 1PJZA 1M1NA 2W58A 4DPKA 1AUPA 1PHPA 3GJXC 3L7KA 1V16A 4ZU1X 5M2QA 3H47A 5TMBA 2A2ZA 1B26A 2Z5FA 3DHNA 1JFRA 1ZCAA 3N8KA 3NFYA 1YFLA 2LV8A 5AVOA 1C1HA 2AKYA 2GASA 3G8YA 1THZA 4IIJB 4JMPA 5AVRA 1FLDA 1M76A 1TKRA 4ZDJA 3FCCA 3FWZA 3PGJA 4HXEB 4EFNA 4KJZA 4A5SA 4D9CA 3QBVA 3CPHA 3K0CA 1C9EA 4P86A 4CEIB 4BZPA 421PA 1TZKA 2XF2A 1ZI6A 3H7AA 4G4SO 2OK7A 5ENZA 1KRXA 1N2SA 4DLNA 1K6JA 3EIQA 3S8EA 1ESMA 1J21A 2B20A 1V5EA 2RE8A 2B6HA 3O3MB 1UP7A 1VQNP 1U0TA 3B13B 5ENDA 2PJRA 4BPRA 3HY4A 2C88A 2EAUA 4KAFA 3H17A 4LC0A 3NC4A 3A28A 4AY6A 1RCFA 5L6MB 5YASA 3H3XA 2JK1A 3IHWA 2RHCA 2E4VA 2Z3WA 4C78A 1AM4D 3EDMA 4K9LA 4U0DA 4N8EA 3I9NA 4I6EA 3EXAA 4EJMA 5DDIP 1MJ5A 3I9FA 4X93A 1SBTA 4GUDA 3ZHVA 2H9IA 1ORTA 3H4TA 5A4JA 4OJNA 2HHLA 4S1NA 3WRXA 5FR1A 3O82A 2QWXA 1J9ZA 4D9HA 3HKBA 1XKQA 3ZGZA 1FPMA 4ARBA 1Q84A 3O8OA 2NUAA 4CL8A 1KH3A 3L01A 4BJHB 1OIVA 1DINA 1QFXA 1Z9BA 2WU0A 2X13A 5E7IA 3QYAA 3K4PA 1EBBA 4G8DA 4D5EA 2DKNA 2PZJA 3DF7A 5E95A 5BOSA 1T1EA 2AEMA 2XVXA 3RGWS 3LBYA 2GK6A 1GVNB 1ZQ1A 3IC5A 1PUJA 2KODA 2AFDA 2AD5A 1JP7A 3JQ7A 3ORQA 2BM0A 2EW8A 3KXIA 5EHGA 4KGZA 4LYHA 4IVRA 2AQKA 3PE4A 4S1OA 3W2HA 4ASUD 1DEHA 4ZQEA 2C0PA 5A0TA 1L4UA 3SK0A 2RHDA 4U2DA 2Q28A 1G3MA 2QN2A 2WSLA 3USES 2WWTA 1IN7A 1HV8A 2NPOA 4LYGA 4MS1A 1YFKA 3CQ9A 1AS2A 3QF7A 2XB8A 1MVLA 1TA4A 4TV9A 4YGXB 5EP4A 3HA5A 2QZ4A 4GICA 4L5CA 4B31A 3AVVA 1T29A 2W6CX 3QOWA 1BSVA 1XZ8A 3G9QA 1BXGA 2C5SA 3EDRA 3GAZA 4GR2A 1N0WA 3FI9A 3KHTA 4MGKR 3ZV7A 4BQOA 3W6OA 3B4QA 1D2HA 2C57A 2HFKA 3KCNA 2E48A 4GOXA 4FYWA 2CZCA 1YB5A 3FXAA 3PICA 3TQQA 2JNWA 3SSAA 4FOOA 4FFWA 4HB3A 3I1YA 4OL9A 3LUPA 5CYOA 5BUZA 3SEZA 4A8PA 1H69A 2GNPA 2IZ6A 3QMMA 2I3GA 4IUDS 3W1VA 3WIUA 2Z0MA 4UTRA 5FPYA 3Q2KA 1TIBA 3C74A 2PL1A 3FFTA 3RK0A 3HKDB 4PCLA 1YIAA 1FFGA 3DUWA 4QE3A 3NAZA 4O8CA 3W7AA 2ZE6A 4AURA 1P4AA 2HLPA 2BHRA 3DBHA 5AW4A 1V8BA 3AI1A 1YITP 1LDGA 3CUVA 3T7DA 3HB9A 2MSEB 3VFDA 2JDID 2PQ2A 1OVGA 4XPIA 1NV8A 3LRTA 5J3JA 2D13A 1VIYA 2NP6A 3OZCA 1CYDA 1Y3HA 4N40A 1S72P 3VR6A 2VTBA 2VQ3A 1VPWA 3OTQA 1KPGA 5CVCA 4JEIA 2C4UA 1NG1A 3ZLUA 2QEXP 2BUOA 1Z16A 3S2SA 4M8NE 4FXPA 2JLZA 2IQ5A 3QU4A 1XZHA 3CMCO 3Q5GA 1NJ6A 1QIMA 3B60A 2C03A 2JKVA 5HHTA 4EF6A 2IA5A 1OFIA 1PW5A 2HI0A 4DUGA 1LJ8A 3JVEA 3X3HA 4CLRB 2HUNA 4W7SA 5JSYA 4UM9B 3HVRA 4I81A 2CSXA 3RUCA 3LK7A 1KAOA 1NQUA 2O8EA 4HGYA 1Z34A 2CWOA 1R6XA 2C4HA 3IPYA 4CR7A 2VDWB 1NWCA 1ZMOA 3I04A 4I3FA 2O3RA 4H2WC 2WHPA 4YACA 3LC2O 5THXA 1YUBA 3NNSA 4CI9A 3QLTA 4G1FA 5AM2A 1RJWA 5BV7A 1Q16A 3AOGA 3HPQA 2YRXA 2PEKA 3M5DA 3OHMA 3IX7A 5B30A 3CF0A 1ODCA 5D86A 3I8XA 3G4SP 3TBFA 4E7PA 3BH7A 1QDUA 2O2GA 5A4KA 5JY1A 4CW7A 4Q37A 2EJUA 1IRXA 1KFBB 1ZD3A 3O8QA 1FP4B 1OV4A 5GP1A 3H8JA 5AJWA 4IPTA 2OA0A 3WK5A 3AV3A 1L7EA 1PK7A 1CF9A 1RABA 3DGFC 1NOKA 3FTDA 3MSXA 1YR1A 4RLFA 5HJ5A 2ZRIA 3QFSA 4G23A 5NULA 2EL9A 3S8YA 4KEAA 1KYTA 6GPBA 3OIFA 1T0UA 3QNUA 3W3AA 3KSBC 3RLIA 3MYRA 1OI3A 2AJDA 3GLHA 4WUTA 1KJWA 3VKHA 3PHBE 1JE0A 1KGSA 1QK4A 3DT8A 2RB5A 2H1RA 4RK0A 3PDIB 2IUYA 1J2UA 3ABIA 4OL0A 4XJSA 4PZ9A 4AXXA 4CG0A 2G9ZA 1N3BA 1U2GA 4LS3A 1VM6A 2FK7A 5JSUA 5FBWB 3DTTA 3D59A 3KJXA 3PA8A 4TT8A 1KK2A 2C92A 4D46A 4Q00A 2MR8A 1AXRA 3FUCA 2VUIB 1ZH8A 3EWAA 2ZB7A 4XI9A 2DLCX 3QV2A 1M1NB 1P61B 2R6JA 3SS8A 3ADPA 1V16B 1WXIA 2OO5C 5DNVA 1OREA 1FYDA 1TA0A 4PLCA 4R8SA 2DT5A 4YT5A 1BDIA 2BEVA 2HF9A 3AVOA 4CUKA 4JP2A 4WECA 2JFNA 1FUEA 1IMOA 1MAAA 1NVWQ 3IAAA 4QXQA 1GAXA 4DMRA 2WKQA 1BQEA 1LI4A 2VNJA 4R84A 1CUHA 4DCSA 2SKCA 4OHCA 4BEWA 2HA4A 2F90A 4MWZA 1PX0A 5F9MA 4CKEA 4UAVA 1TAUA 4ZXPA 1BZYA 2WFAA 3ASYA 5CW1A 4EHJA 3FAKA 4S1TA 3GDOA 3GMTA 3GBPA 1R0BA 2VZEA 2WYUA 4EBFA 3QMPA 2WBLC 3KU1A 1MHTA 4OOFA 2R79A 5IBQA 1CFZA 1CRQA 1XEWX 1B00A 1NSYA 3IQEA 3Q1KA 3E9DA 1KIAA 2IUSA 2X4DA 1KVRA 2OCAA 4P80A 2ODNA 3QV1A 5FL7D 2JIPA 1ZGJA 3EGCA 3CZPA 2C84A 4OH1A 4AZ3A 3GRRA 4CPDA 2WUVA 3QI7A 4JYMA 4DM4A 4P93A 1ODTC 3K5IA 4N8DA 1CXZA 1JEQA 2Y1XA 2P2SA 3KTDA 3HKBB 4O4HF 4Q9KA 3PTLA 3OAAD 4XX0B 2VTVA 5F7ZA 4N39A 2RBGA 5DTEA 4B6SA 3O8OB 2YJTD 4IMIB 2MMGA 4NPCA 5HIIA 4JENA 2K0DX 4GOND 1VMIA 4PXSA 2C31A 3W5VA 5JQGB 3ZHQA 2YOFA 1W0KD 3AHGA 2JD0A 2GHQA 4N12A 4PZUA 2DCUA 4S0ZA 4UU1A 1PWEA 3I39X 1MD9A 4OQMA 2E5WA 5ALSA 2ZRGA 1NUSA 2PSFA 2Q50A 2WJZB 3C5HA 3JQ7B 3OO0A 4EBBA 2J7KA 3FPGA 4MPDA 4RQAA 1BVRA 1M6WA 4N18A 1NIJA 2H17A 3NXSA 1PGOA 4I9NA 5EPEA 4DLAA 4EECA 1P2VA 3H9JA 3BGOS 4WK0B 5CA0B 4MS1B 4JUDX 1Q12A 2Y4NA 3CG4A 2FVXA 4CKEB 1A97A 3D1JA 2R2GA 4TV9B 1SMKA 1FDSA 4MKIA 2AYZA 1ODJA 2G72A 4NAUA 16PKA 1IL0A 3DEFA 3GG2A 2DP4E 1C4XA 1P0MA 2M6RA 2OV6A 5F1OA 1ZY2A 1BXGB 3IVCA 2OCLA 1SBIA 1E1CA 2IEZA 4FS3A 1HE8B 2AXNA 3ML1A 1UZNA 2Q5HA 3EVGA 1MDBA 2D0OB 4JT4A 2PNJA 5F7XA 5C5CA 5KDOA 3V32A 5JRZA 1ZD4A 2EKBA 2AOVA 4FGZA 1B8VA 1X6VA 2GCEA 4G5XA 5T5QA 4DV4B 1D09A 4GG1A 2D4AA 2WM8A 3PT9A 3BTUA 1XN1A 5IUNC 1NNSA 3I55P 4ER5A 2Z6AA 1A72A 1TCVA 1TCUA 2BKXA 2ODPA 3Q7TA 2NQ2C 1NE7A 1NXVA 4POAA 3ZKWA 3V3KA 2JAQA 4J76A 2POCA 2DVMA 4JI5B 2JB9A 1MVOA 2PJZA 4RLSA 3DBHB 1T0BA 5L9AA 2FLVA 5BV0A 3VR2D 5CLHA 3N6VA 4L3OA 2QI9C 4KH0A 2RGNA 2VS1A 3SQOA 1SZDA 4X66B 4JEUA 1UT6A 2GPBA 1A9XA 2LKDA 2GI4A 2VTBB 1KQPA 4UFOA 2RI6A 2H7VA 2RH8A 3NHAA 4GYJA 3S7ZA 3SXPA 4AVYA 2I4NA 4DA6A 3VC3A 4X41A 4OKIA 2UUCB 1VXOA 2O7NA 3FVTA 2C0QA 1WCWA 2JFBA 1NTRA 1IE3A 1E3EA 1WXFA 2HMTA 1UJNA 2FP4B 1QMPA 1S8FA 2X1LA 3KZKA 5JCPA 2O59A 1MT3A 3PQEA 4B80A 1JG4A 1EVLA 3FUVA 3HCDA 2N5IA 4RY8A 3RYHA 4EHLA 4ZMBA 1BYUA 3O8NA 3STTA 3TLGA 2I55A 5KNDH 1U4OA 2X5JO 3LW7A 1G4UR 4XIGS 1DKMA 2O8EB 1X0XA 4FYKA 3D4IA 2ETVA 4OXKA 5DU2A 1KOGA 4G0QA 3BN3A 2BI8A 1PEDA 2WHPB 2Z3ZA 4UE3S 3ZNQA 4BO6A 4QOHA 3VNAA 2VXYA 3F5DA 5C9ZA 3A4NA 5AVSA 4RHXA 3C7DB 4REQA 3VZSA 3SX4A 5AM0A 1E6EA 2CLDX 3LIIA 1ILWA 2FEOA 3SSNA 1Y4DE 5BYJA 4QXAA 5JYCA 1VJ0A 1E2IA 2KGEA 1C8VB 1X74A 2XMGA 4BQNA 3O8QB 4M55A 4B3BA 5CHEA 2A14A 1YKFA 4BYGA 5F21A 2OESA 2Q1UA 3FHJA 3P8ZA 1VKNA 1GPAA 4IJUA 2W90A 2AHOA 1N7HA 4KDFA 4LGVA 1T1RA 3PR3A 1SZPA 1O5IA 1G4HA 3X1MA 3ZHXA 1CQJA 8GPBA 3N8GA 5GADl 1UBGA 2ZQ5A 4HNRA 3LW8A 1QIKA 2AF8A 3GLHB 3O9ZA 4TSRA 2ZIZA 4CF6A 4RO0A 1AY0A 4R1MA 2EIAA 1JHDA 4UJ5A 1TGVA 3PNPA 4B85A 3C7CB 1UOPA 1JVBA 3LCMA 1IIRA 4Z9FA 3ZI7A 4Z86A 3KZOA 4RAOA 1YDMA 3AEKA 4PCAA 1I6LA 4YV2A 3QU7A 5KTSA 3A1SA 1VPLA 5EIAA 5H9WA 4MVCA 2HMYB 1Y4ZA 1V5IA 4H7IA 2FRXA 1XJCA 5B1EA 1XLWA 3A9TA 4WZBE 1C3VA 4BQSA 3FIJA 2NWQA 2PRIA 2XYHA 3E0XA 4J0HA 4CR8A 4F21A 5ICMA 5JASA 4M1EA 1Z6GA 1LEHA 1JPVA 2J4DA 1DX6A 2JAUA 2HPHA 2J67A 2FEMA 2O3JA 2PZBA 3QPVA 4TQGA 2ZM5A 1ZOOA 2BEVB 2JW5A 3L7DA 5LZ5A 2RGAA 2AD1A 4K9KA 4RJIA 4UNRA 5A6SA 1ORRA 4OUKX 2WHQA 4CL2A 2D6FA 3PLRA 1JB9A 3K0HA 2FVAA 3GJ0A 5CEJA 1YAJA 4NPHA 1JJAA 4YJ3F 2R3SA 1I4OA 1CHNA 3GRAA 5CG2A 4DMLA 3E1KA 3UCEA 2P91A 4D99A 3EA4A 4QEDA 4OFWA 3S2UA 3A1DA 2EBHX 1SY7A 3MGGA 4M83A 4BVFA 1YL7A 1G4AE 3GA7A 2ZRBA 2VTKA 1IXRC 1WS6A 1RKQA 4FPXA 4WKNA 1G2QA 2XAAA 4XARA 5TGDA 2J6BA 1L5KA 2WF7A 5JARA 1FS6A 3UH1A 3K9FC 3KK0A 1OFUX 2A9QA 5EJGA 1G64A 4KAJA 5BSKA 1H2XA 1Z36A 3JYQA 1SZJG 1LA2A 2ZYRA 5M5BA 4CHGA 2WHRA 1N78A 1T2NA 3HU2A 5TF4A 5CVDA 1K6XA 1JEQB 4IV8A 1XEAA 1BEEA 1IWBB 3DLIA 1SVSA 2H52A 2VSNA 1WMBA 3CFYA 4HUQA 1QVZA 2IXGA 2LPKA 3F9IA 3JWEA 2QQFA 3DE4X 1PNQA 3ELBA 2TMGA 2X5XA 1U2RA 1GRCA 1YDFA 2DY0A 3L3BA 5LM3A 2AQIA 1QE3A 4QU8A 1VIVA 3I2JA 4L72A 1SXJD 2GF0A 1D6MA 5K4GA 3D1VA 3D0RA 3KSUA 4LDRA 1M2GA 3M4NA 2E89A 4KGVA 5BW6B 3GCWA 1UJ2A 3VNQA 3O4JA 3ZVNA 2CHUA 4Y18A 1RRKA 3QE4A 1F14A 2XDAA 3A2LA 3HBNA 3OTIA 4MVJM 1A9PA 3WKEA 2BM9A 3U7QA 4I2VA 3TLBA 2AWNA 4KBYA 1H2WA 4B40A 1RKBA 1XO1A 1G3RA 3QKIA 4PAGA 4M76B 2FEPA 1UKCA 1T43A 2FB9A 4BKQA 1NIPA 4PX9A 1SCNE 3DXXA 4IG4A 3FRHA 2PX4A 4LWQA 4QOGA 4UM7A 4OI0A 1T4GA 1G9TA 2X41A 3QLEA 2E6KA 2Q0XA 4ZALA 3BZBA 4OXXA 3FJYA 4BZQA 1E1CB 1BJKA 4CMIA 1C1YA 4LNHA 1XX6A 4EG5A 4JI2B 2J6IA 4HUJA 3FR8A 3NJ4A 5SY9A 1N77A 2BT4A 2VPZA 4KV7A 5C8ZA 1Y80A 1D5WA 3O6VA 3IEPA 3EQ6A 2P6OA 4Z9AA 1M7GA 4G26A 4OLFA 1W1WA 2UDPA 1T5TA 1U99A 3HYBA 3VR2A 1V26A 2QGFA 1DV5A 3S0JA 4D8VA 2P69A 5KQLA 1OY1A 4IIUA 1BGWA 3ZKWB 3N05A 4IDFA 5G0UA 4UFNA 2QRGA 4KXNA 4OREX 1K92A 3U7EB 3WVNA 3SD7A 4B1FA 1SUPA 4J4HA 1EIWA 3HU5A 4WX2B 1A4UA 5CX4A 1UPUA 1FUKA 1LNSA 3EIHA 3PNLA 5TJ9A 4G1BA 2H92A 1AIPA 4QU5A 4ZI7A 3EASA 3C7AA 2WV9A 3KOWA 5CA1F 1CUXA 1QHXA 3QVGA 2Q3MA 1I2AA 3PHHA 2WNSA 1XT6A 4QPCA 1QVRA 4FB5A 4H2XC 2VCHA 4QYIA 4DDMA 4MDFA 3BXZA 2Y1GA 1XTTA 3OPMA 1QPZA 4XRRA 2NG1A 1CEYA 4JI8B 3EBLA 2BDUA 4G56A 3SLRA 1KZHA 3NIDB 3TLGB 4ZYZA 1W2HA 3FVWA 5PNTA 3O03A 4RZQA 3U81A 4OYYA 4ZGGA 1R10A 3KSRA 1P17A 1YA4A 1YI8A 3OJWA 4LDPA 5EINA 4EYQA 4R41A 3F3YA 4V38A 3R6WA 4CM7A 2IHBA 1V3UA 3OZVA 4EEXA 4II7A 4UJ3A 3N0RA 1XC7A 3EXHA 3ST7A 4ZYXA 2QN7A 4KTVE 4ZHQA 5BR4A 1DMRA 3DLPX 3LJKA 4KQIA 1ILEA 1O89A 2G77B 2P2LA 2ZCUA 2ZYWX 3M3HA 2H0QA 4NYIQ 3IUSA 4EW1A 3DOCA 1ENPA 1WUTA 2AZ4A 4G0WA 4OX9B 3FSGD 4XWGA 5CM9C 4PAQA 1M6NA 3N74A 3UN1A 1M8FA 3CVJA 2BELA 1HRKA 3Q9UA 1FZTA 1STOA 1HFKA 4IDNA 4LWOA 4YMGA 1CQJB 1EJ6A 1R4NA 2QR2A 4GD3Q 5EXDA 5CD9A 2WUEA 2L0QA 1ORHA 2HLNA 2AGVA 2LVBA 2W93A 3ZY2A 4KUEA 1RIIA 2HNKA 4LY0A 2QBYA 4DLYA 1UK8A 3IMEA 4M36A 4OQDA 5DM1A 4X7MA 3QWBA 3EA0A 3M6FA 1NW9B 1G60A 2WPDA 1PLLA 3AF1A 3INGA 3PDJA 3AEKB 2FVYA 5I9IA 3SWWA 2D1QA 3W6NA 3ZXUB 5LA6A 5LNK6 1L2TA 3MFQA 4OB6A 3CCJP 2QM3A 3P9KA 4C3VA 5TV2A 4D74A 3T9EA 2R9VA 3WTCA 1SUSA 4LCBA 4FBMA 4P0QB 1VQ1A 3K2QA 4U0KA 3DNPA 4WXRA 3VYSB 4UREA 1NG9A 2YZNA 2HRRA 3BHIA 4DJFC 2KLHA 1Q7YQ 2GAFA 3EAGA 2BGWA 1GAEO 1JFVA 2WIJA 5ILOA 1A96A 3SZRA 1UZUA 3OIGA 4MYSA 4COCA 13PKA 1YONA 2Z8YM 5IVIA 1GLVA 1HQYE 1TI7A 4F92B 1Z0ZA 5A6SB 2AFEA 3KSMA 2IYFA 2P2ZA 2VAVA 1EE2A 4MSUA 2CXPA 5J43A 3EUWA 2QAJA 2VF4X 3KBOA 3D02A 1P9LA 1QCZA 3SM3A 3SE0A 4MWSA 4B81A 4FOPA 1N2HA 4GBED 3V7UA 1I4LD 2BCEA 4QDUA 1QHEA 1DUIA 3PP8A 2I6GA 3TKYA 4TTVA 3B9BA 5LSAA 3MLBA 2B2NA 1XB2A 2YC2C 1I0ZA 4OFXA 4H4EA 2H0AA 4MQ4A 4NYMQ 5BNTA 1KEKA 4CQLA 4ECAA 2QORA 3PLNA 4XA8A 1TCBA 3CA8A 1GY8A 3VV3A 1FMCA 4M1MA 4I1UA 4QPNA 4WOJA 5TC4A 2QI9F 4KXYA 4W1RA 2H29A 5FTKA 3AM5A 4OHZA 2HBRA 4AMUA 4TN5A 3DDZX 3HACA 2PSSA 3BB1A 2FADA 1PS9A 3QHPA 1W35A 4KGXA 1CP3A 4GBJA 4GOJA 4MUNA 5GY7A 1L9XA 3E5RA 3HCFA 5DN6A 3CEPB 3L77A 4KKXB 2YMMA 1M6YA 3EVBA 5JNWA 3PQ3A 3NTXA 4E4RA 4J4BA 3FLEA 3PV0A 4HUQB 3ZTWA 3USZA 4CIXA 1NDHA 1S2DA 4NF2A 4OFZA 4XYMA 3CRQA 4IJQA 1QG6A 3GFBA 4H4CA 4O4IA 1V71A 1WNFA 1UK7A 3NIBA 1UJBA 4UVHA 2GUGA 3R9IA 3KEOA 4EM6A 3MGCA 2VJQA 3QX9A 4RTOA 1HOXA 4F9EA 2IXTA 2FMUA 3R7NA 4YHHB 2PBZA 1V3VA 2A9VA 2ZDQA 3FOWA 3N2GA 5EMMA 5EJEA 1ID8A 4E88A 2VHEA 1YL5A 3U7QB 4MIOA 3I30X 1I3OA 1DBRA 2HEGA 3LT4A 2HCRA 4COPA 1M9NA 3QZUA 4N41A 2R6R1 1VB3A 2CL7X 3VO1A 3HCAA 5L3SA 4QJIA 3LDAA 3PJDA 4MWEA 3EJDA 2AEJA 4NDAA 4YCDA 1G5QA 3KKNA 4QHTA 3TLAA 5COQA 4DLUA 5HGOA 4UU7A 3ZC3A 4ZOQI 2QJTA 4CMIB 1KQOA 1HWYA 1MO3A 1EM6A 3QKTA 4UFPA 1PO7A 2AX3A 2WSMA 1UXGA 2XMZA 1BE1A 1V45E 2CGEA 1VQ9P 1UP6A 2YVUA 3FM9A 5A71A 3E84A 2G40A 3P5SA 4DEYA 8AT1A 1G8HA 1X3OA 5BURA 1Z2DA 4JU8A 1KZ4A 2CXUA 1RAIA 3KEGA 3QGMA 3RC2A 3K1TA 4YPOA 1OUMA 4NECA 2AN9A 4P31A 2R8YA 3WYNA 2FTKE 3M1LA 1VQ6P 3RASA 4YUVA 1NBEA 2Y0DA 4E5NA 1R2QA 2FHPA 3JQBC 4GL2A 1QANA 3OMXA 3HS3A 5FFNA 1KPHA 3PFWO 5CB0A 2OUKA 3WIVA 2RAUA 3GJNA 4DS3A 5KINB 4QARA 4PYNA 3F90A 4ZI7B 1Z22A 2B36A 4FE7A 1RRCA 1NN5A 4MVJD 3NEAA 2CJXA 4F4HA 3QVGB 2YS6A 2Z4SA 3WGTA 4EAQA 2C3PA 3K9CA 2YY6A 4DJAA 3DPUA 4LXYA 5F7JA 1WXQA 2AI3A 2NO8A 1XQ1A 2JAPA 4M0FA 4QYIB 2C3OA 2P30A 4JD5A 5E0OA 3ZK9A 1GZHB 4BMVA 2RJOA 3MFYA 4TYQA 4A0SA 2J4CA 4D3XA 1O95A 3B3JA 4UCXA 5H7XA 4B17A 1JLLA 1Y89A 4HLNA 4DDUA 2P11A 3R7BA 4PRLA 1B15A 2AKEA 4OHYA 4PNHA 2G9VA 4E94A 5AKXA 2GEUA 3OQPA 2EQBA 2QW0X 1OFTA 1E5QA 1U4NA 3EXHB 3LF1A 4E2FA 2CHGA 4C0QC 3GVHA 4MB2A 2CUTA 1JIVA 3IR7A 3DE0X 4RVUA 4U7FA 4K3VA 2C78A 2JH3A 3OF3A 3TIVA 4JLAA 4C87A 4FJ2A 1L5RA 1KPIA 1XZPA 2VJKA 1F06A 3M82A 5DB4A 2WIGA 3BQ9A 4OFBA 4AJNA 4BB6A 4K28A 1IM8A 1R4NB 1Z7EA 1ZUNB 1P18A 2ZJ4A 3ETDA 3NP7A 5ES3A 4KFUA 2WYIA 3WAGA 1ISIA 3LH5A 3UUFA 2GCPA 2IH2A 2BBWA 1XF9A 1Z07A 3CW8X 3ZX4A 4GE0A 4YXWD 4W5OA 3JYNA 2KGDA 1KJYA 3GXBA 5K05A 3IEMA 2NYVA 4B4WA 1P1FA 1MH9A 1B0AA 2AQ8A 4RVGA 4AS2A 1IXYA 2VHTA 2CWDA 3ZLJA 3UMYA 5J58A 2GHIA 5A5VA 2ZXFA 5LA6B 1LRJA 3UHOA 1E59A 3SOPA 3C45A 2XIQA 4ZEXA 3AHDA 3Q3HA 3M0EA 4DG8A 5E7MA 3HUFA 5LN1A 1G2PA 5FQOA 1TZBA 4HTAA 3L7LA 1NAHA 4CXMA 3VAAA 1LK0A 5FADA 4ZVOA 4CG2A 2XPCA 2IUEA 4MVJF 3CUWA 3KTAA 3UOGA 4Q93A 3IMCA 3AUTA 1SWVA 1I1HA 3IAXA 5DMXA 5CJPA 4GU5A 1WMFA 4R05A 4W9NA 5AW5A 4C5CA 4G0PA 2VP3A 3CCMP 3T9BA 3KO8A 3VKUA 4OQFA 1DG1G 4F4DA 2QLBA 3QNMA 1C2TA 3A7DA 4K6CA 5E6UB 5JDCA 1SUBA 4Z0NA 1F3OA 3LD9A 3CMAP 1RAFA 3TBHA 1XWWA 4R8RA 4DCVA 3I1IA 2Z57A 3BMOA 4Z3DA 1Q15A 3GN1A 2EKPA 1HETA 1HI9A 3GLFE 1U9IC 2SHKA 1GLNA 1OAOC 1M6HA 2GETA 1O4WA 3Q9NA 3JRXA 4EHBA 4QVIA 1BFUA 2LIVA 2YXBA 4CQLB 1TM4E 2D2FA 5ALMA 2HSDA 3GPBA 2HYDA 4BAZA 3MGAA 5FI3A 1YCDA 4YUZA 2M6SA 3R77A 5AVQA 4QBKA 5IWCA 3PEEA 4BNNA 5BSMA 2QGNA 3HU1A 4EKIA 1GIAA 2JRCA 3PHJA 4LXQA 4MHOA 2PYDA 4ZZ0A 5E4TA 2QQ0A 4PNPA 5KQSA 5DGCA 2PT5A 3DMDA 3QXGA 3TLKA 3VR1A 4QT4A 4CIWA 2W48A 5BR7A 5ECYA 1PT6A 4UC0A 3CF4A 3IPCA 3TSOA 1Q0LA 1UDWA 3PUJA 4O4IB 4BN0A 5IJ0A 3OFND 2CDRA 3ZZ0A 2QUIA 1GL7A 1PWXA 3FF4A 5JH7A 3OCZA 1JMKC 3VVLA 4HR7A 4BGEA 1CR1A 1N4AA 1YU6A 2QIOA 2C4NA 1T91A 2XTMA 5EA2A 4O3FA 1GPMA 2JI4A 3N2GB 2PH3A 3JZMA 3IVXA 5FBKA 3ND7A 3K70B 5LPNA 4CEJA 1Z0IA 1H1LA 2LNDA 1HDEA 4BLWA 2R48A 4JLPA 8ATCA 5HOQA 2C4VA 2C4TA 3K0BA 1Z8NA 1NW4A 4TOIA 5C7IO 5L3SB 3ROZA 1J4AA 3N2EA 3IAS6 1MMFB 2KG9A 4JROA 4L8VA 3T7SA 1J2YA 3P96A 4ID9A 3OE5A 4Q82A 1GV0A 3RV4A 4JGIA 1QTIA 2QM8A 3FNEA 4PHFA 2QD2A 5IP5A 2OXTA 4F9GA 4KXVA 1D0SA 4LRTB 4RHCA 1U1CA 3PWTA 3IOEA 4A8TA 1Z4QA 2AW5A 3UCFA 2O7VA 3AXSA 3O0DA 4LGYA 2GCNA 3T3PB 3CHYA 2MSLA 2GXQA 3CZ9A 1MR3F 2E7ZA 1O5OA 4KO4S 5A6VA 3KQLA 3JQPA 1OLSA 4M8IA 3CG0A 3R23A 1UXHA 3UAZA 3U80A 2VF5X 4DAEA 3M5WA 2IV7A 3ZBPA 4NU6A 4A1OA 4M1TA 1YZTA 1RMQA 5AVXA 5KMGA 1XZQA 1Z7GA 2P8SA 1K7YA 2QM7A 2Y1OA 3L18A 3OZTA 3OIYA 4IJ5A 2MHCA 2I78A 4RV5A 3SHWA 3E7PA 5AK6A 1G5HA 1V1RA 3G26A 3DAPA 2BEWA 4IP0A 3C16C 2C04A 3AF2A 3AOEC 2HPZA 1L5SA 1O97C 3T5TA 3CCCA 1N36B 2O54A 4EHFA 2R68A 3UJ7A 4B5LA 1CRZA 2NO6A 4HGRA 4LBWA 5I7AA 4L28A 1MX1A 1FXWF 1EFPA 1LRLA 4P34A 5FOUA 4B3SB 3UF0A 3G1GA 4LNUA 4ZVSA 4Y0VA 3RU3A 5GIPE 3AR9A 2PUJA 5KNCA 3L41A 1Y5IA 3X1JA 1SA0A 1SBNE 4D80A 1N5RA 1XLTC 3L2OB 4WNIA 3ESXA 4K9SA 4EPVA 3VKFA 4DWVA 5LZ2A 1EU1A 1NT4A 1JF8A 3DMYA 2QUJA 1JLLB 1CVIA 1OV6A 1ZNXA 1ZSYA 2HDOA 2XNDA 4Q19A 1RQLA 3VR3D 3IT2A 4C0KA 1V7QA 3B78A 4PCVA 1O1YA 3WLJA 4RTKA 1F20A 1TECE 1GKUB 4X00A 3E7XA 3IJ5A 1L0IA 3DWGA 1HGXA 1NBMA 4CLHA 3V8RA 4QDKA 3KOZA 2EC5A 3OZGA 3P9NA 2VEDA 5CPFA 2YY7A 1VQ8P 3IE0A 1JPNA 5MFPA 1EKXA 4OM8A 1FCJA 3LZ6A 1N5DA 4ZCSA 2BJHA 1N7IA 3NHZA 3WC4A 5JWRA 3VDRA 3RF6A 1V6CA 2RK6A 3DNFA 5DSXA 3K0CC 3UJCA 5BP7A 5LQAA 3RAFC 1BH2A 3AP2A 5JFGA 4F5ZA 1ABEA 1OXXK 2P78A 4FFBA 3P52A 4IIVA 4URYR 1JWLA 4G8JA 4ZPXA 3TX2A 4PAOA 4JLMA 5K99A 3PGA1 5MN5A 4H15A 4JP8A 1U98A 3RKSA 3W2FA 4AJIA 2C2GA 4JYPA 4C08A 2XKJE 3HCBA 4CTOA 3VO9A 3LCJA 3BDVA 3F7NA 3LHIA 1L4LA 1Z18A 2AE2A 2HQBA 2ZUUA 5AJTA 1VCNA 3UB3A 4UOZA 3ESRA 3OZWA 3QNWA 2OTJP 1E0HA 1Q3HA 3LVRE 3G13A 2ZROA 4KIWA 1JKMA 3EPPA 1RWOA 1T8PA 4L8LA 3PHIA 1EWYA 1U0JA 3PSAA 3KTAB 4LPSA 4FB4A 3WRXC 1DKQA 2D1SA 2PWYA 3KD2A 1I3LA 2WYOA 1Y8AA 1F2DA 4FILA 4ZQHA 4XB2A 5FR2A 1J00A 2VIIA 4MMYB 1NYRA 4RL4A 1UKAA 5IM5A 5I7VA 4JYAB 2ANBA 5IFKA 3O93A 3EOAI 1EXMA 2H4ZA 4TWRA 4C4PA 2ZETA 2PX5A 3O8CA 1IUKA 4QGSA 2OCKA 3ROGA 1ZCJA 3IBFA 4R7ZA 3DB2A 3RSGA 4EPYA 2P5YA 3BMOB 5JZSA 4YI3A 4UHCA 4IH4A 3X1DA 2ZW9A 4UATA 4FZRA 4CNBA 1OXSC 2JCVA 2VH5R 4K05A 4Q4DA 4L7QA 5AKEA 1L6RA 1TUEA 1XTJA 1PQPA 3D54D 2L19A 1XJWA 3T38A 3KFXA 1Y6JA 3VR4A 3LMOA 3M81A 4A0HA 3R3SA 1P72A 1M1KQ 1K7EB 4LXHA 4O5OA 3GRKA 1YR8A 4WLEA 3VU3A 2I8CA 1U63A 5IAJA 3NOQA 2AYYA 2WF5A 3QUTA 2BKEA 1T1GA 1SCIA 2XUIA 3HDVA 4C7XA 2IP4A 1E1LA 1UR5A 3LFTA 2C4MA 2IDJA 3FCUB 1VA4A 2IOQA 3ON5A 4HBZA 5L51A 1C1XA 5DX0A 3PG5A 4UVEA 2NO0A 5IJ0B 4DBLE 3U09A 1JEJA 1UKYA 1TX4B 3AEUA 4L2IA 5ALVA 2OGZA 4R8LA 5JH7B 1YJAA 1XRQA 2YNMD 2BKUA 3CX3A 4O2AA 2ZRHA 3LX8A 1ZMRA 3FKQA 4UAUA 4PXAA 2KW5A 3HR4A 3MJRA 4B9AA 4LXUA 4E2YA 4DV3B 1E2BA 1KI3A 1JEYA 4X44A 4AMVA 1CC1S 4JC0A 1E5TA 1GTVA 1NI5A 2YDYA 1I14A 1KEUA 1P0PA 1H1LB 1RBMA 4IFIA 1K4MA 1LS6A 3PDWA 4BX8A 4CEJB 1V7PC 2E4UA 2QYSA 3PEFA 1QVGO 1ABFA 1AKNA 4JXKA 3RFFA 4C4OA 3WBBA 1MC8A 3OE7D 2Q6VA 4TYMA 1JBKA 1RFGE 2H85A 1TEHA 4PLPA 2CUKA 2XH8A 4MKHA 4J8PA 5JMWA 1AUVA 1CUYA 3H2SA 3I2KA 2IODA 1ZXLA 3CPSA 2VZ0A 1RFLA 1TB4A 1XDSA 1WDKA 1XXHE 3QU9A 4PSDA 2OQRA 1L5MA 3HVKA 1DLIA 2COUA 3I04M 2K93A 1JFFA 1QTQA 3SJUA 4OIFA 1P2UA 2IDZA 1BHO1 1QGAA 3IA2A 3OQBA 4HQLA 4RV9A 4TTPA 4DJJA 3DOOA 2YZ2A 1IY2A 3BJMA 1KEPA 1R8QA 3HFJA 3R3VA 1POWA 4PQFA 3VV2A 2V98A 5KQMA 1RHUA 3GGDA 3SLKA 4C5AA 3RROA 1JECA 4RZIA 4LJ9A 3QVXA 1RTTA 3E5HA 4KSCA 4X1IA 3MJSA 5KMGB 4OD0A 2JFFA 2VWHA 2WJJA 3OOHA 5KQGA 2B8WA 4ALJA 1A04A 2QVYX 5D6OA 1K5HA 2PU5A 1Y9DA 1V1RB 1POXA 4EEZA 1QYDA 1J9EA 2BEWB 1JNXX 2C8KA 4CDGA 5AK3A 3GNQA 5HQJA 5BN4A 721PA 4AUMA 2KWLA 3DA8A 5CM8B 5EQDA 1OOEA 4M1ZA 1SKYE 3ABQB 2BL4A 3TNFA 3FRIA 1E0KA 2A9OA 3WB1A 5HRUA 1TTQB 1X8JA 1EFPB 2O2XA 2WYHA 3CO0S 3COZA 4JOCA 3UT5A 3ZQKA 5E1DA 2MY5A 1XGKA 2CNWD 3H5RA 4LNUB 4MNTA 4MICA 4JBIA 5EJAA 4FOLA 5BMVA 4MAMA 3E1SA 1Z5UA 4ZMSA 1Z74A 1F9AA 1JPJA 2X3UA 3TPCA 3QLVA 2DX7A 4UHEA 5TS3A 3VO8A 2CQ8A 3KFVA 1SKMA 4UM9D 5EIXA 2F3RA 3MUFA 1CYEA 4F6CA 2MVUA 2PWPA 2C5FA 4JUIA 1Q83A 1M2HA 5C5IA 4P7KA 1I01A 4DJDC 2KG8A 1N9KA 2QZZA 1U2GC 2BH2A 4ZKEA 5LQKA 4J7AA 1PR9A 4OBBA 2WTBA 3MW8A 4WZAA 4YDRA 5TMDA 3SC4A 5CVEA 1C3EA 1QP7A 3P0FA 1UM8A 1FSGA 1VXRA 2KGCA 3FRJA 5FULA 5LQJA 2BJWA 2CXSA 3PL1A 3WI7A 1L5ZA 1SOUA 5B6JA 1SXPA 3KDAA 4II2A 2QTNA 4O02B 4UOQA 1E6MA 4HZIA 1DCFA 2OT3B 4POOA 1X1SA 1EMDA 3QBDA 4YJKA 5DM70 3WZ2A 3G0HA 1T5LA 3I6BA 4GM0A 4XQGA 5M34A 3QUBA 4X7BA 1E1QD 1W96A 2OYRA 3B6IA 1Z6YA 2UV8A 4YECA 4E4YA 4FFBB 5CGZA 2J5QA 4HQ0A 3CCSP 3SF8A 1AS0A 3BXPA 3H0DA 2CNNA 3IH5A 3TPZA 1GU0A 2OKCA 4KXFB 1G17A 3GZ4A 3OEED 4BZWA 2HWYA 4XDHA 3PFBA 1WEKA 1LK7A 4ZK6A 1WY7A 4B32A 3WDKA 2G28A 3FNRA 3EN0A 4KPUA 5DRYA 2GN4A 1B74A 1P7PA 2V7VA 1U7WA 5L4NA 1BDMA 3KJZA 3IPXA 3A31A 3OCCA 4MR9A 4N47A 4FOTA 1W30A 4LGCA 2VJYA 4AW9A 1H3EA 2O4UX 1FFBA 3KKZA 1ZRNA 3AT1A 4PW0A 3EVNA 1G16A 1ZM2A 3GP5A 3ZXIA 5IEBA 1OH7A 1QYCA 2FJ0A 3CH6A 3SP1A 2GJSA 1LQ2A 4WNYA 3L6OO 4XFKA 3DT6A 2EX0A 4UARA 4ERNA 3AIMA 1IIBA 3IEKA 3O2QB 1SHUX 1T6NA 2HQ1A 3BHMA 3FW1A 1AO3A 4J9UE 3T06B 4N0QA 4BTLA 1M2EA 4JJGA 2UZIR 3A1WA 3MRSA 4DUZB 1LTHR 3X2SA 1Q1ZA 3D0OA 3MRTA 3KB8A 5H8WA 5HEKA 4DILA 1E3TA 3ZGNA 5F2OA 1Y5RA 3G5AA 5AJVB 1K3TA 1Q17A 3SR0A 3IKVA 4L22A 1IEVA 4ZVTA 2AA3A 1U5AA 1GITA 4N01A 1NJ5A 1UODA 3FCAA 4G8BA 3ZDYB 2OCXA 2D00A 1E61A 2CZQA 2GD6A 4UQOA 2GR9A 2P5UA 1Q1EA 3VJRA 3W4KA 5AW3A 4RPGA 4NMMA 4TKZA 5C8VA 3GXOA 2FEWB 1FTNA 3RRBA 1Z29A 4HTFA 4YRIA 1QR6A 3RBAA 2AX4A 2UXCB 4YR9A 3RVKA 5CIQA 3UQZA 3WGJA 4C0BA 2B9EA 4WV3A 5FI5A 1MLDA 1VECA 2H2HA 2KQUA 3UHJA 2ZI7A 1T9BA 4L75A 1K98A 1MB0A 2O2CA 4FDVA 1C1XB 1QKIA 4ISBA 2O8BA 3OJXA 2ZZKA 2JGAA 2GBIA 3NHMA 4YCAA 3OQNA 4GS5A 3AEUB 4L2IB 1F12A 3HC7A 4O2AB 1ORWA 1CR6A 2OYCA 1WV1A 3N2IA 4HKGA 1A2KC 2WDPA 3ZCPA 1QORA 5F2KA 1XBTA 2M98A 1O9GA 3C43A 1VP3A 3FOAA 3I73A 3N70A 2P9EA 4FMCB 2OGUA 4HDQB 1NX6A 2VK4A 4N7BA 2P3OA 4CR6A 5BYKA 4UHDA 1KMIY 3E5NA 1PR5A 2NTVA 2QOEA 4RTLA 2HK8A 1YC5A 3NH6A 1SUAA 2FZVA 3CVOA 2RGNC 4U02A 1FC0A 2C3YA 1GGHA 4LHZA 4PZCA 3EGXA 5FDFA 4M9UA 5GOZA 4TZ6A 5B1IA 3CR3C 4BCDA 3BCUA 3WJ7A 2XRZA 2I03A 1XNQB 5JE8A 2RGBA 3KYIB 1M66A 1N5LA 1U0RA 3D3JA 4KACA 4L74A 4R3NA 5ERGB 3HB0A 4EY3A 2JGIA 4BB9A 3F8WA 1R12A 1U3WA 1DWUA 1JFFB 5JROA 3UJ9A 1R0YA 3IDFA 3KDSE 4NE9A 1QHIA 4CE6A 3BPSA 4LHEA 1X14A 3GROA 5HKAA 1F0YA 3LBFA 3MOIA 3JPWA 4IR7A 1JR3E 1Z4PX 4LC1A 5EESA 1O77A 7REQB 3Q6MA 3W8FA 2CW5A 1CY2A 2O1EA 2W2VA 3ED5A 4MWDA 1TK3A 4AK9A 4X6LA 4X1IB 3RIMA 1WSAA 2XNCA 5C8DA 5AOCA 4ZVVA 1ZH6A 3SC6A 1UBMS 3T3EA 2HREA 2XA9A 3WLOA 4D82A 5AQ1A 5T64A 2CYCA 1H8EA 2QT0A 4YPFA 3SBXA 4K9OA 1XDBA 3Q7IA 4NH4A 3IURA 4TQUS 1CZRA 2JKYA 4R0VA 2V96A 3JZDA 4ZYVA 5DCLA 3SJBA 1IZ8A 1QIEA 5BN4B 2Q3JA 2W4QA 1TU0A 3VR6D 4CIAA 5AW6A 4NXNB 4FWBA 3CE7A 1Z4OA 1T5HX 4IOMA 3VJKA 3O83A 1F9EA 5CDGA 4RJ2A 3PI6A 3UT5B 2A1TS 4DC1A 2VJAA 4EMTA 5C80A 3OLWA 3WYGA 4A26A 4N54A 4TKUA 1W47A 3ABZA 4HS9A 3TAXA 5BMVB 5J2UF 1T0HB 1VHLA 2AC4A 4URUR 5ALLA 3JYHA 1ENZA 2OFOA 2WR8A 3DXYA 4DUGD 5KCZA 3A2MA 1J8DA 1KA9H 2OV1A 3BGDA 4WOCA 4AN4A 5CLFA 9ABPA 3T1TA 2PBLA 2X2OA 3VZCA 4X1YA 4BVAA 1N3LA 2K87A 4N4AA 1HT0A 3TSCA 2UUBB 3UC9A 2NO1A 3PXUA 4M7OA 1EOQA 4D8YA 3PTAA 1JIUA 4BTEA 2ZYGA 4D8UA 3T4UA 1TQ6A 4IJKA 1A9TA 1NMSA 2HRDA 4WZAB 3GFPA 2GZAA 4TV9F 4P9NA 1ESNA 1D8TA 4TL8A 1JTFA 4G3XA 2FSUA 1KBOA 1X0VA 4PHCA 1GRQA 5AESA 3P32A 5B58C 1Z56C 3PT5A 4DCPA 5JSKA 1NBIA 1JBEA 1XG5A 3L7BA 5SZKB 4EIWA 1PK8A 3OPVA 3W3AD 3P2MA 1EG7A 3IAS1 2QVGA 1R7RA 1X7YA 1YTLA 2BCGY 1GCUA 1CLEA 3M70A 1XTZA 3GV0A 3UMCA 2IC5A 2W0MA 1BDHA 1A4RA 1XVVA 2QG4A 1R6DA 3HQ4O 3QK7A 5DH9A 5EWMA 5WRFA 3SF8B 2HQSA 2Z2XA 2GTIA 1GGVA 5IBRA 4CMGA 1MORA 1UQRA 2WILA 2Y1FA 1ZN9A 3AL3A 4RV4A 4ER7A 5C53B 4TZ0A 1AKUA 1K0UA 1JAHA 3PB3A 4EVIA 4UTZA 1NQOA 1JDBC 1NU6A 2NGRA 4RZUA 4TZKA 3EVDA 3ESYA 3DFFA 1Q74A 3DUFA 1JV2B 1NJ2A 1E3WA 4I50A 2BJVA 4U2EA 5CEFA 1F8UA 3MB5A 5KKAA 3ZZNA 4KPUB 1K8RA 3LUBA 4NFSA 1L4KA 1W93A 1O6FA 4XR4A 3Q9SA 1DNYA 1CERA 1O6CA 3FUTA 4MR9B 2Q9BA 4RJLA 1M2JA 1V7CA 2OZPA 3MILA 2QX8A 1OSNA 1ZVJA 2B1RA 2ARKA 1GSAA 4FE4A 2ZYAA 5EEGA 2HA3A 4GYYA 2CBZA 4MEBA 3WGNA 3WOHA 5AKLA 1XCGB 4XCVA 1QFZA 3D7LA 5CB4A 3IESA 4BGDA 5E8JA 4ADSG 1ODIA 3RFCA 2ZIVB 3DZIA 2CKMA 3EG9A 1XDZA 1DQYA 5LBTA 1BWPA 1G21A 1VCIA 1VG8A 4IRXA 5L4LA 4J94A 3N58A 4BXOA 1Y34E 4M0EA 1AOXA 4NMWA 2PMBA 4ZU3A 3TRFA 4ER3A 3EG5A 3LY8A 3L02A 2X22A 4JLNA 2VHZA 4TWBA 1Y6GA 2DPMA 3LT2A 3DFZA 2C1ZA 4K5QA 3KIPA 4DREA 5ITSA 2PZLA 4LFAB 1LF5A 2C3UA 4DABA 4E7OA 1VIDA 3G49A 4QEZA 6PFKA 4I46A 2CLCX 3WHIA 3UYKA 2GA8A 1U3UA 1XKXA 4NEOA 2EJBA 2NT3A 1HTBA 3FA2A 2VJPA 1TA9A 3F4BA 3RO7A 3SMQA 4BNWA 1M2NA 5GZ3A 5F4BA 5IASA 2EG5A 1G6KA 1HLFA 3MCUA 1QUFA 2AI2A 2O8BB 1C7FA 2BTOA 3G2KA 1DC8A 2B99A 4OJQA 4QHYA 4B2LA 4YAKA 4J0FA 2NIPA 1OT3A 1VGRA 3ITKA 2CSUA 3M33A 3CRVA 2ILVA 1L7XA 1Z2NX 4FYMA 3UGQA 2YVAA 4CETA 3RSOA 2D5CA 2VK2A 1Q81Q 2VAPA 1P4HA 3IB6A 4NQZA 5D8DA 3K31A 1WP4A 4K9DA 4RPCA 1P1CA 1S89A 1P3Y1 3V80A 4BV3A 3UV3A 4H16A 4I5DA 5H3HA 3RS5A 4QC2A 4YAIA 1FU8A 2C82A 2R8ZA 1XHFA 2JH9A 1NJFA 1V11A 3DE1X 4IH9A 3R5XA 4QO8A 3IDOA 4R2IA 5BV8A 4OA8A 1WG8A 1FQJA 3G9ZA 1WKVA 3DNMA 3S99A 2O0KA 1KZ1A 3G1UA 5TR9A 3UMJA 2RHMA 1SVOA 3JYLA 1I4DD 5BORA 2BE7A 1D1QA 4MOWA 1JXQA 3EGXB 4MGEA 4QWMA 4BBPA 1W2WB 3VRHA 4RK7A 3BZWA 3FKSA 4B47A 2Z2ZA 1E9BA 1N0HA 1A8UA 1OIWA 1F0PA 3A0RB 4DOMA 1FNDA 3MZ0A 3WLPA 4B83A 2H4YA 2Q1WA 4Q16A 3PEVA 3L8MA 4CCSA 3H86A 2BMEA 5CP8A 3PFGA 2NNLD 4ZAGA 4JC4A 3VTAA 1A69A 1Q0UA 3PIDA 4FVTA 5EE9A 3SZOA 4J7UA 3ZHRA 1NPYA 4Z3KA 2PA0A 1YTUA 1NAIA 5T3YA 1XQVA 1H2HA 2DUWA 4I0WB 3C6XA 2H08A 5JZ9A 1YULA 1IY1A 1NVEA 2ZQYA 3P7MA 4J0DA 1JJ7A 3KJEA 2JAWA 4GM4A 4HN9A 2ID8A 1IXSB 4U2GA 3KYBA 3V1TC 5EZYA 3V7FA 2Q46A 4M8KA 3EXHC 4HNQA 5EZQA 4Y2UA 3QWAA 3DE3X 5LB4A 4B3TB 3FPFA 5DYWA 5AOAA 4ENVA 5HOEA 1NXWA 2VHQA 1D9ZA 5CLIA 1NN1A 4KXLA 2I1LA 2JLAA 3E61A 3CIFA 4TWAA 3RWMB 2Q1SA 4NENA 1QYWA 2O1XA 3VR0A 1FDRA 1QFYA 1NXOA 1VKZA 1ATZA 3GHYA 4JT8A 4RA6A 1FTYA 4X90A 5E9QA 5JC8A 3CXRA 3GJ6A 4HWPA 2HJWA 3MPOA 3Q7RA 2VJMB 3NT2A 3A1EA 3ZH9B 3KKMA 4AZWA 5JZBA 1G20A 4IIBA 5KC9A 3VPBA 1GGFA 1MJNA 3IIIA 5CLLA 3WK9A 4EEKA 2HDWA 1L8AA 4R1SA 2WTUA 2JLXA 2VNHA 5DIZA 4C6SA 4KQGA 5KYGA 1YBMA 5E2AA 1Z5VA 1PFQA 3ONVA 2IF2A 4FBLA 4J2HA 1A8OA 1PFVA 3NOXA 1CQIB 4UVIA 4UCQA 1SZCA 4JOQA 4X1YB 5FEMA 3PR1A 2ZJ5A 1TYCA 1ZXBA 2HNBA 5EJDA 1I1OA 3I0NA 3FYHA 4LOJA 4WYMA 1I7LA 5E0KB 1TDJA 2XDQA 5FWNA 5FL3A 3FPBA 1RWXA 2D5BA 2R44A 3AW9A 5B1YA 1KQFA 2GPTA 5FHRA 5EZ6B 1GQRA 4RIIA 1WOYA 2J3EA 4C0JA 3HRIA 2Y27A 2ZI3A 4ZVNA 1ENOA 3SQDA 4YUYA 4MUIA 4YMWA 1KSFX 2VDRB 3FYCA 5FUWA 3CC4P 1G42A 2FFRA 1IQ0A 4LHWA 4X64B 5JAOA 4FWTA 3FMFA 4RESA 1X7YB 2BGIA 2GFQA 1P19A 4XJTA 5AYVA 4OP2A 4DR5B 1G66A 1J0XO 2KR5A 1TJNA 2MSKA 4PAWA 4NX2A 5EWMB 1SUFA 5J4YA 3ZDBA 4GMFA 2V65A 2YHSA 5C52B 4ROSA 5DWQA 5DM60 3TB4A 2QE6A 1OBFO 3HO1A 1C9NA 4WK2B 2QE7A 3OICA 1GU7A 1JKJB 4OPMA 3VDMA 3SNKA 4OHOA 2BUAA 4I50B 3DUFB 5EJ5A 1E3WB 4X63A 2A78A 3ZDXB 5HA5A 5EZSA 1XMQB 2VOJA 3TQFA 2DBYA 1FVXA 3MJVA 2G1KA 3RIYA 4G97A 3PD1A 4NU0A 1OWPA 4YY3B 1R6TA 1U6JA 2EDAA 1AK1A 2CUNA 3P0RA 1RXIA 2P67A 3BJEA 4HPXB 1KP9A 4AKEA 4ENUA 4H3HB 3MMSA 1EWQA 2OWEA 2ZYSA 3JR3A 3M8KA 1XRLA 4MW5A 3ESBA 4UNQA 1CUSA 3I6IA 1EHYA 3JQ6A 2Q21A 3BG5A 3I05A 3T4PA 4FD3A 1VOTA 3EVTA 3I6QA 4XRQA 1BE8A 5CB4B 5F33A 1GCGA 2PR7A 4HH0A 3LBHA 3C4VA 3IS3A 4XUEA 3LCRA 4XVUA 3NVDA 2CK3A 3EG9B 5H3LA 1B1AA 5TMEA 4GWGA 3IERA 4PX2A 1G21B 2FPRA 4QDXA 4E5DA 4UEQA 3MMXA 1WJGA 4BXOB 3GVCA 1Q95A 3VAZA 1V2HE 2GF2A 1GDDA 1QGED 1A8QA 3GD5A 4IWYA 3ENQA 1Y1RA 1ZIOA 5B4VA 2FPXA 3K70C 4BE4A 1WBBA 4B8ZA 2JFVA 3CCBA 3GJ7A 4H59A 1Q20A 4ND8B 5EIOA 2FAXA 2GFIA 2ZOSA 3ZS9A 4A5OA 4QTTB 1M8GA 2OORA 1E1MA 3CCFA 2J9GA 3T95A 1X92A 3LQQA 3ETGA 5CW2A 1NLYA 4JODA 1A9RA 4Q1AA 5DWVA 6CHYA 1CEXA 1OFGA 1XDWA 1MHPA 3ITNA 5CEEA 3AVTA 3SOZA 1QQBA 1G5RA 1BHJA 2ID7A 3CJTA