2FQ1A

Crystal structure of the two-domain non-ribosomal peptide synthetase entb containing isochorismate lyase and aryl-carrier protein domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
KLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the EntB multidomain nonribosomal peptide synthetase and functional analysis of its interaction with the EntE adenylation domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Isochorismatase
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq1A02
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2fq1A01
3KL2A 5KP7B 4IZ6A 2KWLA 2CNRA 2EHTA 2CG5B 3EEFA 3UAOA 2L22A 1X3OA 2N6YA 4H2WC 4BPGA 2KOQA 2JU1A 2KW2A 2QNWA 2DNWA 1YACA 2LPKA 2L0QA 2MVVA 4BPFA 1IM5A 2LOLA 3NY7B 2KOOA 3HB7A 4H2XC 2A67A 2LTEA 5EJDA 4WGFA 2N98A 1L0HA 4HKGA 4NEOA 2FVAA 2KG8A 3EJDA 1XN4A 4R0MA 4WH0A 2K0YA 2JQ4A 2WT9A 1HQBA 3O92A 2FAEA 2GDXA 3LQYA 2WTAA 2K94A 2ROQA 3RG2A 2LL8A 3MCWA 2VSQA 3R77A 2N50A 1L0IA 3CE7A 2MR8A 2KG6A 2K93A 2JU2A 2AFDA 2KGAA 2H0RA 3OT4A 2L9FA 4MRTC 2X2BA 2B34A 3GZLA 3R2JA 2FQ0A 2CQ8A 3O93A 2EHSA 4BPHA 2MD9A 3TXYA 2CGQA 5HVCA 2GDWA 3LMOA 1DV5A 1HY8A 2XZ1C 2N6ZA 2KORA 2KR5A 2PNGA 4H2YC 2FHSC 1X9GA 5KP8B 1YZVA 2MR7A 2JGPA 3PL1A 2MY5A 1VKUA 1ACPA 2LMLA 3O91A 4L07A 2FVEA 2AFEA 1J2RA 2MVUA 4CA3A 2KGCA 4H17A 5KP6B 2MF4A 3TG2A 2XZ0D 4PXHB 3EJEA 3O90A 2KOSA 4DG9A 1T8KA 2LIWA 1AF8A 2KGDA 2K92A 1DNYA 1OR5A 2M5RA 3TB4A 2KGEA 1ILWA 2N5IA 2LIUA 2FVFA 1KLPA 2FQ1A 1NF8A 1NBAA 3IRVA 2FADA 5HV8A 3HU5A 3S2SA 2KG9A 2FACA 1NQ4A 4PWVB 2AF8A 3O94A 2KOPA 3V8EA 2L4BA 2K2QA 2AVAA 2LKIA 2GDYA 5CZDB 2K0XA 1F80D 2N5HA 1NF9A 3OQPA 2FQ2A 3EJBA 4L08A 3GZMA
chains in the Genus database with same CATH superfamily
4R40A 3FMIA 3SG0A 4JN6B 5FOUA 1Q0HA 1P2GA 2AGVA 1J9ZA 3KYCB 3PB3A 4MLZA 2X5JO 1C7RA 3N5CA 4NBKA 2WJAA 1SZDA 2OO5C 3W6OA 2PGDA 1Z6YA 2VWHA 3MF4A 4JI0B 4JYMA 1GTRA 2IUFA 3CEAA 3L5KA 3GLHA 3L7NA 4XJXA 4LYGA 4EKYA 3QTLA 2GILA 5KC9A 1I4LD 3THYB 3T3HA 4DPKA 1RM4A 2VLOA 1L1QA 4RIEA 5KSOA 4GGOA 3UK2A 1NA5A 4FFRA 6Q21A 2FXIA 2B1IA 4EM6A 2IKSA 3CZPA 1VPLA 4MPJA 3R8FA 3M6MD 1ZD1A 2I4RA 4LECA 2FEMA 5KYUB 3AJ8A 1JFSA 3V1LA 1PZMA 1SEVA 2Q2QA 3Q9UA 4DCUA 2GAFA 1GZ4A 1A9QA 5JHHB 3Q7IA 4DR5B 4S2UA 1CUCA 1TW3A 4IH9A 3TRJA 3VNSA 1CJBA 3AHHA 4C7VA 2CB0A 5JOQA 2YHAA 4ALMA 1VHDA 4BQSA 1JNXX 5ENVA 3RLFA 2YIDA 2FX5A 1WKCA 3ZCQA 4CL2A 1CF4A 2WIGA 1QNLA 1W75A 1OPRA 5SZKB 4EJSC 4EECA 2ZQZA 4N65A 4MR7A 2JBHA 2LL8A 5F4ZA 3ZHTA 3WR5A 3ZWXA 1NJ8A 3C87A 3OMLA 1TYDE 2V9CA 5KOHB 1RKQA 3A37A 1YV9A 1R4NA 2AFDA 1RJEA 3F46A 1MPTA 2MOKA 2QX7A 3PNMA 1LFDB 1SWWA 5HJ5A 2WHQA 2PH5A 1SCAA 5JXHA 1NJ2A 1GG8A 3TLAA 3GFGA 5DM70 3DKPA 5ADUS 4C6TB 3T52A 2A92A 4PPQA 2CXNA 4PNPA 1N1DA 4RHTA 4Z4EA 5GGXA 2DH5A 2FTKE 4CU2A 5KTOA 4PYNA 2PT7A 1UQRA 3KD3A 1L8OA 4OXKA 4RVUA 3VR0A 1PCXA 4EJ2A 4LHXA 3IUNA 1GGVA 1PJ2A 5K0FA 1KWGA 1X74A 2I71A 2ZYRA 3KD2A 3Q12A 1N7JA 1E4YA 2CFCA 5HIJA 1GRRA 4P83A 4IXDA 1ZNQO 1JHDA 2Q5HA 2GN8A 5BW4A 4F1JA 1FYDA 2OA0A 3EXIA 3LGSA 2JKVA 5J2UA 3VC1A 4OJKA 2YTZA 4J6EA 1ZFNA 1E2QA 2FUKA 1U7PA 3JD4A 1HDOA 3MS2A 3R44A 4CHGA 1PZFA 2QLJA 1J56A 3HJGA 3IQIX 1RJ9A 4CYMA 3BCHA 5ELLA 4M8LA 4PG5A 3U80A 3CCVP 3AG6A 2ZXEA 3MXOA 2F62A 2EKQA 4UZSA 1BFUA 1NUTA 1TVEA 1MW8X 3HN2A 4PAWA 1V4VA 4GECA 3ENWA 4IJMA 1OAAA 1B3RA 3U60B 5DNCA 3EMVA 1CUZA 2OHXA 3ENNA 1E94E 4CG0A 1VMDA 1KMHA 1T2EA 3NORA 4JX9A 5CIYA 1G1AA 1DADA 2I6TA 3GJ5A 4BASA 2HW8A 2Y0PA 3NBMA 4I4TB 1U4OA 3IAFA 2VTBB 1I2ZA 1TECE 2JIBA 3D4PA 3M33A 3RSSA 4MUJA 1Q0PA 2FUEA 4HPJB 5KOYA 4TSFA 3C8HA 2RGRA 2ZVJA 3F8SA 4E3WA 3I01M 4M3NA 4FD3A 4R2XA 4BZPA 3ZX4A 2RSLA 5BV2P 3BTSA 3UH1A 4JLJA 3VO8A 5LWHA 1IVSA 1YVUA 5T4EA 2OXIA 2O3UA 1RXCA 1UIRA 2OXTA 4L3WA 1R7RA 2JFVA 4DMUB 1HFEL 3DR5A 3OIGA 4DLXA 5HCIA 2L0QA 1CNFA 1DBIA 2ATEA 3IYLW 2PUCA 1DUSA 1D7OA 1V11A 5KNBD 2ZVPX 2XCSB 2IHKA 3AESB 4XGNA 4RO0A 4B79A 1OD6A 1ORVA 2P9HA 1RQXA 2GARA 2UKDA 2FN7A 4L6CA 3L82B 3QA9A 4BP8A 4CM9D 3G5MA 1XL0A 2ACKA 2PEIA 1OFIA 2YV3A 3FRIA 2XB9A 2G82A 3AINA 3FPKA 1FQWA 3ER9A 2VL7A 3OHSX 2QTWB 3KWMA 4B6JA 3H1GA 4Y2HA 2H17A 2LR0A 5BSWA 3CF6R 4OSEA 1F6WA 3JQ8B 4ZOBA 4GXRA 4YYZA 3CCSP 2GCPA 2ZYGA 4BNUA 3UPTA 4GQIA 3HCPA 4FE7A 3EZ2A 4WLFA 2NO8A 3N07A 3KHKA 1QMGA 3H9UA 2Z09A 4OKIA 4YAUA 2SBTA 3BZBA 3INYA 3LFUA 3SZ3A 2OTLP 2ESRA 4L50A 5M29A 1EAYA 5G0VA 4Z0PA 1SCKA 3CUUA 1YR6A 4GP9A 3WIVA 1X1CA 3ISJA 2H1FA 2ID4A 2VYND 3OLCX 4DSUA 2XXAA 4OU5A 3TRFA 4BB9A 2CC2A 1MO4A 4TRRA 4XVCA 2MYPA 1JEOA 4ARVA 4DLAA 4UOEA 1TPYA 3Q7EA 2WEKA 4FU0A 3BWMA 1X15A 4JFRA 4HQOA 3N8HA 5FUWA 1RBZA 1JF8A 3O1IC 3G7UA 3OVMA 4M22A 3OTOB 1N6NA 2ECOA 3U3MA 3B1JA 2GBCA 4WE3A 4X6LA 3I62A 2V59A 1BRMA 3JQAA 5ELXA 4R1LA 1JNYA 2XUOA 2ZTUA 4D80A 1H6CA 3LCCA 4EW2A 1R3DA 2QRPA 1KE1A 3GXBA 3TUIC 4YCMA 2WWRA 2EDCA 4L3OA 3UVEA 1VL8A 3TNDA 1DG9A 1LLDA 1FMCA 1KERA 3BDAA 2HHHB 4BFVA 3FWKA 3WZMA 3WJAA 2XDWA 4MCHA 4HEQA 1WAMA 1YR8A 1SC1A 2CDAA 2N1MA 3EHEA 3N3AC 4HNSA 1MX5A 3WKCA 4JEIA 3I09A 1ZN2A 4D9HA 4BGDA 4O63O 3TG2A 1WWKA 3I72A 2XCTB 4UZEA 4X84A 3K8ZA 3NQ41 1SUWA 3KOOA 2EKPA 2BUOA 2GZJA 3QFHA 2QORA 4KTTE 4EYSA 5BUZA 1U0TA 4BO0A 4I4TA 2IEBA 4PPYA 3JQ7B 4KV7A 4QFBA 2GN0A 2DH6A 1ONBA 4DRYA 1TTHA 2I6QA 5DNDA 4EG5A 1T5DX 2CDBA 2XOKA 4MAMA 1AU9A 2ISSD 4ZOQI 2PENA 3HZOA 5LP6F 1ONNA 1TDJA 5JRZA 2QVLA 2JPDA 1SBTA 3IA2A 4EG6A 1B16A 4IZIA 4B44A 2QIPA 4G81A 5FOXA 3L6EA 4Q3KA 2CNLA 5KJ1A 1F2UA 1HTBA 1M67A 1V43A 2V7VA 2YJNA 1L4GA 2A5YB 4P22A 3VYRB 2YZMA 4EZEA 1IZ8A 4NCAA 1SCBA 4EPTA 4JGIA 4AJHA 2G28A 1D0IA 2QTHA 4KQEA 5ALZA 1X8XA 2HWWA 2NZVG 4CIXA 2RG7A 1YBFA 2XGSA 2XQFA 4Y2YA 4F6CA 3MMXA 4LTDA 4QVGA 4H0NA 2PRJA 2PZFA 4XEUA 5IC6A 3ZWKA 1F6DA 1PYGA 2R8PA 5CB4B 3OZWA 1N2BA 1JBKA 5I8ZA 1BKYA 2H9AA 1A5TA 1A95A 3A26A 2XMDA 4S12A 5CG2A 4YP7A 4OHYA 1P7VA 1XMIA 4D9JA 1C0IA 1JHAA 1OFHA 5IHPA 4D26A 4HAIA 2IU0A 3PFCA 4V0LA 3G0DA 3OEED 3V4LA 1ZH6A 1CHNA 4Z4HA 3B70A 5IYZB 3P9ZA 5EPEA 4CQMB 1QAQA 3V6MA 3N2KB 2BFNA 1JXQA 4N0EA 4EKIA 1TTTA 4I1VA 4DPLA 4JDUA 2R8OA 4KP7A 5EUQB 4KR9A 4DNXA 4RIGA 3FMOB 4PG7A 1Z6GA 4AZ3B 2DFKB 1OSNA 2ZIAA 1NIPA 4R2HA 5HZKA 3P0RA 1LV8A 1LXCA 1W0CA 1Z5NA 5D5QA 2DR2A 5HK8A 3VC3A 4BIIA 3VR3A 3C3MA 1PT5A 3S29A 1ZPDA 2H18A 4KYUA 4BO9A 2NXEA 4K3UA 4QYIA 5AJXA 1DMRA 3U5TA 1TUEA 4HH4A 2X8AA 3BQMB 1I8TA 3DTNA 5IKXA 4OQMA 3GZLA 3UC5A 1I3NA 5BQXA 3RC2A 4H31A 2ZTSA 2GS9A 4EQ6B 3QLUA 2HH9A 1CUAA 4P36A 3EIXA 5JMOA 2HU7A 3HNOA 2ANCA 1ECCA 1UFKA 1Z38A 4FFLA 4X20B 5HFJA 2YVUA 4EX7A 3F6CA 1G4HA 1KDRA 4RK1A 3SZLA 5FHRA 4RU1A 5KNCH 2PRSA 4KR0A 1CDZA 1ODKA 3DD1A 1YDWA 4YMVA 5TR9A 2AJLI 3EZYA 3ZIDA 2N47A 4PVDA 1U2GA 1NLUA 1VBNA 2XMSA 1Y48E 1Z6QA 3IULA 4Q1FA 3E9YA 3KCQA 3ZHBA 4D3SA 1XMOB 3IAXA 4KLZA 3TO5A 3EOBI 3MJVA 3LCVB 4RD0A 1OWNA 2I2WA 4Y2QA 2GXAA 1RI2A 2H51A 3PL5A 2C20A 4TUYF 2XWJI 4Z0TA 2R6HA 1KZ1A 4IDDA 2BIFA 5E1OA 4UQLA 1J7JA 5E7JA 1QUFA 2CFRA 4HATA 4H18A 2KGEA 2MSLA 3VU1A 3BIJA 1L9KA 1MAHA 5G0WA 1PRYA 3KNZA 4LY9A 1WV0A 3AY3A 2GEJA 4IUYA 4OD0A 2CSUA 3E22B 3DWFA 1JR3E 4FFWA 2ZRIA 3DBLA 1MN6A 1P1HA 5DNYB 3NU1A 2NUTA 2BUBA 4DIDA 4OHKA 1IBSA 4PIVA 2QV0A 2KOPA 3TMYA 1AKRA 4BAZA 3D1VA 2QENA 3MS4A 1ORWA 4CU5A 3KKLA 3RSCA 4CZ2A 4JQCA 5J4YA 1XDGA 2WJZB 1QAMA 4WVLA 1L6IA 2YR0A 3V2GA 1BROA 3CUTA 2PH7A 2QDXA 4IQ0A 5L4SA 4QKOA 3SFTA 4HAXA 1QB7A 2HPHA 4B3GA 3DDWA 3EH1A 1IIRA 1V1MB 1RIFA 1AZWA 4BXOA 4Z6KA 1P6UA 4LJ8A 3LX6A 1CLEA 5K4GA 1ZG3A 4YLYA 1U98A 1NY5A 4FI3C 3V9PA 5GZ6A 5HMLA 1KYIA 3ANMA 4ALLA 2D5BA 1DJQA 1V8OA 2F8SA 3I01A 1CY7A 2NLOA 4L1KA 4GLLA 2IS6A 1E1LA 1MIOA 1HORA 1KMCA 2J45A 4HL6A 2BY4A 2ZM5A 1Z5OA 2JFNA 5HZMA 2CWWA 3H84A 5FI3A 2GJ8A 3FLMA 2HT6A 1GUYA 3KALA 5CJ2A 4OHWA 2WJHA 1MH9A 5JC8A 4OQPA 1HEUA 2DPLA 2I2AA 4HZUA 3I9OA 4CL0A 1X8LA 1AO3A 4MMZB 5JD5A 1KI8A 1ECPA 5F21A 1C81A 1Z4QA 4MO9A 1KQ3A 3L0YA 4QBKA 4OG2A 2RGWA 4DJTA 4M9QA 3GA0A 1SOUA 4MIYA 4GI2A 1OYYA 3PD7A 2HSZA 2YXLA 3QRWA 4Y9DA 3WSTA 4G8DA 1L5LA 3E7WA 3H2JA 3FDXA 4F85A 4JBLA 4W9RA 5KOJA 4IWYA 3PHHA 2Q8QA 3BXEA 1UT8A 2C2MA 2W4QA 3KVYA 1QHYA 4JUCA 1NSFA 4HDSB 2VAMA 4QDKA 2FDXA 4N3NA 2ATCA 2Q29A 5A7HA 3FAZA 4RFSA 4UCQA 5EAIA 1TO6A 2F1JA 1YB7A 4FONA 1IUNA 3CC7P 1ZMXA 2AXQA 2ZTLA 1DQPA 4KQWA 1FZQA 4QDZA 5EJ4A 1N7HA 4C9BA 4CL8A 3FVVA 3JQGA 4YAOA 4J07A 1KU6A 3VBCA 3DOEA 5P21A 2CD7A 1JPVA 2DJ5A 4URYR 1ZN7A 1T0HB 2WD9A 2ZB4A 4G89A 4B3MB 5DPMA 5JCJD 1E0SA 2L2QA 4IV5A 2ENUA 3QZUA 2O7SA 4INZA 4DIUA 1V3QE 1WOMA 4E12A 4PZCA 3P9IA 3WWEA 4M0KA 1Q0UA 4Z86A 5HFAA 4M99A 1GN9A 1P91A 2VPYA 2Y05A 4BLQA 1SHUX 2CJYA 3LXMA 2C7OA 1T8KA 2B36A 2UAGA 4BJ3A 3ND7A 2YIVX 3W4KA 4NPAA 3EVZA 3PE6A 3H5IA 3R5TA 1BWSA 1FNNA 2GZMA 4WK4B 1N5KA 4DSTA 1V95A 3U19A 3VNAA 3D0KA 2D0OB 1O4WA 3TOVA 3KOMA 4MVJM 3VVBA 3QVJA 4HNGA 1PUJA 2LXNA 1T2UA 5BN5B 3AEKA 3TIFA 4MI6A 1CRQA 1PQYA 1EGMB 1P62B 2BGIA 1WBJB 1LS1A 3OLQA 5FBQB 3S2SA 2WP0A 3OIDA 2JJQA 4BQNA 3EEYA 1BVHA 1XK7A 4XB1A 2F17A 4ZEWA 1TA4A 4FOLA 4YASA 5BRAA 5JATA 1Y1RA 5IJAA 1SZJG 2DQKA 4O59O 2E89A 1X39A 4DCSA 4YT4A 4DMKA 2P4EA 5CVUA 4LEIA 1KH3A 3ND6A 3VTAA 2BFAA 4KYVA 4TV8B 1R4MA 1QYDA 4X9XA 3C3XA 4YJGB 3U0BA 2MU1A 4QU9A 5CT9A 2I2BA 4BO1A 3CB4A 5FWDA 3SSOA 3G9QA 1GT6A 2I4IA 2VLIA 4XGRA 1ZXBA 2FI1A 5LD2B 3BFXA 1HE8B 3GLHE 3P1JA 3B20A 4OUKX 1NURA 3SOPA 3EFEA 4Y1RA 3O2QB 1EGAA 3R5SA 4JC4A 4Z9AA 4TQUS 3OOJA 2C3UA 1S2IA 3AF4A 3RUIA 4CLDA 4A0HA 4PC1A 1Q2UA 1V7ZA 5JY1A 4QJ4A 4LK2A 2DHCA 2NUPA 3I8OA 4BCCA 3UXEA 1Q91A 1PT8A 2PZ8A 3DUFA 3KXLA 4ND2A 5FPSA 2LOLA 3PUWA 4HXYA 3VHLB 3JQFA 1H1LB 2AF3C 4D56A 1EEXB 1X1DA 1E1MA 4OQYA 2ILTA 2G1KA 2X8JB 1OHHA 2Y99A 4F8YA 3UJ8A 1A97A 1DQNA 1PVVA 2OLKA 5TC4A 3T0GA 3ZEAA 3GUUA 4ZO6A 2ZI3A 1BWRA 4M0LA 3BMNA 3UOWA 3QPAA 4JC5A 4EDFA 4UVDA 3L9XA 3DPHA 5T57A 2W22A 4NFHA 3MFQA 3FCYA 4EG7A 3T1QA 1UBSB 1D1QA 3BWCA 1H65A 1TJPB 4KXXA 4LOAA 3HWX1 1AUOA 4CQMD 5TVGA 4BMPB 1QFYA 4JIMA 4O29A 5DK4A 1ZY2A 3RG2A 1T43A 3R0VA 4MV5A 2CF5A 3KYCA 3R3JA 1Y3BE 2D2IA 3AERB 3ENKA 4ZI2A 5A0VA 5LXTA 2CXUA 1AS0A 1YF3A 3ZJ4A 4Q9AA 1KS9A 1L4HA 3O8NA 5CT8A 1I30A 3OZFA 7ADHA 5CU7A 1DX6A 3R0IA 4WRRA 1X1RA 4GNKA 3RBXA 4BMOB 1UBHS 1FNSA 4ZI7B 3TD9A 4B3BA 4P32A 4F9TA 4PTYA 5KZMB 4AULA 2HTEA 3J7AC 2ADMA 4XI9A 1OH6A 2Z6QA 2AN1A 3HDQA 1FFXA 3ZDDA 4BPHA 3E3NA 1M34E 3DLPX 3PHJA 2V3WA 2EW1A 3GRZA 4X3PA 2G71A 4ZODA 1FS6A 1E5XA 2CYBA 4KXMA 1XCPA 1YR1A 2BKVA 3OUZA 2F55A 1E6KA 1XZ8A 4QXOA 1QP8A 1KZ6A 1VBKA 5DGIA 4HMOA 3E61A 4CKXA 1UDRA 1TZCA 3NHWA 5FEUA 2PUBA 2P75A 3I9KA 3VPBA 1FYXA 1JA1A 3AB7A 3LP6A 3OJOA 3VRHA 3R41A 3WA7A 2BGKA 3NYQA 1MFZA 4NBRA 3GNTA 2LKCA 5DX8A 4KR3A 4FBMA 1FXWA 1TC1A 2V6IA 3R7BA 2DQ4A 4JSRA 5EE9A 3KQVA 5EIXA 4MVJI 4F45A 2KLHA 1ZVQA 1XN1A 3T9FA 1ZIPA 5KS2A 5GADl 3I1JA 4E94A 3F0TA 1SELA 3R9IA 4DWVA 3IVRA 2Y9PB 1RWKA 2P2GA 1GOTA 1V41E 2IDMA 5KC8A 3VVMA 4LNHA 3ONDA 1W4RA 2DR3A 2VTDA 3NH6A 1RHRA 3AJEA 3V48A 3AIOA 2YY7A 1E3SA 3DTYA 2D2FA 4GM0A 4PAGA 1Y6ZA 1Q7EA 4LF5B 3G3EA 3CLVA 3HJTA 3PNLA 4JHLA 4HZGA 3VM6A 4W7IA 4NCKA 1CUWA 5CX1B 1RFGE 2I78A 2R751 1IMQA 4WL0A 2FZGA 5JH7A 5AUPB 1I2MA 1XMQB 1NLZA 1MZVA 2Z43A 1VQLP 5JNWA 1HYEA 3HXMA 4JJGA 3C3JA 4DJ5X 5EP3A 4YY3B 1ESMA 1F4PA 3DS3A 1UT6A 5MN4A 2GR9A 5C7LO 2HO4A 4FMDB 3MTBA 1ZINA 3FPFA 4MW2A 1U9IC 3I6YA 2JEZA 1KZHA 2ZRBA 4E2FA 5FIUA 3AKYA 3ZV5A 3CIFA 3ITEA 1KYTA 5I3CA 1U0RA 3U39A 2OXFA 3MCAA 1KQPA 2JGDB 4U0BA 2H5JA 2Q6VA 4QG3A 2NM0A 1Y8ZA 4D9BA 4LI3X 5JDCC 3KZVA 3QPCA 2JEYA 5IUJC 2Z46A 5CK5A 4YT5A 4UEOA 2H1WA 4MJ7A 2V7PA 4REMA 2Q3FA 3CVWA 3GLIA 3LLUA 4HWTA 2N98A 1YZLA 2EKZA 1XZGA 2DT5A 3Q3VA 5FNVA 4AL4A 2JZNA 4J0HA 4FHDA 4X00A 5FTWA 4B0PA 2E49A 2GO1A 3AF6A 1PJQA 4Y1FA 2VBGA 3THXB 4NJEA 1P9RA 2XCUA 1KFBB 2X2OA 4UHBA 2PZLA 3QWHA 2ZB7A 4CMIA 1RXVA 3OLZA 4NEGA 5ICGA 1SBZA 5IZCA 5JWOA 1JDZA 3L6CA 2R8EA 1FFYA 5J1SB 4Q3BA 5DYIA 2CL7X 4F9FA 3N2LA 2V96A 1JW9B 4RQTA 4W5WA 3OFJA 2J6HA 1OXUA 3W3AD 3UJ3X 3PXXA 4KXFB 4EW1A 3GZTB 1XHLA 2G9NA 2MYNA 2IXBA 2WAAA 1QIHA 2ODQA 1ZNXA 3BXZA 3QU5A 4HFNA 4QPNA 2X7HA 5TQ2B 3B9QA 4PRLA 4Q12A 5AI9A 2VHEA 4PC7A 2IPLA 4QARA 4UW9A 5I4KA 2PPVA 2X1MA 4B8YA 2YUIA 1AZLA 1WR8A 3GRAA 2NN3C 4KWCA 2JLAA 3ZWWA 1MW9X 4ENQA 2OORA 4MIKA 1MAUA 4JLKA 4M7PA 2Q8PA 4OLAA 4DWJA 3LMOA 3WGQA 2HREA 2AUMA 3JQQA 3H0EA 1A9TA 1R5NA 2GF0A 4RADA 3ZH9B 3B1YA 5CVJA 1MZPA 2AC4A 4RVNA 3N86A 3TZEA 3E9MA 1Y5NA 2I6XA 2HFJA 2LTAA 4H4EA 1PSWA 2VJYA 3QQ5A 1E58A 4JJ8A 4ZVOA 1HE2A 2W4IA 4KRXA 5E9QA 4YA6A 1BZYA 3CTMA 3RTGA 1L1EA 1EX7A 1V3TA 5G4KB 4O0MA 5ARBA 1VP9A 5HGOA 3KO8A 1JIUA 1G18A 5EJ8A 1XRNA 2VJKA 2GK3A 4LC0A 4NNPA 3NP7A 5BN1A 5DBHX 4CFYA 2IH4A 3RRJA 4QLOA 5K0ZA 5A5FA 2XZOA 4XFKA 1DNPA 4PGGA 3T1HB 3CCRP 3ROQA 2LF4A 1HI9A 2I33A 4NYMQ 3IP7A 5CXXA 2AQKA 1DKMA 1OXXK 4L8LA 5K3EA 2JFHA 1YB1A 2Y0DA 1KLPA 3FFXA 3PRKE 4QDXA 2B61A 4QSHA 3GJ6A 1JKIA 5JEDA 3FVTA 3FHLA 4MDYA 4PCAA 3FETA 2O19A 4KK4A 2GD6A 4W4TA 5BW6B 1E2PA 3KAPA 3NANA 4NTZA 4MS4B 5ALNA 1XZPA 1Q16A 4B3IA 1IN6A 1XB2A 4WMLA 4KFRA 3GT4A 2NACA 3B5EA 2ODEA 2R00C 1T3TA 4X65B 4ABTA 3L79A 1C1XB 3UA4A 1ZWKA 3AI7A 2O20A 1M10A 1DIOB 2AN4A 2IC5A 3EC2A 3N7UA 4QXMA 4RV5A 4XRRA 3RNOA 3TZCA 4AJNA 4AMVA 5DCWA 4LJRA 2QK4A 3EG9A 1ZCZA 3IOYA 3R6LA 1RABA 4ZMRA 4Z1OA 2OBXA 5CUQA 2EHTA 2HQOA 3GLKA 1BXZA 2IE8A 1YTUA 2PGXA 1E89A 3U7GA 4GP6A 1NATA 5D6OA 3MB5A 1E64A 4L7VA 2JIMA 4DC9A 3B7WA 4OHVA 5HTKA 4EKGA 3ZWNA 1IN1A 2B2NA 1G42A 4NMLA 1C4KA 2ERXA 2WV9A 2C5FA 4PS0A 4GZMA 1M1KQ 1M8FA 1NC1A 3PDHA 4PLGA 2P6MA 2QTAA 4S1NA 4WFKA 1TEHA 4CGZA 3UC9A 5DNUA 2ZB8A 3ZLVA 1BRTA 4NYIQ 3EQZA 2OAP1 4AAYA 3FOZA 4WNAB 4EEZA 2LVBA 2AMYA 3LHIA 5EWMB 5FEMA 3U7HB 5IKMA 2OCPA 3IILA 4HAWA 3DKRA 3T0IA 2DG2A 5C1OA 4U1RA 2RAVA 3Q5EA 4MINA 1KWKA 1UDCA 2OO7A 2GDXA 2WSSA 1J8QA 4JBGA 4KVFA 5DLDA 4HAUA 2XZDA 1VJCA 4D9FA 1O6FA 1KD1Q 1ZJJA 3SJAA 2A0KA 3H2IA 3SKVA 4EA8A 1J8FA 1HZZC 4CMCA 1VE1A 4RTQA 5DV9A 2FZKA 1LV7A 3RWOA 4CR7A 1ZJWA 4BFCA 4RFLA 4B34A 2PE5A 1KA9H 4HAZA 4IW3B 4KQ2A 3RVQA 4DYDA 3L0SA 1F20A 3CVOA 3IUJA 4U7FA 3JRWA 3ZKWB 5EQFA 3ZHVA 1T29A 1L4FA 1M75A 3PUIA 4RLSA 4XRGA 2R0QC 1ABFA 2B0JA 2VNSA 1DIRA 5GIPE 3MSCA 4IIJB 5WRFA 1FZTA 4CMKA 4C06A 1IATA 2YX1A 5HE8A 3RRYA 2FY8A 1PNTA 5MN5A 2F1KA 4PR3A 2WU8A 3DTVA 5EIBD 2O07A 4CBVA 5JCXA 3HCCA 2P2NA 2IYNA 1ORHA 3V34A 2V9ZA 4LQ4A 2AN5A 3QX7A 2H59A 1X7WB 1NNLA 3UBMA 1Y3HA 1L5RA 3VO2A 2AK2A 4C3OB 3H2GA 4RY0A 3AU8A 1GU0A 1PQ4A 1E1RA 3Q5GA 2YC4C 4U5XA 4B7UA 4S0ZA 4LVCA 2P41A 3EW9A 1I0ZA 1VRCA 3LA8A 5LU8A 4ZKEA 3CC2P 1U3DA 4TQAA 3C7DB 2XWSA 2XWQA 5F52A 4CHTA 2M6LA 1GADO 3JD0A 4AJ4A 7AT1A 5GVRA 2YZKA 5K0LA 3VPXA 3GIWA 5AD1A 2YNMD 5IT5A 2PJRA 3ESBA 4LWZA 3BRWA 4F91B 3HA5A 2O8FA 1K3TA 1J49A 4AYWA 1Q0SA 2R1VA 1G8AA 2AJBA 4C21A 4NX2A 1TF5A 1FUYB 4AM8A 1UZNA 4HH0A 3K1YA 4DRXB 4X3OA 2XXAB 4L3VA 3PVSA 3AR4A 2GDYA 4FZRA 3DBRB 4IUBS 4RH3A 3A2LA 4Z9YA 3BREA 4BX3A 4HVCA 1M7GA 4HBZA 2MSKA 3FMPB 4ARUA 3CZ4A 1O96B 3E9NA 4A0QA 1JSXA 8GPBA 4X1IB 1CQIA 1O9GA 3C6YA 3HCDA 4K9OA 1RLTA 3OC6A 4RTJA 1CU1A 1L7VC 2B7LA 4EX6A 3GGSA 5HDQA 4CPDA 5HKAA 2HR1A 2FP3A 1KH1A 1L4UA 3GFQA 3IP3A 3KLNA 3MT0A 4OK3A 3QEJA 3UNXA 2XODA 4COOA 5CFMA 3RVPA 3NWOA 1ITZA 3MCVA 1TVKB 1H4SA 1A04A 4D9EA 2NSJA 1FMTA 5B3LA 2KW2A 4YVFA 1UH5A 4AC9A 5BSMA 4EG0A 1QO7A 4EIWA 1T0UA 1I1HA 3CR8A 4AG3A 3A05A 4BEJA 1OIXA 4WZBB 4MA4A 1PGNA 2QU8A 2E4YA 2HNAA 4A5SA 2C42A 1LZKA 3AV0B 1MTOA 3M6FA 1R9GA 1O08A 3E22A 4NBNA 3LF1A 3R5KA 3BXPA 4PXYA 3M34A 1S6YA 3QELA 3DL2A 4UM7A 4AJKA 1H3FA 1NUHA 1QDLB 3FNRA 2PBRA 3KWLA 4KQFA 1GTVA 1Q1NA 5KOHA 1UJCA 3AEXA 2FPSA 2PVPA 2W6IA 2HQBA 2OZLB 3KEGA 4MP3A 4DB2A 3HU1A 2OCYC 2A4KA 1A88A 1GSIA 2HQ1A 2WZDA 3KKNA 1NM5A 4HDMA 1E2BA 4Z5XA 3I83A 3T1NA 1GZ3A 3OO1A 4RY2A 4FKBA 4GDMA 1FFGA 2X9LA 2IOQA 4R16A 2QUHA 4HLQB 1YHZA 4HNRA 2GQ0A 5GJWC 4BMSA 1QVWA 4X44A 2V4UA 2NAPA 2RKBA 2B2XA 1W4AA 2HTFA 4GRIA 3R9KA 4MPDA 4TZTA 2A9JA 3L1IA 4A2CA 2XPCA 3P20A 3R4CA 4E15A 1U5AA 2G83A 2LDXA 3NIGB 4H1UA 4YJ3F 3H2BA 3K09A 4YO8A 5BNZA 1Z7YA 1UJBA 1HKUA 3UMCA 1YD7A 4ER3A 5JV5A 4GMXA 2FSSA 3D4LA 1KYWA 2ZWPA 2WHEA 3NS7A 2JGRA 1L7EA 5IT9A 1E1NA 4TYWA 1H0RA 3INNA 3IQEA 1T6BY 4FCCA 4TGLA 3U49A 3TVYA 5CGZA 2NYVA 1NP6A 1XQVA 1KR2A 1V1RB 2PBZA 4DY4A 4LI0A 4REQB 3EXFA 5JD3A 2ORWA 4D5EA 5K6RA 1OZAA 4PYQA 3TLZA 2ZVDA 2W42A 2HKIA 2HCFA 5B3JA 3I6MA 4M6WA 4CCYA 1NZDA 3M2TA 3QVVA 2E1MA 5DM60 1JQAA 3NKFA 5F7ZA 4XQGA 2J4FA 2MSWA 1MRSA 2AKYA 3NATA 4JEUA 4U9UA 4PPNA 1YGYA 3PGXA 3W6UA 2XOEA 4A92A 4IS3A 1F1JA 1AJEA 3V4OA 4MJXA 2FPGA 4HEJA 2G9VA 4BLPA 3D0QA 1E77A 3WBBA 4B1FA 1I7LA 4FQ7A 1RRVA 1JXAA 3U48A 4R8SA 4AN4A 4CQMA 1IN5A 1BCSA 1Q0LA 1NX9A 1TUBA 4NBUA 4RWZA 3TUJC 3RM3A 2FPPA 2EERA 3BAFA 5BO5A 4DSNA 3DV9A 1QYIA 4L27A 4YIKA 4CLEA 1MAWA 4DFDA 5IX8A 1DUIA 1W6UA 2XB6A 4O4IF 2I62A 2OYRA 3V6LA 1KI9A 3ZU5A 3WMRA 1XQWA 3NYWA 4N82A 4CM7A 5I7HA 3TNJA 1DXHA 2XD4A 3U2QA 3WLQA 4KDFA 2B5WA 3PQ7A 3NUQA 2VPXA 4X7RA 5LP1A 2UXBB 1JG4A 3K32A 3QLJA 5GWXA 4N1AA 5I9LA 5I7RA 1E5VA 3CX4A 5A3SA 3TW8B 2H9IA 3NGXA 3K70C 2H92A 3H5AA 1FNBA 3HZZA 3IT1A 2E3JA 4LVNA 4OGLA 4RA6A 5HNKA 1QG6A 2P9QA 4B6SA 1PKEA 3HDJA 3MOGA 5BXYA 5K0TA 4ZQFA 4R1UA 4PM4A 5E6UB 5IH7A 3C48A 4AZ3A 2FWNA 2X77A 3V46A 2F6RA 4YJKA 3UKJA 1GITA 2EBFX 2NTYC 4I50F 4ENWA 1CS0B 4DNOA 2TECE 2MVVA 2CLFB 4N7MA 4Y7CA 1XTJA 2QQ0A 3Q6IA 4KO1S 5AIAA 3EYWA 1UBGA 2ERYA 1XHFA 3FYUC 1BVYF 4K40A 3TLMA 5BPFA 1ESNA 2AZDA 3NVDA 4GSKA 3F96A 2C2GA 4FXOA 2HMUA 1OBCA 2ZANA 3EQ2A 2F59A 4FWTA 4LFCB 2B83A 2CYCA 1SNYA 3N8KA 4M0FA 4MUBA 1V37A 4RETA 3WL5A 1MO3A 2FEOA 1L3CA 1UJZA 2IYZA 1FDTA 4FFVA 4LGCA 4PANA 1N2SA 4O2BA 1QTQA 1HQDA 4XTCS 3H5NA 2R6GA 1G9SA 3UG6A 1J07A 2V8OA 4GZLA 3UUWA 3DC2A 2B4YA 5FWYB 3P0JA 4B3DA 3CRMA 2R5NA 3VR4H 6GPBA 1HLGA 3GIDA 3M6UA 4TUYA 1F5SA 1NPYA 2P2LA 3CE7A 1V4BA 1VHTA 1DXYA 4J1NA 4N0MA 4IR7A 1R6TA 1GWNA 3TCNA 2CVQA 2Y0CA 3PT9A 3WYEA 4G5YA 5TJ9A 3EXFB 3F6BX 4GG1A 1QV7A 3NHBA 2C9YA 5F98A 4CIAA 1YRWA 2SECE 2VN8A 1SBQA 2PKWA 5EPUA 4TMYA 4ESOA 1PNVA 1S2MA 2I34A 1F8XA 1VL0A 2V7UA 3JS5A 2ZRCA 4FN5A 2HQSA 2K7ZA 3FSGA 3RANA 5JJCA 4OXIA 2VJMA 4QYSA 4X6YA 2EKBA 1X1AA 2X4LA 4GICA 3MK31 4Q4DA 4ND6A 4NOLA 5CHEA 1SCQA 3WRVA 2QA4P 1ULBA 1DEHA 2PXAA 4Q3AA 1Z8NA 1G20E 4RK5A 4HR7A 4PSVA 3I5UA 2HMYB 3HCNA 3CLKA 5HRUA 4YJHA 5AK5A 1VOTA 2W0MA 2VEOA 3RJZA 3IV6A 4RQUA 4IWNA 4EY4A 3HVUA 2P2ZA 4MXDA 5KINB 4F9GA 1U63A 2VP4A 1Z75A 4ARAA 2C99A 2JB9A 1KDVA 5TT1A 1TA9A 1VZ3A 3GXOA 4P3NA 3CNOA 2GH1A 4V0OA 5L3SA 1VKZA 2B9EA 2R7MA 3RTCA 3HS3A 4IIHA 3AUYA 5LZ9A 4ZZIA 3VOTA 4PQEA 3DQZA 4FR0A 1VQOP 1EFPB 5HJEA 4FWIB 3WL7A 3C3YA 2JBGA 1KJQA 5H0IA 1RJFA 4TWZA 1ILEA 2GZIA 3HKDA 1LJUA 1XRMA 2QX6A 2GRUA 5JRDS 6ABPA 1PL8A 1UXOA 3T38A 1ZIXA 2GNPA 1JXOA 1QS0B 4FDAA 2CXQA 1CY8A 3HN6A 5EGNA 5AVJA 2H31A 1TNDA 1EP3B 1V16A 1Q1ZA 3RSFA 3DV0A 2JANA 4A8JB 1II0A 4WFQA 4DEYA 5IC4A 1CJTC 2WI8A 4UREA 4O25A 3D59A 4GS5A 3ZU4A 1VKRA 1RMQA 3DCYA 4HDRB 1HR0B 2VG8A 3ODGA 1A9OA 1AHPA 3BILA 3FI9A 1REQB 2ZJ0A 4KWTA 3OURA 3VV3A 3V4SA 3LP5A 1UJ5A 2QMOA 3WYNA 4G56A 4B3FX 1LPBB 2VAVA 4KOEC 5HW0A 2ZE7A 5JFOA 4PBRA 1AKEA 3NDIA 4FC7A 1Y3IA 1IONA 1AXGA 1DKNA 1B8UA 1OLUA 3FYTA 3DE0X 3GZNA 5FADA 3VJLA 3P71T 3VJRA 2WYVA 4HF7A 2BGWA 3ZD7A 2QMEA 1E3MA 4U7DA 1M2HA 1N3LA 1Q86Q 2HCRA 2Q5EA 2ZWMA 4YI3A 2P9JA 2XKKA 1EJ0A 2VTVA 5KPDA 4CVNA 3KOUA 2EFDB 2CLSA 5T6BA 1XKLA 3MIZA 4ZGGA 3L0DA 4LZOA 1C14A 1SB8A 2J30A 3HB7A 4JCCA 3K30A 3AJDA 3I0ZA 2ZWAA 4K81B 2Q3DA 3CHYA 3WJ1A 4WK2B 2EJVA 3IPLA 4ZCTA 1TYZA 1AQYA 1S4QA 1NFFA 4INAA 4JXJA 3A25A 3V8RA 4LQDA 2PUGA 3GFPA 4P4SA 1BA3A 1QJCA 1T5IA 4F3RA 3QEMB 1FYEA 5AJVB 2X4GA 2W70A 1TRKA 1TGVA 2X7XA 1ZLXA 5ESXA 4B43A 2O1SA 2WIKA 4ND8A 5TDHA 3CH6A 2HBYA 4HDAA 4U3JB 5K3DA 2FETA 2J3KA 3ADBA 5HXAA 3V4PB 2PUAA 1T3ZA 2Q6TA 3K5HA 3M4NA 1F7UA 2HK7A 2EP5A 1E6EA 1GNTA 3DZBA 3H1TA 3K0BA 4XUGB 2IRWA 3B1FA 1QE3A 1S2OA 1ZGZA 2CD9A 3I76A 1LPNA 1RADA 3O8OA 4I4LA 2COEA 3DS2A 2RGYA 3ENZA 1DBWA 4GIBA 2O7NA 1W4LA 2G0AA 4B8WA 3KYDB 2DHRA 4DEXA 4LBZA 2J46A 3ZDCA 3ONNA 4HLCA 3K0AB 4PV7A 4QLBA 3FVQA 2CHFA 2GZFA 4F5DA 3LP8A 1ZW6A 3A3OA 3GVIA 4B85A 2UZAA 2DGYA 4W5OA 4IZOA 1DKPA 1KEKA 2BUAA 1GGHA 2Q5IA 3NC1C 5FLEX 3HN7A 2E85A 1O87A 2OG2A 1IEWA 4YAKA 1O8CA 4BQFA 2H29A 3UV3A 4FE4A 4YC7A 4YAEA 5C51B 5AVZA 2RKWA 3NHMA 3GLGE 4Y1RB 1EFPA 2H3HA 4AYTA 4CEHB 3FTNA 2VF7A 5CR9A 2Z9BA 4YMHA 1QONA 3CF0A 5DN6D 3OPQA 1HYGA 3CEHA 1AXRA 1XSEA 3V5NA 4PH1A 3TIXB 3MOIA 4P3XA 3TAHA 1QU2A 4L7QA 1GGKA 2HEGA 4AUEA 3LO5A 4MAAA 2FMHA 4DOMA 1FQJA 2F64A 3HYSA 3IOCA 1MZ8A 2H08A 3QNUA 5IUKC 4UHPB 1Z2EA 2NO5A 3M5CA 5EC8A 3U0VA 3GDWA 1YXMA 3RIEA 1V5WA 2NXWA 1UXIA 2IU4A 1A76A 2YASA 3OJLA 1JH9A 2XYVA 1KETA 1B3BA 1I4TD 1NBEA 1NF2A 1QCCA 3GJXC 1PJBA 3H18A 3HZHA 2YZGA 1CD5A 1FDIA 2TYSB 3F47A 1J00A 3DQQA 5EA2A 2IV3A 3RRBA 4DLPA 3GRFA 1Z45A 3LGAA 3Q1KA 1BHO1 3OBBA 1OB2A 4RQBA 2WT8A 1F2VA 3GY0A 3MJSA 4AIIA 4CQLA 2VVTA 5JAHA 1EX6A 2PJZA 4BJ6A 1XDUA 3D6JA 2D59A 3CLUD 5DM4A 1FMLA 1TMGE 1PG0A 3Q87B 2XAUA 3URKA 2EFEB 5BWLA 4GR2A 2ZUCA 3VO9A 5KP7B 1U65A 1XZNA 3E2PA 1GTG1 3U4HA 2C04A 7MDHA 1A27A 4CETA 3KB1A 3CPWO 4KL8S 4KGDA 1ZK2A 2VA8A 1JMVA 4MOWA 5CVEA 5B57C 1Y1PA 4OMDA 4H60A 5BUQA 2EBWA 4K9NA 5JFTA 3KSUA 3QEMA 2X8BA 2DNWA 4RCYA 3WL3A 1RWBA 2EARA 5JS2A 3CCLP 2L0XA 4AXXA 4CM8A 1EGHA 3EZ7A 3LLSA 2AC2A 4MKXA 1GUAA 2B1RA 4LE0A 4TYNA 4RK4A 4NKRA 5B2FA 4RA9A 4M38A 1JHXA 4XUDA 2A5JA 2K5XA 1IHYA 2X0RA 2XMQA 5U4QA 1EHIA 3GJTA 1CB7A 1W5TA 2AFVA 4J75A 4NEOA 2VQDA 4KSBA 5BV0A 3TOXA 4Y98A 1XMJA 1C80A 2VHTA 4P93A 3OQMA 1I3CA 2LV8A 4EH1A 2M9MA 4GLOA 2VDVE 2VJBA 3OOHA 4ZALA 4M0EA 5A2QA 2JGNA 2XJ9A 1GAXA 3E1GA 3G88A 3KYDA 2WWYA 1WUYA 3DV2A 3KKOA 1FNMA 2PUTA 3L0IB 3IEVA 4AP6A 1ECJA 4RX1A 4BMNA 1PSDA 3JYPA 4LDRA 3LXXA 1RI4A 2C58A 3ROXA 1KI6B 4F9EA 5JC1A 1IZ7A 2XB4A 4P34A 2QX8A 4QWWA 1QC5B 2E18A 1U3TA 1Y37A 2QTVA 5LKRA 4C0LA 2W2TA 4FDLA 3LWZA 3R8CA 1XTUA 2YVAA 2QVXX 1EGQA 2BHTA 4HUJA 3JZAA 1EDBA 4YH1A 4A82A 4AS3A 3ES9A 2MWMA 1RI1A 1E6MA 3FHCB 4PWYA 4Q4CA 5IK2D 3QU4A 5CTAA 1UAGA 2BISA 3OM0A 2QGZA 1N0WA 5JPIA 3RUPA 1NN0A 5FPKA 2W2MA 4G1CA 4WAUA 5EKSA 2FPIB 3U3JA 2RHDA 4GMFA 4URUR 3WQRA 5HM6A 2BEWA 2GBGA 1VE5A 3HZQA 1M1NA 3Q7QA 3U3OA 2ID8A 2WG1A 4MGYR 1UK7A 3G5TA 5CH3A 4UAUA 4C6TA 3IQXA 3R4VA 1QCDA 2J1LA 1AGXA 3WZ2A 1UBCA 5JNUA 4I7EA 1P2SA 1J5EB 1OX4B 1JR3D 2BRUC 3AHJA 2EOAA 2Q2VA 3KYJB 3PDUA 3LCRA 4FJ2A 4FMDF 4RGBA 3FKJA 4AD8A 3FFAA 1E4EA 4IKPA 4JUIA 1NXVA 5U9CA 1XQ9A 1NN3A 3SC4A 1GRVA 4BNKA 1VHNA 5BQ5A 2BTQB 5IDYA 4Y6GB 4KMOA 3RVSA 1WL8A 1YFJA 5CM2Z 1CUEA 1PJTA 2AH5A 2FSVC 4XSHA 4BLRA 1Z22A 5EERA 3VKVA 4RMGA 3VYWA 4OATA 3GFFA 2X6QA 1DBPA 1YHYA 3FTDA 4GSLA 1T24A 4M98A 1LK5A 4FKZA 2PT9A 4HKTA 1L8QA 4KN5A 3UJCA 2K2QA 2C1XA 2JVJA 2UXDB 1BAPA 2IGBA 5JNTA 4QD3A 4DDMA 5JAIA 4UM9D 1FP7A 2Y68A 3EDRA 3SC2A 3AZOA 3KWFA 3OFVA 3MGBA 3JARB 3WK6A 3NTLA 5F4BA 5CXUA 5KYTA 2W2QA 1C4XA 5D3ZA 1T5BA 3D7LA 2IEDA 4KFTA 2BM8A 1HYHA 1N0HA 3FHJA 1TFUA 1YFKA 4MPPA 4XYLA 5C35A 1R6BX 1DT5A 1N2CB 1OVMA 1DFIA 4D43A 4MQEA 4NR0A 3SQLA 3O8DA 3ZGOA 2WDZA 1PEDA 4QOSA 1TMYA 4NU5A 1US8A 1KVTA 1RC1A 4B6QA 4Q7LA 1CR6A 4CG3A 2OD7A 4DBLE 4GH5A 3ZOKA 5JYEA 1SUPA 3PA6A 5D5HA 5TGDA 2Z5VA 4BZZA 5A4MS 2WSMA 5DO9A 3K31A 2GYKA 1EFUA 3UGQA 4MV4A 1MOPA 2GWHA 4QQFA 4AF6A 4Z9BA 3AVQA 5TV2A 4YHHB 2K87A 5KTYA 2X23A 4BATA 2HF8A 1UJNA 3NBZC 1TU3A 4FQ8A 3JVDA 4KUGA 1E61A 1NVMB 1XTZA 4EB0A 2J33A 3X2FA 1DQSA 1FOEB 1Y4ZA 3KKQA 4FZJA 2A9QA 2RB5A 4QGSA 5J4HA 5DKFA 1FSPA 1U9JA 3KVOA 5E4JA 3MCWA 3CLTC 2H1LA 1SIBE 3EXAA 3HB0A 3I2GA 3OEYA 3PNVA 4P6VF 4QBIA 5I7SA 4YJ2A 4G2TA 1ZXLA 2E1PA 2KM1A 3EIUA 3K05A 2I1LA 2QLMA 1ZUHA 3ZHOA 4I2NA 2I67A 1SPBS 2B8TA 3RIHA 4D5GA 1ZK4A 2L9FA 2V6MA 4CDMA 3FPLA 1J90A 3HHEA 4AVYA 4DLZA 3WQSB 4FINA 4BCDA 1SQFA 2PWBA 4BBZA 4QSMA 4RS3A 4ZDJA 1VYHA 2XR1A 1P74A 3EVDA 5J9FA 1DIBA 4PQGA 3OM1A 2EYUA 4MLPA 1BH2A 3PXUA 4QOGA 4UE2A 5KCMA 3HBNA 1IN8A 3G1IA 2UVPA 4X20A 4YRCA 1ZH2A 4HGRA 3OU6A 1SGWA 1EOQA 4H7KA 4H4CA 4PZ9A 1UKBA 3UHFA 4TYPA 1ZEJA 3A1SA 1NJIQ 1RXEA 1VECA 4J29A 4UM5A 3TQHA 4C05A 1R6VA 4IMJB 2D54A 2H6EA 4QOIA 5J63A 1BFDA 4PH0A 1RPAA 1XCLA 3OKFA 5IJWA 1ADCA 1VC2A 2MR7A 2H0QA 2WVHA 1TF7A 3G8AA 2FW0A 2YWBA 1SXJB 3O1JC 3UFXA 3R5JA 4OHZA 2MINA 4E0BA 1F2TA 1FE8A 4G8CA 3QWFA 2ONKA 2ZPUA 3WSWA 1VKUA 1FXWF 5ES3A 2IYPA 3RHZA 2R79A 1YCHA 4NRDA 3U16A 4OEHA 1Z36A 4HXGA 3MJ4A 5EWMA 3G2MA 4ICIA 5LKAA 4MR8B 4RZ2A 4ZICA 4IIEA 1U0NA 3EXHC 4Y0NA 1OC2A 3C3WA 4Q4AB 1A7KA 3AL2A 3PTAA 1X1QA 3AHDA 3PC2A 1HKHA 2VZ0A 3SJ7A 3OCVA 1RE0A 3IFSA 3DHEA 5KNDD 3DZJA 2GJ9A 4KXUA 4N5IX 4HT3B 1MV5A 1N2IA 5A0TA 1H9CA 1SXPA 4NU0A 1JIQA 1HSZA 5AK3A 2IZ1A 3LPDA 1GPLA 4WK0B 3G1WA 5CRIA 4PG6A 5EMHA 1NULA 3WB2A 1ZJ5A 4FLEA 4F2WA 3NONA 5K1ZA 3P8ZA 5IEBA 3FOEC 1LPSA 4L08A 2LDBA 2I55A 4R83A 4RPJA 2XTJA 3JPYA 5ETJA 3RSOA 1P4AA 1XNJA 3IXQA 2WKWA 4N7JA 5FNZA 2NPFA 1TZBA 5IBRA 3M4ZA 2ZSJA 4QELA 3JQBA 4ZAYA 1F7VA 4JUBA 3U4MA 1DSSG 4J7XA 1CRPA 4PNZA 4RD4A 4EI2A 2Y1OA 2FN4A 3IIIA 4R7GA 2COKA 3T4EA 4NMMA 1VQNP 4HWOA 3H9GA 1O54A 2Z2JA 1XQ6A 4FQ5A 4JKYA 3ZQUA 2B4TO 3KV3O 4KZKA 3KZCA 3UMJA 1QH8A 3OI7A 4XJSA 3RK0A 3V3KA 4JR0A 4CM4A 4KRYA 2JFPA 2XT9A 3E6AA 4FGUA 1GILA 3I61A 1SU8A 2QE6A 1NVWQ 3QEAZ 2P65A 3NC0C 3G0HA 4IO1A 3SYNA 4DV0B 1EIAA 1TQ8A 3M9WA 4P7BA 3TQOA 5HHTA 4GBGA 1DCTA 3EYAA 4HOYA 1FUKA 3FLEA 4ZYYA 4G1VA 2COUA 3P9NA 3ZBQA 1GA4A 1CJMA 3CPHA 1CR0A 2QRJA 1HUQA 3PFFA 1K7XB 3SEQA 3AZQA 2HPVA 3AZPA 3SYMA 2GZDA 4LZAA 3TZHA 4C0QC 1O97C 4QTTB 1FQKA 2H4WA 1L5GB 2GN9A 2KBEA 4C0AC 2IYUA 4ZVVA 3UXYA 3Q9NA 4MA0A 1MQSA 1Z6MA 3F90A 4FYHA 3WWYA 1GAQA 1J06A 2Z83A 3PS9A 4GYYA 1P5JA 4RV4A 1ZISA 3DMHA 1G5PA 4JWKA 1SAYA 2W2KA 3B2NA 2O8FB 1UEXC 4HGZA 3I8SA 3OTQA 4IINA 4QC2A 1PK7A 3Q7SA 4BVLA 1QVFO 1JDVA 1P39A 3AVVA 2GVZC 5DHUA 2J09A 2QW8A 2QLNA 1ZO8A 3RS7A 4UJ5A 5DYYA 3SDBA 3QXJA 3QBEA 1USVA 3B3QA 1BN6A 1U81A 3WP0A 2QSYA 2PYIA 1EQUA 1S5PA 4JT8A 1GL6A 2QTZA 4RMNA 3WMEA 3TJMA 1E1KA 3B89A 4QATA 2XUZA 3MMZA 1H23A 1Z15A 1Q3HA 2OGSA 3A9VA 5LQDA 3ELUA 5EUBA 5G0UA 1U0OC 1T4CB 421PA 2NO7A 3ELDA 5FOTA 2J0SA 5GAJA 3P9CA 4U8GA 1WQ1R 2R00A 4G97A 4RE6A 3SXPA 1K8YB 5JO9A 1O95C 2A30A 2J6CA 3KZKA 3MCTA 5EPOA 2ZUWA 4WJZA 3L6OO 3KS9A 3QP9A 3DAYA 2WWIA 3V1MA 5AVOA 2MY5A 5D87A 4B3HA 4CNBA 5L3RA 1UZAA 1E3WB 3STHA 1B8VA 3IPRA 3REFA 1CERA 1CC1S 1W8DA 1ZOSA 2HF7A 1BVUA 1UR5A 2HSEA 3PXEA 2JARA 3BFVA 3UWKA 4BO3A 5BW5A 1OVGA 2QGFA 4CV3A 3GNSA 2GN4A 3PIIA 4NQZA 4QUEA 3MTEA 1WUKS 1AKYA 3PKZA 2FDCA 4F86A 4JOCA 2GZ3A 2OSBA 3LMKA 4EWLA 2LIUA 5FOQA 4KX5A 1BXRB 3OT1B 2E4XA 5BS2A 3FWYA 1AXEA 4QYMA 3ZQ6A 5I7UA 1GZHB 2DKOA 3VZRA 3RRMA 3K0HA 4F38A 1MP0A 4MUYA 5LPNA 1ZJYA 1BW9B 5I4IA 2PSSA 2IPAB 2QS9A 2Z1NA 1Y8AA 3PQEA 1JYFA 3PGJA 4J0JA 5JH7F 4TV8A 1A77A 2QUKA 2C95A 2AUTA 1E66A 2GZGA 4DQXA 3ZV7A 1XLVA 3T54A 1MGPA 1L0BA 4BUZA 1MBZA 2P9XA 2PLAA 3CZRA 3GLVA 4ARIA 1PFUA 2G80A 4BKMA 3QOXA 1ZUIA 4RACA 3RROA 3AJAA 1G8SA 1BOFA 5AUOB 3OD5A 5BNFA 2RB4A 1AYIA 3NFRA 1W8IA 4OXRA 2N6YA 1VIVA 3BX1A 3GMIA 2R6DA 1NWCA 1P1KA 1Y3CE 3IPCA 3N9IA 4GX0A 4BNTA 3KHTA 4EYGA 3HV0A 1N8SA 1MIHA 2PZMA 3BK1A 3EXG2 1MORA 2HD4A 3GP8A 3CPJB 3MERA 4NATA 2C3YA 5EE0A 1R0BA 4IIJF 2D00A 2Y1WA 3D54D 1KGSA 3ROPA 3TGLA 3R1IA 4J0CA 2GMWA 3FMVA 3NY7B 1VKNA 1TQ4A 1XYGA 3UICA 3WDMA 3VR1A 1E9EA 5JJIA 4BCBA 1ADYA 2Z4TA 3RUCA 5HF5A 2HRQA 3G0IA 2FUG1 5HCNA 5I47A 3F7TA 4JBHA 3RYTC 1JEEA 3EXG1 3SXJA 4YV7A 3KAKA 1PV4A 3GLSA 3ED5A 1WE2A 3PBKA 1R0ZA 1UEIA 3H9CA 1U7XA 1H5UA 2G3YA 1JE0A 4IDBA 2R7LA 3JQRA 3ILSA 2JQ4A 4S3MA 1MUUA 4HD8A 1J4AA 2B8WA 1VKOA 4ARSA 3WLFA 2BGRA 4JR1A 3H4MA 1EFHA 1D8TA 1PWYE 2HQRA 2X9NA 4ZFNA 1FUEA 2FSPA 3NRCA 5LYYA 1PX2A 2O1EA 4I66A 3BL5A 3S7TA 1ICEA 3R5HA 3FPJA 3W2FA 4DXAA 3CRQA 1CEXA 4QXRA 4EB3A 2B8NA 3KVVA 4WERA 5JQGF 5DIZA 1GQQA 1I36A 4O4IA 2FB9A 4CW7A 1V7PC 2W6ID 3ABIA 5AQEA 1KORA 1U7HA 1P8JA 2ZRKA 1JEYA 2JJ2A 5CLLA 1N4AA 1QHHB 1GVHA 4GPZA 1K5DA 1WS6A 4CLRB 1KXZA 1RAEA 3I9NA 1ZA2A 4GC5A 1OF1A 1P73A 2QQFA 1DI0A 1HDZA 1G17A 3IUQA 3MJFA 4MVJH 4M54A 3LBFA 2B69A 4UD6A 5F1KA 4C1NA 5LP6C 4BO2A 5I9IA 4BNDB 5B6PA 5K7SA 2KR5A 4N76A 2QIOA 4RXTA 3K6RA 1EIWA 3VAAA 4U0JA 3BGWA 4IXMA 4MYSA 3VSDA 4EHAA 4FGSA 1R64A 2EIAA 4N3BA 1EFLA 2CT8A 5JQWA 4RTPA 1QH1A 2HSWA 2FSHA 1RC0A 4GSYA 1JIIA 3GUCA 4RSRA 1P2BA 4TKZA 5SYNA 4MYDA 4AMYA 3LXUX 2HRDA 1DAFA 4Y3UA 2WHPB 5LQMA 3LRYA 1X3LA 4PLYA 5EOVA 3CWZA 4HX2A 4OQDA 2IFTA 5PNTA 3EAFA 1OKKA 1OT5A 1DEOA 3NAQA 3L4SO 4Y6LA 2J32A 3GEMA 3PHLA 1VKJA 2VZLA 3BB3A 3SC3A 4YQEA 3L92A 4B74A 1D4FA 1JJ7A 2NSLA 3V1YA 4QZVA 1Y6QA 2P27A 2Q9BA 4BU1A 1WD5A 1E18A 3L4EA 4XIJA 4XCVA 4NCHA 5DNEA 3UB4A 3VDQA 1NQAO 3SLRA 1AIPA 5CDFE 3R3SA 4GVXA 5FBWB 4KOAA 3IERA 2P6PA 2B9VA 4BO6A 4DIMA 1EAMA 1P2FA 4FE3A 2H9YA 5ICFA 3AETB 1AK1A 4M9SA 2O7VA 2XF2A 1M73E 4KAJA 4E4TA 4MRAA 4RPLA 4PQYA 2BGGA 1XZJA 3H11A 1X77A 4J76A 4ZT3A 2NU7B 5KQMA 1Y7HA 3IUMA 3WDLA 2PX4A 4A1FA 3B3AA 4HS4A 4HEHA 3U4GA 3PDIA 4C08A 2WF7A 3HU2A 3IJ5A 3PC3A 1QF9A 2BCJQ 3NW9A 4P53A 3REGA 5IYZF 3THWB 1UC8A 2QMQA 2FPOA 3CY6A 3P52A 3CSDA 4YDRA 3N53A 4TMVA 4HFMA 3UGKA 3WRXC 2BSQA 3ADKA 5E3HA 4TPKA 4QUAA 5F64A 2IV7A 2Q4EA 2WVGA 4HDOB 5FUBA 3I64A 1ADFA 3OMWA 3WLLA 1MTZA 3CVXA 3WKBA 4C6RA 3PXDA 4A6XA 3MT9A 4PPFA 4RZUA 3OSZA 2OFWA 4YTEA 4F6RA 4RSMA 1RI3A 3HDTA 2JLYA 4TWRA 2A5LA 5E4YA 4M0PA 3RKUA 4YAFA 3IDAA 3AFOA 4U2BA 5AKKA 1IAVA 4DA6A 5CW2A 3FVWA 1UZUA 5ICSA 3EIWA 3NNDA 2WAYA 2YQ4A 5K20A 2VHCA 3OUTA 4HQKA 4RVOA 3C1AA 3UHPA 2UZ1B 3VSEA 3TKAA 2XUGA 2V7QA 3X2SA 3WBFA 4HN2A 4LKOA 4COCA 4BVAA 5BSKA 1I10A 4Y1EA 1RWXA 1NP3A 4XFZA 1Y3DE 3RUHA 3WFIA 3AP1A 3EGVA 4DL9A 1RWQA 1LDYA 1HO3A 1JE1A 2Q5QA 1FU4A 2X0JA 3C97A 4IDGA 4NE9A 1C3XA 5K8CA 2AVDA 4B45A 2AFHB 4RIIA 1NPDA 2PU7A 3NHKA 4HDKB 2AZMA 1AQ6A 3KKPA 3ANLA 3KT6A 3TBFA 1JIXA 1RYZA 2NX2A 3C5WP 2Z2ZA 3WGIA 1JJ2O 2OHFA 2PFSA 3DOCA 2ONJA 3NVMB 4ZK2A 4WSOA 5CCDA 2G4CA 2RHHA 4JLOA 5COQA 3WFJA 1DZ3A 1IAQA 4IIXA 2RHGB 3RVLA 3LY7A 4YROA 4DF3A 1DOAA 2QT0A 1OTYA 1ZSVA 2VDKB 3OCCA 4S1VA 4OFXA 5H59A 4TS1A 5I9MA 4DZTA 3QY9A 1XD9A 1N2JA 4GXTA 1XDDA 1UC9A 1NW5A 4L4XA 1KAGA 4NVRA 2ZSBA 1DV5A 2QTLA 1VQ1A 4KWHA 1DCFA 4C6SA 4ZV7A 3JAMA 3HJNA 5K3FA 3V55A 3VR5A 2Q3CA 4RF2A 4BS9A 3INGA 4QEZA 3A2KA 4QUDA 3KFVA 1H0SA 3G2JA 1II8A 1TM5E 1JV2B 2CKDA 4ER0A 1UXJA 4GWGA 1P19A 3LT4A 3O91A 4PS1A 4KAAA 4ECEA 1YCGA 3LW8A 2AXNA 1DV2A 2GHTA 2IIPA 2NO6A 4P5DA 3V9AA 3WAJA 1PNRA 4E2WA 2R6AA 4F4DA 5AW3A 1Z0AA 1D1PA 1S02A 3ST7A 3BVPA 1A8HA 1OFGA 2GXQA 2VDLB 3MZ0A 4NABA 2CLIB 4L85A 3L8FA 3GAAA 4PICA 4Z0HO 2AJDA 4DUZB 2FQXA 4GL4A 4HI0E 2YFKA 3AR5A 4HHEA 4XAQA 3ZY2A 2D3TA 5KOIA 4YNBA 4EG4A 3DZKA 3CUWA 4C0KA 2JIDA 3C4QA 2AZTA 1Q7BA 1DX9A 1T6XA 2WFMA 3DFIA 3LUFA 3MD0A 4M60A 5C3UA 3U3ZA 5L53A 1AN9A 1VL1A 2WW8A 5EP2A 4GKKB 2Q4DA 4UUOA 3UAWA 1K89A 2KYRA 3TSAA 1YS9A 2JIOA 3BHJA 5GJCA 1EZ4A 3RYFA 4BPBA 4WCFC 3OF2A 5HS4A 4UHDA 3AP3A 1R0XA 3P32A 3ABSB 5GZ3A 1K4MA 4RHXA 5D3MB 1KJYA 4BRUA 3RQSA 5JAUA 4AECA 1TM3E 1J8VA 3S1AA 4BMCA 4P98A 3SJUA 2CUKA 1QAOA 1Y4AE 5GJBA 1C0PA 1VMIA 5HQ3B 3KOYA 3AWIA 3EGWA 1BXGB 1R66A 2VHWA 3HNRA 4LXYA 5CBKA 5HGXA 3FOFC 2WU1A 2VP6A 1S1CA 2V0GA 2A0FA 1ULTA 1IJKA 5JZSA 1U5BA 3TQSA 1EVYA 3P9QA 3V33A 3H87A 1JAXA 3A7DA 4RJTA 3HI6A 2PRZA 1PDOA 1BYIA 2E4UA 3OQJA 5KDLA 1ZCAA 3BD6A 3E23A 4I4IA 4WXHA 4EI8A 3ICOA 3H0KA 3PFIA 4J4HA 4ZTBA 6REQA 2QTRA 2E4ZA 2XGOA 4FW9A 2ZBGA 4JXKA 5FI0B 1LVHA 1NRXA 3UJ6A 4ASUD 4AJPA 3CR7A 1ZIDA 3IKVA 3OQ1A 4BO5A 3I5XA 4KODA 4MEJA 3IAUA 1LLQA 4MQFA 3N3BC 2FW8A 4KPUA 2NMVA 4F5ZA 2A4MA 4ENVA 1JQJC 2V6FA 4CKCB 3BMQA 1UQUA 1XALA 1UXGA 3LRPA 3CO5A 3WHKA 3KXPA 1MHPA 5ED4A 4EHFA 2H1VA 4XB2A 2VYNA 3QVOA 4IL5A 3I2JA 4JLMA 4QHSA 5D1NA 4BN0A 1G9XA 1NBME 2YIMA 4HP8A 2DJIA 3DTJA 4JKOA 5K0BA 3DPUA 1L5SA 3RIGA 1Z9BA 2GJSA 5B58T 3Q40A 3S28A 5IZ4A 2JFGA 2ZBEA 3KU1A 1XPJA 4Q7EA 3S99A 3TGWA 1W87A 4EZBA 1E79D 1T91A 3R9WA 4UTVA 3QPUA 2Q07A 2IUYA 5E7MA 4W1QA 2QN3A 1I1QB 2P2YA 1R37A 3LKZA 3G29A 3FJ1A 3IPXA 2WFZA 4QKQA 4M0CA 3GQVA 2RAUA 1TO2E 1WP4A 2PGJA 3WAKA 5A1TA 1N5MA 4KUEA 1PTJA 3AHIA 4BWVA 4U0EA 1YTLA 3FBTA 3NPAA 2R96A 4RZSA 4PO1A 4TKVB 4F2PA 1UKYA 4IIJA 2R5WA 4NLLA 1F48A 4QNBA 4J0EA 5JNLA 3TK1A 4GRAA 1TLTA 2PXCA 2VCYA 3TTYA 4HO1X 5K45A 4XWTA 5D01A 3V7NA 4PY2A 5I7VA 2OXRA 4AFNA 2FUG6 1M2JA 1M2VB 1FDWA 3LI2A 2CY0A 4FYYA 4RLHA 1S3IA 2PSDA 1B1AA 5TPWB 4DA9A 5ICEA 1HDGO 2GLXA 3ZV3A 5L95A 4GR4A 3D3JA 4PHFA 5JD6A 3MWFA 3PEWA 5FBHA 4NCJA 4FFBB 3OCYA 4QECA 4Q9NA 4TV8F 3R3YA 3TKLA 1P72A 2QB5A 2XVYA 3B1VA 3THRA 4PO3X 3KU4A 4JJ7A 3FUTA 1E1YA 1F38A 1QLJA 1WDLA 2X0KA 2RK3A 4JLUA 4PW0A 2DUNA 5AJZA 2IP1A 4AN0A 3RQIA 4UUPA 1GAJA 4BJ5A 2PJDA 3N0WA 2WYIA 1ODLA 3H9EO 3IE2A 3OTHA 3VBEA 4R9SA 1A8SA 4Y0AA 2NZ2A 2P6RA 4WT7A 1J09A 1ML4A 2HLPA 2L42A 3PNBA 2ZUTA 1PJ3A 2RH9B 3CG0A 3K0CA 4YRPA 3IUPA 2RFLA 5E2AA 3G8BA 1ZR4A 4IPTA 3COPA 4E32A 4TRNA 1ZI9A 5AJHA 1TXGA 2C4NA 3FPBA 1EK0A 3SJCA 4YJDA 1Y7PA 3FN4A 1SVMA 1X7XB 3VDMA 4DLLA 5BMVA 2ZSIA 3ZHSA 3EGIA 4DM7A 2FN9A 1POXA 4FZ3A 1M9NA 1R15A 1V25A 2IYRA 4M8KA 2YW2A 3JQ9C 4AMGA 4DIFA 1D9XA 1O96A 2AFHE 4J0QA 2I66A 4KQMA 2VRCA 4LXQA 4EF4A 5EG5A 4EGJA 3U7JA 1NBHA 2DVMA 2M6RA 2QWXA 4WIAA 2C2XA 1NLFA 1U0HC 3H99A 3QVMA 4OVKA 1XDZA 3UFXB 5AVUA 2XRZA 4E88A 4G0OA 1AQUA 1GQFA 5BWOA 1DPFA 2G9ZA 4CTKA 4ARZA 5CB6A 1J7KA 2B3TA 4PZUA 3SYLA 3MMPA 4PO9A 3CEMA 2JCSA 4FCTA 5ALUA 3QYAA 1Z6ZA 2FV8A 3L4BA 3AM1A 5IK2A 3UV7A 4DCTA 4UAGA 4HTFB 1ZL2A 2JU1A 4I5GA 5GQSA 121PA 5J23A 4S04A 1SVKA 2LPKA 3K5IA 4QOFA 1Z13A 1XO1A 4J91A 1U0FA 1FSSA 3D6MA 3DCIA 3ZJVA 2ZRGA 4B87A 1I24A 2DP4E 4MWEA 4IYRA 3IOMA 3AHEA 3TZ6A 1NSYA 3ZK8A 4DA8A 4ZVSA 1Q82Q 2W6PA 4OL0A 3L6BA 5IKPA 3IPYA 1R00A 1NL3A 2B99A 5AOAA 2VDPB 4F92B 2YOFA 2AB0A 1Z4JA 2EHDA 5KAPA 5EESA 3ZLJA 1UWKA 1WTAA 2JFUA 1LVUA 3Q7RA 2A3RA 4FSDA 3GN2A 2Y92A 3MRSA 3V8VA 1QIJA 1Z5PA 3SBXA 1I94B 4Z4IA 1KIFA 2P9YA 3AY6A 1QYCA 3CKLA 5ALHA 4EFMA 1M74A 2Q3HA 3MIIA 3T7EA 4ZYVA 1MD9A 3QQPA 2XD9A 3KEQA 4ZAZA 3VZCA 3OLXA 2P1ZA 3HKBB 4ENSA 3K0FB 4TMWA 2PIDA 4NOJA 4QO8A 4NENB 4C7XA 2CV1A 4IGIA 2XNJA 4GZ6A 4PZLA 2GFIA 3PQFA 3KZOA 3OCJA 3PI6A 4PRZA 3JRXA 5ALWA 1XNRB 3O93A 2DWUA 2PD4A 3TTXA 3IA7A 4C5CA 3EDCA 4NWIA 3MB8A 2PLNA 3KJFA 5BY2A 3M3PA 2ZCJA 4UVGA 4BGEA 4RH1A 4GMKA 3AUSA 1FFWA 2C94A 1JX6A 3N8GA 3SI7A 1UFOA 2NO4A 1NVKA 3OEWA 4I4CA 1I1OA 4UKDA 5ERYA 5L7YA 3TIVA 2EZ9A 2YVQA 1RQ2A 3UXHA 2C92A 4JUAA 1NI3A 1QZXA 3WLOA 1NXTA 3GRPA 3MBOA 3MQ2A 3IVCA 2E1RA 4I0WB 5EMNA 3W0LB 1A98A 5A3JA 4A2WA 4B3RB 1AUVA 4D98A 4TTSA 2W2XA 4PHTA 3VPDA 4EBFA 2MSEB 5AHWA 2BMFA 1VIDA 4INOA 2YJGA 1BCSB 4OBXA 4TYMA 1JHUA 3AI3A 3HDGA 4N4AA 4F5WA 1Y9JA 3F3YA 4MTCA 3GFVA 3H7AA 4ZMBA 3FDZA 1H2BA 1FFSA 3V7UA 5BSFA 2HZ7A 2E37A 3ESRA 4H77A 4ZAGA 4RY9A 5CAEA 1K0UA 1PV2A 3FTEA 1EUZA 2I4MA 2IYEA 3LHKA 3NCTA 1U2DC 3PP8A 3RYHA 3RFFA 1H2WA 5AXBA 2EG5A 2JIZD 3R8XA 4Z3OA 4A10A 5JE8A 1TTPB 3CNBA 3U6KA 3IP9A 1JAYA 5LYJB 2PMCA 5C5IA 5ALSA 1O6GA 2FWRA 5LZ4A 1P3Y1 2DUJA 1A7JA 3DEIA 4AN1A 4MZXA 1E4OA 2J9YB 3FGZA 4CUJA 2KMLA 3PA8A 4D6XA 4F2HA 6ADHA 2PMFA 3H17A 1K6JA 3NDPA 2O1XA 4MW9A 4IZ6A 4JVMA 2PUFA 5REQA 3UWMA 3KL4A 1IXZA 2RC5A 3GYGA 3F7NA 3DDHA 2H4JA 1X1SA 5DMHA 2X0IA 2RCNA 1VBMA 4QL3A 1XCOA 1QORA 1DKQA 4AICA 3P94A 1Q1GA 1SUDA 3AYZB 4S35A 2H4FA 1J0EA 4UNPA 1NW8A 2NU9A 2QNWA 2FJ0A 4KE8A 4OP3A 1F2TB 1IB6A 3N0TA 4PNHA 2BBOA 1PR5A 3PNQA 1BDBA 4ETMA 3OIVA 1MAVA 3RHFA 3G8DA 3ZWAA 1OA1A 1BMTA 4RF5A 1IRXA 2P11A 1S72P 1RWOA 4LK3A 3NI2A 1JVSA 1V3UA 4IDCA 4RPCA 3DHVA 3I2HA 5IAGA 2ZT7A 3UA3A 1V71A 1W46A 1QGYA 2Z8YM 4R51A 1AMNA 4AP5A 1N8TA 2WE7A 1K5PA 1JWLA 1BW9A 4YRNA 3ZWMA 1T8SA 4NENA 2NT4A 3OX4A 7CEIA 5AOVA 3LDUA 4GW3A 4QOEA 1GDDA 1V47A 2IL1A 3M49A 3NBAA 3BB1A 4E31A 3WFZA 1B0ZA 1W4CA 4J2OA 3WKDA 1BEZA 2SKCA 3IUSA 4QVKA 4W5JA 2YZNA 3RRNA 4RK6A 4O3MA 2D2VA 5JNRA 1ACJA 5KSPA 1T6NA 4LF7B 4DV5B 4UVHA 1XCBA 3NKLA 4XZ3A 3CCQP 1OLXA 2V7BA 3QOYA 4GLJA 4NL4H 3I2KA 2JLUA 3MYYA 1L5HB 5JROA 4J16A 2C4MA 4Q4JB 5KVQA 3WZLA 4NC9A 4LSGA 1PW7A 2YS7A 2PSHA 1IEXA 1CIVA 1E8NA 4LJ7A 3F71A 4WZBE 3EJWA 4H7PA 4ZRDA 4YJFA 1GPYA 3PV0A 1D2MA 2D3WA 4UAVA 2XZ1C 4TT8A 4TQGA 3GPBA 4GOKA 1TT7A 4MULA 1UMBA 4MPRA 5HGJA 1V8ZA 3A06A 3MTJA 4Q3DA 2CXPA 3MHPA 4EVRA 4P31A 4W9MC 4PZZA 4XOUA 3ZDZB 1P2UA 1OCEA 4Y6OA 2AJTA 1KO4A 3DEFA 4RHEA 3ZHUA 1N5DA 1E2UA 1Z7GA 3VZSA 3T5DA 4NPCA 4BFYA 4IOMA 5HWSA 4UVIA 5EZYF 4ZQEA 1U2SA 3R9XB 4EFKA 2DGDA 1U9YA 2EATA 3FPGA 2R7NA 3GJSA 1X6VA 3PFKA 2VNHA 2LIWA 1I6LA 1O6ZA 1XEXB 3H3FA 3ILHA 3WXMA 2C5BA 4ZCQA 4Z2AA 1AT1A 2RH8A 4BTLA 1NR5A 4I14A 4JJAA 1VSBA 5F1YA 4WXYB 4A23A 5AKLA 4F6LA 4KJXA 5IUNC 1ZGHA 1GU7A 3IV7A 2Q7XA 3K0CC 1PJSA 5AW5A 5A1JA 4JXXA 2WHRA 1OIWA 3O8CA 2I9PA 2IZ5A 3GQBA 4RKRA 4YRKA 5JCPA 2OCDA 1SBIA 3EC1A 3TZKA 4XQ9A 2XVZA 1BE0A 1A4XA 3OCZA 4KIWA 4I55A 4JZYA 4U6NA 2B5OA 5DRYA 4V0SA 2FPMA 2WLSA 5LLTA 1PUIA 1PS8A 2CLCX 2OOKA 1H94A 2OPBA 3LHSA 2BJWA 5K05A 3DE7X 2QTMA 4A36A 1M6HA 3WLJA 1U1EA 2RGUA 1QIIA 2L22A 1NU8A 4LHYA 4RPHA 1Z4PX 4TS9A 2IS2A 4Q6WA 3UK1A 1KRHA 3HC7A 1NP7A 1TC2A 4F4UA 2JJMA 3P9XA 2O2CA 4QAQA 5DTEA 5IDWA 4C89A 3L7OA 3NHJA 4IGAA 3BE4A 1YQGA 3BHMA 3OFSA 4KE7A 4N5DA 2R1TB 5G2OA 1A5AB 3I6ZA 2CDNA 5ULLA 3ZUPA 4DCGA 1ULZA 3NALA 1NPTO 3PD0A 3KTDA 3R20A 3SC6A 2Q3LA 1DTWB 1M76A 4UMVA 2KG8A 3IBYA 2J85A 5BSHA 1VLMA 3PXGA 1XFAA 2PA3A 1GO2A 3COVA 4YAWA 3CVJA 4B7XA 4DLKA 3R0ZA 2JFQA 4MVJP 2F00A 3A9CA 1OLXB 2FG5A 2QN9A 1L5FA 4PG8A 5SY4A 4DW8A 1QHNA 5DK6A 3EZFA 4ZI7F 2JIZA 5ICMA 3DEYX 2JCGA 2ZYAA 1X9HA 2VSQA 4MVJE 4D6PA 2VA9A 1Y42X 3LTEA 3PGKA 4YDQA 1KYZA 1P6XA 1P7PA 1VJGA 3DLTA 3TL3A 1DUVG 1FTQA 2P91A 2MMCA 2QG6A 3IO3A 3HYRA 3LDFA 4LJ5A 2NU8B 3PRYA 3FPEA 3GH1A 4NYIR 5CA1B 4LPSA 3FDJA 4MRSA 4AJLA 4N3GA 3R2JA 1Y7TA 4WASA 4BP1A 4BGIA 2WA2A 5JECA 3A9WA 1DTEA 3TBHA 4HFRA 5EWJA 5KI6A 1DQZA 1EXMA 1GXSB 1HLFA 2PIAA 2OV4A 3LBNA 5TS2A 4DDWA 3DM5A 3FUVA 3U5ZB 5IH3A 5ADVA 5KYWB 2ZEJA 2C3MA 4M7RA 4QGHA 1N8RQ 3I92A 4ODIA 4WZBA 3CMEP 3T94A 2LZ0A 3ZXIA 2FE4A 1C8LA 2F9FA 3DMPA 4X7MA 1H0KA 4DDKA 3AUXA 3RYCB 2VAWA 5HKBA 2GCOB 4R3UC 2QU7A 3ZC3A 4D97A 2HRCA 1V5IA 2OAQ1 1ENPA 3PL1A 1XD2B 2XCOA 5FJIA 3LG2A 4OGGA 3FR8A 5F3WB 1EDZA 3R7FA 2W90A 3CT4A 2Y1LA 3IVGA 4L9RA 1A4RA 2D1FA 3R24A 2WK1A 3SU8A 2IU3A 4BYMA 4ZHSA 3FR7A 4ADSG 1P6QA 2CZCA 2HHCA 2J08A 4HWSA 4LDPA 2G6TA 5EHQA 3RTAA 5AVQA 1JPNA 5ER9A 3OZIA 1J0DA 1UPFA 2UV8A 2JEOA 2WJJA 1OR5A 4WZAB 1X7ZA 3RF6A 2IBMA 4Y2UA 4I8DA 1CJKC 1XL1A 3B6ZA 1YL6A 3K8YA 2WWWA 1N6PA 1TIPA 4G09A 5AVRA 4G8BA 1ZKMA 3H16A 5CNMA 1P0FA 3MLAA 5ERXA 5FUQA 2FKAA 2OGTA 3RVRA 1GLGA 3AVUA 5BSUA 4WCFA 1NR7A 3BPSA 4PWVB 1SHJA 3X44A 2BELA 2CGEA 3PPYA 4QYTA 4EUEA 3HMKA 4A7PA 3ZZTA 3PIDA 4H1HA 4IIUA 2OBNA 3SYRA 2C3OA 3KQOA 4LG1A 4DIOA 4OTZA 2PX0A 3GK3A 1FJGB 2HO5A 9ATCA 1XJ5A 4W1PA 1H6AA 1YIAA 2CNRA 2OXEA 3AU9A 1JEYB 3NTUA 3G2HA 4CQNA 2W6MA 4JAVC 3DFMA 4TROA 4KPYA 1AGRA 2QX9A 2O3TA 2LD4A 2QD5A 3Q2KA 4B9EA 2BH2A 1Y5RA 1KI3A 4J2HA 3RSLA 4LC9A 4DJJA 4IF4A 2IA5A 2CCKA 2E6KA 1PFQA 1S2DA 3ZI7A 4BO8A 3RS8A 2LWIA 5E95A 4DCOA 4S2EA 4LNUB 1QH1B 3L8DA 3D4BA 4H7JA 4J4BA 5JDCA 3COYA 5A6SA 4X61A 1RR6A 1SBYA 4I1RA 5JVDB 5LB4A 1RO2A 3HYBA 4KW7A 3W7BA 1M2GA 5HZGA 3LUPA 2DLNA 1HT0A 2J59A 2PMBA 1IUQA 1GKYA 1LQTA 2VRCD 3HR4A 4I36A 3QVSA 4P7GA 2Y4OA 4ZV4A 4G0VA 3W6PA 2R6R1 4C07A 5D5PA 2F43B 5LQJA 2W6ZA 1WDWB 1QZZA 2GBLA 1HURA 3GRRA 2MIIA 1W5SA 1SUEA 2R8ZA 3EIEA 1E1CB 2UUAB 1D07A 1T0BA 5HQ3A 2ERCA 2C77A 1B15A 2PMDA 2OCAA 1ZD5A 3IT3A 2P78A 1XELA 3HY6A 4YRJA 3ZZUA 5G4LA 5JBQA 1EP1B 1OROA 4E51A 2HX1A 3AOEA 1NIJA 4EFLA 1BQ4A 1H69A 2ZGVA 2IY7A 2WUEA 4A0SA 5B36A 1X0VA 2Z0MA 3AOGA 1XA0A 1OXMA 3JQCA 4G5SA 4GPAA 3NHZA 3FVRA 4CF5A 2VJOA 5H83A 3O8QB 1MMFB 3VPGA 5KTRA 5LJLA 2MD9A 1WUHS 1EVLA 5IABA 5TT0A 2CNOA 1ZGCA 2PYDA 3AG5A 4FZVA 4J16C 4MVJF 2QZJA 2VI5A 2AKAB 5E9WA 4BUJA 1C9EA 5KNBA 3L04A 3OTIA 4L5YA 2CLEB 1RPTA 2BDTA 5FWNA 1PJAA 4PBSA 3E5NA 3CCBA 3CRRA 5EZYB 3P26A 1B6SA 3TLJA 4KXLA 1FMFA 5DHPA 1K8AQ 1RRKA 3CQ9A 3HXKA 4L76A 4E13A 2JRCA 4R84A 1C4WA 1OGYA 2HMTA 2IS4A 3CE9A 4MQMA 4YCLA 3MBIA 2AE1A 2AI2A 2HA6A 4UUAA 1IU9A 1IOZA 1ZGGA 1UBUS 4DLBA 3GVCA 2XITA 3BXHA 1Y8QB 4I1YA 4PGFA 4UHHA 3AC0A 3AY7A 2Z58A 4PYMA 3C6QA 1HNZB 1Z5ZA 1A8UA 5TSDA 2Q1YA 4EB6B 4R71A 2WE8A 2H7VA 3N74A 5I51A 1JJBA 1IWBB 1DDIA 1SVLA 2J7KA 2ZETA 1BHSA 3NHYA 2OHIA 3P2IA 2P9BA 4O33A 4OIMA 1VGVA 3HEBA 2C97A 1RHKA 1TVMA 2R5FA 2XVMA 3GFSA 3IHLA 3MGAA 2G6BA 4G5GA 2GN2A 1JG6A 3PPXA 4IX1A 2W8BA 2TMKA 4J4TA 3AF5A 3HABA 4JVOA 3JY6A 2R84A 2JBAB 4OBEA 4RJIA 2C98A 4XD2A 3NRJA 4FEGA 3ZN2A 3KE9A 1N1MA 4NZZA 2NP6A 1GY8A 1HC7A 1X7GA 3ZWDA 1PYDA 4AS2A 2ZS8A 1KQNA 7MHTA 3NWJA 3IQWA 1W88A 3LYUA 5FV4A 4M0IA 1TADA 4KPGA 1Q7RA 2FEKA 2RK4A 1SG0A 1YIJP 4GPIB 4BOYA 3ZNNA 1OE0A 1NKVA 3BICA 3WWZA 3QUBA 1B41A 2P2DA 1CFJA 4OQLA 3GROA 3PF8A 3PFBA 4XLLA 1CRZA 3BTVA 5TE9A 5LMCA 2QR3A 3FB1A 1VI5A 2JD0A 4C2AA 2WZBA 3LDGA 1KL7A 3EFHA 4RGQA 5KVCA 2VZEA 4ZEOA 3NV9A 3T1OA 4FCVA 2XUFA 1Q1AA 4KMSA 1TCAA 1IM5A 3CSUA 2VDWB 5ILQA 5LL6P 3BBLA 1G8GA 3D8RA 3GFTA 3I37X 1OOEA 3G2KA 4D41A 3AB8A 4HN9A 1IXKA 1EE9A 3S2UA 3FGOA 4RZIA 4EAQA 1VQKP 4HQNA 2EQAA 1U0SY 5CCXA 3NIBA 3ZGYA 1GKKA 1P61B 1J21A 4L8VA 2CLKB 3H1BA 3HVRA 4IIFA 2HK6A 2GF9A 2OY0A 3B3FA 3H5TA 3MGKA