2FQ1A

Crystal structure of the two-domain non-ribosomal peptide synthetase entb containing isochorismate lyase and aryl-carrier protein domains
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
279
structure length
279
Chain Sequence
KLQAYALPESHDIPQNKVDWAFEPQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the EntB multidomain nonribosomal peptide synthetase and functional analysis of its interaction with the EntE adenylation domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Isochorismatase
total genus 87
structure length 279
sequence length 279
chains with identical sequence B
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2006-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fq1A02
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 2fq1A01
2KOPA 1NQ4A 4HKGA 2K0XA 2MR8A 2JQ4A 2KOQA 2N5HA 2AFEA 2CQ8A 5HVCA 2N98A 1J2RA 4BPGA 4L08A 1ILWA 2FQ0A 2GDYA 2KOSA 3O92A 2KGDA 3O93A 2MY5A 3RG2A 3O90A 4H2WC 1DNYA 4H2XC 5KP7B 2WTAA 2PNGA 3UAOA 2MD9A 2K92A 2LPKA 3GZLA 2FQ1A 2JU2A 2JGPA 2LL8A 1X3OA 1OR5A 2ROQA 3CE7A 2FHSC 1YACA 3OT4A 4MRTC 2XZ1C 5CZDB 2LIWA 2L4BA 3LMOA 2WT9A 2LKIA 3V8EA 2B34A 1HY8A 3TB4A 1NBAA 2FVAA 2XZ0D 1VKUA 2GDXA 2FADA 2LOLA 2N6ZA 1IM5A 2LMLA 2DNWA 1AF8A 4WH0A 4NEOA 2FACA 3TG2A 3TXYA 4WGFA 2A67A 2K93A 2CG5B 2KGEA 2KORA 2M5RA 2MR7A 4IZ6A 3HB7A 1NF8A 3KL2A 2EHTA 2K2QA 2K0YA 2MVVA 2KOOA 1XN4A 1X9GA 2K94A 5KP6B 2L22A 2L9FA 2FAEA 4BPHA 2CGQA 4CA3A 3IRVA 3MCWA 2KW2A 2VSQA 3S2SA 2MF4A 3R77A 5EJDA 2EHSA 2MVUA 2JU1A 2AFDA 2KGAA 2LTEA 3R2JA 3EJEA 5HV8A 4R0MA 1DV5A 2FQ2A 4DG9A 1ACPA 1L0HA 4H2YC 2KG9A 2FVFA 1T8KA 1HQBA 2N6YA 2CNRA 4PWVB 2H0RA 2L0QA 3EJDA 1YZVA 4L07A 2GDWA 3HU5A 3OQPA 2FVEA 2KGCA 2QNWA 4BPFA 3O91A 3LQYA 2N5IA 3NY7B 1KLPA 4H17A 4PXHB 1L0IA 1F80D 2KWLA 2KG6A 2N50A 3EJBA 2KG8A 2AVAA 3EEFA 2LIUA 2AF8A 1NF9A 2X2BA 2KR5A 3O94A 5KP8B 3GZMA 3PL1A
chains in the Genus database with same CATH superfamily
2PBFA 1K4KA 1YIAA 2R7NA 3WYNA 1ZMOA 1YZ3A 5FWXB 4NDAA 3L7YA 4OGGA 4ZQHA 3GWGA 3ZLJA 1YE8A 3H5OA 1U1GA 1A1SA 1HF3A 2W8BB 4C76A 5JYDA 3CNLA 3Q6NA 2JB9A 3TBFA 1HYBA 1NR7A 2JBAA 4O59O 1X94A 1Y80A 2O3UA 4WGGA 4AY3A 5IVPA 1E3SA 3LX4A 4R3NA 4IH4A 3RF6A 4WOJA 5AM2A 3IAAA 5JCJD 4PCUA 4JYZA 2O7SA 4MLCA 4AJJA 1ZCFA 1XVAA 4WEOA 5EQDA 1YULA 4M36A 1WPQA 5J5CA 1WLYA 1N2CB 3EODA 3NDIA 5I7WA 3LQ2A 3TPZA 2ZYIA 4L78A 1V5WA 3RC2A 4I4IA 4U00A 2Z0MA 5KI6A 2NNWB 1QBKC 2GEBA 5BR7A 3T12A 2AB0A 4JEMA 2CVPA 2WMNB 2NZYA 3HBMA 1FDOA 2WJAA 3IAHA 4H3HB 4F4DA 1YR2A 2ZUVA 2DR3A 3RSLA 2RG7A 2ZM5A 2I34A 1UJCA 1TUEA 3RGWS 1E3JA 4NKRA 3SQMA 4JP2A 1WWKA 3OPXA 4EJ6A 4HQOA 4EYGA 2VYFA 3JPWA 1RC1A 3V8EA 1XRLA 2OLJA 3CC7P 4ENSA 4PZAA 2IPAB 1YRWA 3C43A 1WU8A 2GN9A 1Y6JA 1EQ2A 2R5WA 5DTQA 2ACKA 2VYVD 4BMDA 4KIWA 2EKLA 4YMHA 4CQNA 3OIYA 4ZXPA 1UCFA 2H5IA 5GM2A 1XAHA 4QEKA 3TQTA 1MZ8A 4X95A 1PQWA 1U0BB 4HRVA 4UUAA 3ONVA 2WW8A 3UV3A 1VSTA 1ZAYA 4RM3A 4CKEB 1L0BA 1T6NA 2FE4A 2ZVDA 3KUKA 2J7PD 1NI3A 3QEJA 2PZAA 3NWJA 1XKLA 2H2HA 2P5TB 3GROA 4K9KA 5DNWA 1W25A 1AVTA 5GIPE 2D1YA 4C01A 3ZWMA 5KO2A 1O87A 3NYIA 4OQPA 1H8EA 1ZOOA 1D2MA 1OXVA 3QPCA 1CXZA 1ORIA 1Z4JA 3ZXYA 3RROA 1E1NA 1MC1A 3EG9A 3PZRA 2PS9A 4G0ZA 3FJOA 2V45A 3P0JA 3DS8A 3V6LA 1JDPA 2E4YA 3G2NA 3TUIC 3VZRA 2QTWB 4NZPA 4J0GA 4ZI7F 4GH5A 2IYXA 2OENG 4J7XA 3PX7A 2NV2B 1K7XB 5TS2A 1K97A 1X1AA 4V0MA 4BWFB 3EJEA 1E2LA 1BE0A 1F2VA 1NOIA 4CIWA 1DXQA 3HXOA 2VR1A 4PHTA 4RVHA 1G16A 1M6EX 1P6UA 2G28A 4IHAA 1RNIA 3DB2A 1TCVA 4FEAA 5CVVA 5DH9A 1G8HA 4ZAWA 2A14A 2RK6A 3NH6A 1BE8A 4XA8A 1K63A 3MG9A 1OCEA 2YJ3A 3EW9A 4XPIB 3H7IA 4Y9DA 3VC1A 2GO1A 3WL4A 4DEVA 3KOOA 2EQAA 1L8XA 2QRGA 5G02A 3AWIA 4TKVB 1C4OA 1PL0A 2P79A 2QROA 3QLUC 1KO7A 2MSKA 3VDRA 2H16A 1TTHA 2POCA 4LQDA 2FZVA 5H8WA 4FFBA 3C3MA 1CD5A 3JYNA 3BL6A 3R7DA 3TZBA 3MGBA 3O3OB 4C08A 3NTQA 3H11B 3PFFA 4BNFA 1MO2A 3KEGA 1E2FA 1L5FA 4F1JA 2F4VB 4ENQA 2AVAA 1YS7A 1NVFA 3JAWB 5DT9A 5HIMA 1FMJA 3BC1A 3LA6A 1V9LA 4G63A 721PA 2H7YA 1O5OA 2DPHA 1Z17A 1V16A 1ZEMA 4KO8A 3PXDA 3HB7A 3EGXA 3ROQA 3WL8A 2J8ZA 4AXXA 3E05A 1W2WB 4IGAA 5JNVA 4AY6A 3NW9A 3ZE7A 1QO0D 1FFWA 1X6VA 4DV2B 8MHTA 1R3DA 1SUWA 1SIWA 4LE2A 4HN9A 3WO1A 3PGJA 2LRHA 1HG1A 2DFKB 3C3KA 2VPZA 2JAUA 2P67A 3EDRA 5EHXA 3CUTA 2VS1A 4LA4A 3Q9NA 4REQB 3RWOA 1EJ0A 4RULA 5CLHA 1UPUA 3N5CA 3QXCA 4M22A 4QVKA 3TPFA 3ZQ4A 4E33A 4EO4A 3AFMA 2V0GA 1CUWA 1JPVA 3FGPA 3E4DA 2OKCA 4MZDA 3WYEA 1AZLA 1ZCZA 3ERCA 3GA7A 2ATIA 3HCWA 4K9QA 3N28A 1ZD5A 2QG4A 4K8RB 3WGJA 3ZYCA 4P4GA 4E03A 1OA1A 1BX0A 4HK4A 3U7QA 4QOJA 4IEIA 3OZXA 1JIXA 1JKXA 1EUCA 5BW8A 4RTJA 4XYEA 1YR8A 5JWOA 4XUDA 3OE7A 1NSFA 2ZK7A 4UUNA 2AVDA 2ABWA 1TX4B 3BFKA 4IIXA 4RXTA 5AM5A 5C8YA 2PPLA 4Q93A 4C4AA 5JUWA 2WC1A 3HPQA 5LJIA 1HKHA 4B48A 1RC0A 3UJDA 1SVSA 2PEMA 3KPJA 1Y4ZA 3WZLA 1N0UA 5JO9A 4G5RA 2F4NA 1USUA 2I76A 3H97A 4QPNA 3LBIA 4ZHSA 5BWCA 1YR7A 2ILTA 3KYDB 3R20A 4GOJA 2L2QA 3K94A 1B1AA 1J99A 2WSMA 4JLMA 3WLTA 4C21A 1MJHA 1TZCA 3K0AA 2PQ6A 1IZ8A 3EQ9A 2QYHA 2YWXA 3NHMA 3AR7A 4QE3A 5AUNB 5FOQA 4R6XA 3B1WA 3E9RA 1GM5A 2HZBA 5ESXA 4MKRA 2PH5A 1RYBA 1HFEL 2ZFUA 3NKFA 4YMLA 1EFPA 2O2EA 3H65A 3KETA 5D3MA 4ZVTA 3B2NA 3HCCA 4KXVA 1T5DX 2P75A 3TEMA 1YR3A 3IPXA 3IDZA 4JKIA 4L3OA 1L5MA 2XYRA 3RYFA 4A91A 5K0CA 5ICEA 4JIMA 3MWEB 5G4KA 3VOTA 1JLSA 3A4NA 3LUBA 5DULA 3WGQA 4BBPA 1I3CA 4EPWA 4ZVKA 2BGNA 1MA0A 4IGFA 4W6ZA 1ENZA 1Q7EA 2VHVA 3V3KA 5ICFA 4BX0A 1LSOA 2EYQA 1DZIA 1MPTA 1SUSA 5ADHA 5EJDA 4JGBA 4HTFB 1CT9A 2Y1GA 4H59A 2LCQA 1KFKB 1T8UA 4DCOA 1NPYA 4AJ2A 2SBTA 3Q3JB 1VBFA 1FE8A 1SRRA 2VXYA 3A6ZA 4AFNA 4AN0A 4X24A 1Q0PA 3FKSA 1WIWA 3OZ7A 4ZDWA 2VDOB 3HCAA 3PQ3A 2FPGB 4LC9A 1QAOA 1N2ZA 2AR9A 1YGPA 4WT7A 4DILA 3RHTA 3F74A 4X64B 1JBEA 2ASEA 2B94A 2DBZA 3TSZA 1IXKA 3GK3A 1P91A 3VSCA 3Q1KA 2CXNA 4EUKA 1JT2A 3SM3A 4OEHA 1SCUB 5FBWB 1R6UA 5C8YB 2YHIB 5JZSA 4YJGB 3UCEA 5H70A 3K71B 4RY0A 1Z0AA 4GKKB 4DS3A 1Q7BA 4DAOA 5GOZA 4RQUA 3PC4A 3I55P 2C2ZA 3HJTA 3BWYA 3WIDA 3AH8A 1P7WA 3E2DA 2EU8A 3AI7A 4N7JA 4FIDA 3VOAA 3QKWA 3EQ2A 4ZCPA 1JLLB 2Z43A 1P2FA 3TKLA 3I2IA 3V4OA 3MTQA 5J63A 1G8GA 3IMCA 1VLHA 4IF6A 4HVLA 4Y8VA 5IHPA 4RCYA 1NVKA 5HKAA 2QR2A 4QGBA 2D1QA 1E5QA 2LDBA 2HRQA 3COZA 3ACCA 4N1AA 4DWWA 3I1FA 5K3CA 1K6IA 2VI5A 3LUPA 1NOJA 3B1JA 4GPEA 3CVXA 4TM7A 2A7QA 5G41A 2QG9A 4QWWA 4CMHA 2HQBA 3AR6A 4CU2A 4BQQA 3TL6A 2C3OA 2VXCA 2VT2A 4UFPA 3KZ1E 4RY2A 4FJ0A 4NX2A 4PLHA 4AX8A 3TBHA 3BH7A 4DMLA 4MA5A 4H7JA 1K3FA 4EKNB 3U44A 2M9MA 3EGDA 3ZKAA 4HXGA 5AVJA 2A9RA 1MQSA 1GTVA 3JAWA 3N75A 4LMRA 3AR4A 3KHTA 2KJQA 4ZXFA 4LZAA 2EATA 4YRAA 4ZJUA 1P1FA 1E9RA 2J46A 3JWHA 2FP4B 1OXUA 4K2HA 1RXIA 3R5TA 5C18A 5H02A 3TZEA 4L16A 5JV5A 3IEVA 5KWIA 5EZSA 2ORIA 5LQAA 2BD0A 3ICVA 3LPNA 5CVJA 5P21A 1VCOA 2ZJ4A 4P31A 1SA0B 2X0EA 2M8PA 4YYEA 1N5KA 3QSYA 4HKTA 5HFAA 1DEAA 2X86A 1VIAA 4HAYA 1IVYA 2HWXA 2I62A 2D8MA 3CZQA 4FFMA 1V5FA 4XPIA 4BX9A 5KTTA 3WLMA 1ZJ6A 3SLGA 1E61A 4RTSA 3A3YA 2O20A 5B1YA 5AK4A 5HNKA 5ENZA 5JRZA 4F2PA 1MB4A 1Y82A 2MSDB 5K0GA 1NVGA 2C7VA 4ROTA 4AS3A 3T8YA 3CNHA 3L1IA 1Y1TA 2O1SA 4BE4A 4KR9A 3D0KA 4URXR 3NORA 1XZAA 1AKTA 2A84A 4RZ3A 4ZDJA 1L4UA 1GQSA 2V54A 4H6VA 4RFLA 2IU4A 1H93A 2IPMA 1Z5VA 3OE1A 1BJTA 2ZIEA 3QPAA 5J40A 1FYFA 3E81A 4DTIA 4EA7A 3INGA 4JH0A 3SC2B 4JYBA 1OC2A 1OI7A 3GNLA 2ZS8A 3T3NA 3OFJA 3QG5A 3KYBA 2BELA 1JI0A 3MQ4A 2IX9A 2XWSA 4EUNA 2O05A 4GGPA 1I3KA 2FR0A 4HL6A 4I4NA 5EI5A 5CLFA 2WV7A 4X97A 4YCAA 4WY2A 2MSCB 1C80A 4UXHA 3D6UA 2BMJA 3EXIB 4Y6SA 5BR8B 5K8VA 4DR6B 1Y9DA 4MQBA 4WZ6A 5FADA 2MHCA 4DTCA 2YL2A 5AOVA 2AQIA 1B8UA 4IMJB 3OA0A 5EVJA 3RSOA 3CX8A 5A9SB 3DNMA 4WBNA 1DFHA 2DWUA 1E4OA 1TM2A 2IIVA 3A6GA 2Q3EA 5DI9A 4F6LA 4DB4A 3GF4A 3G89A 1Y3FE 1A27A 4RIGA 3CLTC 4JI6B 4YRBA 1K68A 4BGVA 3OCWA 3W4KA 4RKFA 2ZI5A 3UFXB 3FW1A 3AZQA 3GB9A 4FWIB 2C78A 4CHGA 4L4YA 3COWA 2IBMA 3H4IA 3L0YA 3L4KA 3FUUA 3VR6D 1KVRA 3O8DA 2BMWA 4PLGA 4M1KA 2BZSA 4LHSA 2GF9A 3L7LA 3PNBA 4ZJZA 1JQAA 1NN1A 2IXAA 4TRJA 3K9FC 1E1RD 4UHCA 4B3DA 1MQ9A 4EB6B 2PX8A 3HFRA 4G1MB 1CEYA 1KYWA 3MSCA 4AZTA 4BYGA 4WKNA 1AQUA 4IEFB 3DKRA 1XCBA 3G23A 3PCXA 2AE1A 4GMHA 4RZ2A 4UVDA 3ZJUA 2F9FA 1SCBA 1U7TA 3JQBA 5CXXA 3V8NA 5C1OA 3NM5A 1VMIA 1CJKC 4A0GA 2X0NA 1DBVO 1WBJB 3S99A 3SEZA 5KQLA 3G1TA 2KX7A 3ZUGA 4Z0HO 2UVPA 3KAPA 1JDSA 3WLSA 1MAWA 5T4EA 3W3AH 2O0LA 3D9QX 3PNKA 4IDEA 1JBQA 4O3MA 2OBBA 5IXJA 5I4KA 4XX0B 1H0KA 2C9ZA 3VISA 2JJYA 4D2IA 4X20B 3AKYA 1JKMA 3A4LA 2H4WA 2G76A 1ZSNA 2Q07A 4HNRA 2AYXA 4OA8A 2FPIA 4AJ9A 1KZ1A 4BIIA 4Z49A 5I3CA 1ID1A 1ZK3A 4H27A 3A1CA 2F1OA 1AUQA 4OQDA 2G9ZA 3PUKA 4U2BA 1JG7A 4UM5A 3OC6A 2ZUWA 1EGMB 1U11A 2ZT5A 2HJHA 3L07A 1ZHFA 5DCWA 4N76A 1IJEA 3IAFA 1DKLA 2IS6A 2XAAA 4EL5A 4R31A 4J1QA 4BV9A 1RPAA 2XNJA 5A7FA 3EFOB 3O4RA 1FP7A 2R5FA 3C6QA 4AAYA 5KNDA 1G3RA 3DFMA 4PG6A 4CKXA 4HDOB 3HZHA 3I53A 3WB0A 4B6JA 3TO5A 1HE4A 1HT2E 3SC4A 2PGAA 1RWOA 4FHCA 2PJUA 3C2QA 2A35A 2PYZA 3I5AA 4C7OB 3CF6R 3QIVA 4R05A 3UG6A 2JCXA 1JE1A 4HQ0A 5IVDA 1RWXA 3WK5A 3HP4A 4WN9A 2VFAA 3A3KA 3DTNA 3GEMA 4AYTA 2JEZA 3QEKA 1TQ6A 3BB1A 4YUWA 1IN6A 1C7EA 4XVRA 2ZSEA 3VZQA 1TT5B 1Z06A 4LF7B 3ZWYA 2X76A 5FCDA 4UEWA 2A1TR 4COPA 3LQQA 2OHGA 2ORVA 1PNTA 4TLLB 1RYEA 1XQWA 4AMUA 1CKEA 1PZXA 3AF5A 3BCHA 4MHOA 3UTDA 2YBDA 3K6SB 5EE5B 3KQHA 1ZFNA 4OK3A 1AKUA 1Z2AA 1Y1KE 1QPZA 2R86A 4C2UA 4U8HA 2ZSDA 2AQHA 3T9EA 2D0IA 2ZTHA 1EFDN 4XR4A 1JFFA 2AXEA 3AJ8A 3NZEA 1NRWA 3O3CA 4TXHA 4B3FX 4YJDA 3G85A 3ZE0B 3R9XB 5ITZB 1E6JP 2AD5A 2B1GA 4HRAA 1X1QA 3FXAA 3IV7A 1JR2A 2XWJI 2Z5FA 3LPAA 1L5VA 3SVZA 2BGWA 2ZJOA 1SVNA 1GQFA 3CW2A 5JSUA 2YMPA 2YWBA 4FI3C 1TPYA 2W98A 3BH0A 3QNWA 1ORVA 3QXHA 4EHLA 1OLSA 2VHQA 3A14A 2X5KO 1MDBA 1Y3HA 3RE1A 3ILSA 5MGBA 3QLJA 4J2HA 3T7RA 2OP1A 3K9HA 3DCNA 3I09A 4MYCA 5FI3A 4M8LA 4EY5A 1DVRA 4K9DA 5ICSA 4CFZA 1JMYA 5F2NA 1CBUA 3OZBA 3IR7A 4IX1A 4GZMA 5EESA 1W87A 4QUEA 2HF2A 3IMFA 3Q9UA 5IUKC 5A04A 4YRQA 4PAQA 1DKOA 3HG7A 1GIAA 2DBQA 1Z75A 4G5QA 1NC3A 5K45A 2FX2A 3AVXA 1LPNA 3LVBA 3MOIA 4BO5A 1J7KA 1N25A 1U90A 1UEIA 2HLHA 3QF4A 4WXHA 2ZJFA 3TZLA 3TTVA 4OI4A 3QOXA 2IYVA 2O8DA 2TMYA 5EPUA 2RFLA 2QPAA 4MTCA 4BP9A 3N9IA 2AN1A 2WYIA 1Z5GA 3V9PA 2F43B 2W2KB 3AVVA 3KJFA 2VLBA 1HH4A 1T2VA 1GPKA 1I14A 1XQ1A 2IEAA 3P8ZA 4I46A 1YXMA 3C7CB 4TKMA 5CFPA 1O0BA 2D5LA 1OWNA 2PYDA 2WTMA 1S5PA 2BFBB 3NOQA 3FCXA 3G9UA 2K7FA 1LD3A 4MPJA 4D44A 2P41A 1QKKA 2PYIA 1VLZA 3IVAA 4HWRA 2X2FA 1SNYA 2IHZA 2NN3C 3E9DA 3QEOA 5HF6A 4OSOA 4YJ3F 5ALJA 3U3JA 1H94A 3FVQA 3LWNA 5DDIP 5A03A 4WOPA 1TM4E 5CFNA 5HJ7A 1X8LA 4MQUA 3PSHA 5AUPB 3H13A 3PQCA 2B5OA 1M8GA 1IUOA 3EASA 2E3JA 5AW7A 4B76A 2XIQA 3DKPA 1K6XA 4QFCA 2ZRHA 3T5BA 2HDNB 3L0IB 3VUEA 4XRGA 5HW0A 3DEAA 4R9VA 3ENVA 5CH5A 3O2SB 4QPZA 3FA2A 1JLKA 2K6GA 4EGSA 2Y9MB 3KEOA 2OXIA 2HRCA 1NMZA 2CLMB 4Y0NA 1XNRB 4WK2B 1M2WA 1R5JA 5B6PA 1TEXA 4HXFB 1IHYA 1MB0A 1PSWA 1RAAA 2ATCA 3HYBA 1GY8A 1SUIA 2DKFA 4JENA 4M0FA 3TW8B 5JI3E 5JAUA 1AA6A 1P4JA 3BZUA 3EPJA 4BNKA 1SBQA 1KC3A 1NUHA 4IIBA 2AC7A 2QSJA 1JDBC 2V4ZA 1V11B 3C8UA 2X1MA 1VG8A 3FAKA 3GFRA 3HVUA 1LK5A 1ADGA 1Y9JA 2FGKA 4JQSA 1ZICA 3DO6A 3KLNA 4N0PA 2WJVA 4XM2A 3CTPA 4MW2A 5EP3A 2AL7A 3MUOA 1JZSA 1L5SA 2OVBA 2VA8A 3KAQA 4LBYA 2KORA 3L41A 3EUWA 2NU7A 3D8HA 2CUNA 2OV2A 4G97A 3ZV3A 1GV0A 1S2GA 2RSLA 5BSKA 4LSGA 3EEYA 5JMTA 3AM1A 1TMKA 3GEPA 2ZZMA 2WUFA 1YDEA 1UEJA 4QUIA 1T1EA 2BIFA 1HDRA 3Q2KA 3Q41A 4YJ3B 5KOJA 1E3EA 4EK9A 2CLDX 1YL5A 3KOUA 4PZUA 5CH3A 5DO9A 5LA6F 1AGPA 2PKXA 1N9GA 2VTVA 5HCUA 1KI9A 3P9XA 4P93A 4OHZA 4JT2A 2Q7DA 1DC6A 1E1KA 5KX5B 1R4NB 3HU1A 3PITA 4M46A 4TRNA 5ENDA 1QOZA 4AMVA 3FKSD 3UT6A 1C4KA 4EW6A 4PYRA 2AMVA 1DV5A 2QYOA 3QV2A 4KV9A 3AU8A 3NNSA 4H7IA 1EWVA 2AA3A 3Q0TA 1E58A 1F4PA 3FR7A 3QOWA 3ZCXA 2IITA 4W1PA 5KYXB 3UUWA 3AEUA 2FW6A 1T3ZA 2IGBA 3JQ7B 1R15A 3IL2A 2Z45A 4HTAA 4C04A 1XU7A 3AVOA 4CM8B 3KOZA 3B51X 1UM9B 2VYND 2XV1A 1ZH2A 3H1BA 3IEKA 4CL0A 4PS0A 5I7EA 1YVUA 4DEXA 2P6PA 5AVKA 2BW0A 4EVQA 1Y8RB 2G4VA 5U4QA 1S89A 2PUEA 4PXHB 1TEZA 2I8LA 1I7LA 2I2XB 4E2YA 4AVYA 1PW7A 3ZBUA 1TJ5A 4ZAFA 5DHQA 2OXCA 3BSYA 3GJ8A 1RW4A 2D1FA 5JS8A 3N2YA 2XPCA 3O0DA 2REQB 3G8BA 4HY3A 3D6HA 1O6CA 2PENA 2OQRA 1BD3A 2A2ZA 2ZXFA 3L7OA 5CW1A 5AKJA 3SQDA 1O58A 3VRLC 1G8FA 2GO7A 5BRAA 5LOVA 2J85A 2GESA 5F12A 1GA6A 1SVIA 3M8KA 2MWMA 1NC1A 2XODA 4IVNA 1NBOA 2YFQA 3LPDA 1AXGA 2RGDA 1E63A 2WA2A 3RAPR 3STTA 3BMCB 3UPDA 2XXMA 1H2FA 4YCCA 2O19A 2VF8A 1DBSA 3EUEA 3IJPA 2QJWA 2X5JO 3BEDA 3L82B 3OPMA 2IHKA 3WO0A 2HUNA 4BAUA 1ONSA 3EXHA 3X2FA 4EF4A 2B0JA 3AI2A 3PGKA 3HXLA 4P3OA 4RORA 2BHVA 4TZKA 2WTAA 4QBKA 5LLTA 3V4RA 2P1ZA 1ZK4A 1UQUA 3OLXA 2OO5A 4PC3A 4RKRA 4AMZA 1J1UA 1XKQA 3LSTA 3FWZA 4PSUA 16PKA 1PZEA 2OBMA 4F3YA 4YRGA 4Q7QA 1SEPA 2EERA 4KO4S 3ZZNA 2YN4A 1HNXB 2VZEA 3RRJA 1TAUA 1C30B 2J87A 2OCDA 3GV0A 4NARA 2RH9B 3DKIA 1EWTA 3IPCA 3WHKA 4G01B 2QL7A 3IODA 5IJXA 4J03A 4DR2B 1M2OA 2PWBA 3BEOA 2NU8B 1NNUA 4JEHA 3WJ2A 2HDHA 5K3SA 2O8CB 3FYUA 1VFNA 1A96A 1BN6A 2W70A 4WJLA 4IDDA 4ZCQA 1JMKC 4GZLA 3KPWA 4XQ9A 5D7BA 5LB4A 3P2EA 1T9BA 1DQRA 5DWQA 1DUVG 4BFYA 1YZHA 5DM1A 4HEA6 3PZBA 4YJKA 4QXMA 4JJIA 4LY0A 1I2BA 2QUHA 1WXHA 2HY7A 4I6GA 4FDAA 4DV6B 3H6HA 4V0QA 1ULHA 3EDQA 4WWHA 2Q2VA 1X9GA 5EXPA 2O2SA 2AZDA 1NGSA 3VSAA 1LDEA 1FRVA 2YYZA 3HYNA 2QVYX 3GJ7A 3MCWA 1VQNP 1PZMA 1Z73A 2ZJAA 3CRZA 2JHGA 4FYMA 2XDQB 3LCUA 1EUQA 4BVBA 4HVAA 1YHNA 2D1RA 2OLKA 1B8NA 2VBGA 3H9GA 1Z3IX 1SBYA 3KVNA 4G4IA 4HX2A 1GV1A 1KE1A 1RWVA 2JFNA 2C3PA 1UWCA 1Z4QA 2R5NA 1ZN2A 1E9CA 1J22A 4N7BA 1W9MA 4LHVA 4P5EA 1FR2A 5EE3A 4KPEC 3KSDO 4CV1A 3R6GA 3H1GA 1CY6A 1G20E 2E6UX 4RVGA 3UXHA 2XGOA 2Q4DA 3FOAA 3SVLA 3MFQA 4FDLA 3HA3A 1O77A 2JIZA 1WVGA 4BRUA 2GJAA 1P6XA 3MHTA 4JCOA 1W4ZA 1UBGA 3AXTA 3DOOA 3IMGA 4MWGA 4LTMA 4R1TA 3L1HA 1V8PA 4DJ5X 2WSBA 3AHCA 5DWVA 5F2EA 1NMEA 2FRVA 1PGPA 2C94A 4BXOA 3L49A 4BVHA 1PLJA 1XYGA 4N9WA 2NZJA 1Z47A 3IHKA 4AECA 4NVRA 2D06A 3IGFA 2X6QA 2V7QD 1W7AA 1QB7A 1E1LA 3GRPA 3K92A 3QXJA 1SCDA 5F77A 1B93A 2O1XA 2VUIB 3AUXA 3LWZA 1XNJA 1XXHE 1TXGA 4XI9A 4LAFA 4ZO6A 1QK3A 2I65A 2C1EA 4WBXC 1UBMS 1NFRA 2H07A 2O2DA 3LCRA 5EE0A 1RAFA 3H87A 5AICA 2IPLA 4KB5A 5B3LA 2ZE6A 3U19A 3KEMA 1OW3B 1DV1A 1Z45A 2BE9A 1FFSA 4TOIA 4BV2A 5EIXA 2HBYA 2YKGA 4JWTA 1UKAA 1BIFA 2QX9A 1K8ZB 1ODKA 4G0WA 3QK7A 2AFIA 1IIBA 2CD7A 1Z5NA 4KHPB 4RVCA 3CYFA 3WE7A 3A11A 2ZQ5A 4ARSA 3ICQB 3PDIB 4OUDA 2FPLA 1II0A 1OIWA 4DMHA 5TB5A 1WZIA 1Z0FA 1R6XA 2WZQA 3I83A 3AIKA 3JASB 5KAPA 4QULA 3DS3A 2XT9A 4RE6A 4FHZA 3B85A 3PVZA 5ALXA 4C30A 1XV5A 1KH3A 2JIQA 3WKEA 2V4UA 2PHZA 2PZLA 3HA2A 3ZJTA 1LK0A 2OPBA 4UBKA 4I1RA 5I4CA 2Q9AA 5CLQA 3JSAA 1GPUA 2F9LA 3RANA 3O8NA 1LVUA 5BW5A 4MWEA 3CW8X 5JAHA 3GJSA 5D51S 2EIHA 4BP1A 3L5KA 5FF9A 4E7PA 3VYTB 3W5DA 9ABPA 4CQMD 1V7CA 2YC2C 3HN2A 4GPBA 4I19A 3KQYA 4BB0A 5JDCC 3CKMA 3UUEA 2NTNA 4ARUA 5EUMA 2QRPA 1RWKA 4YMUA 1P1KA 2GPBA 2A1IA 1EUZA 2R65A 4YP7A 2NVUB 1TCAA 1MW9X 3RFVA 3IAM6 2PY6A 1KFCB 3ID6C 3A04A 4URHA 5CURA 1V1MA 5EZ5A 1Q82Q 1A2QA 1QIHA 4M0MA 2EKPA 3RVMA 1E1RA 3PL5A 2BKLA 4QOFA 3HR4A 5I45A 1YCFA 2CDAA 2CWWA 2HBRA 4UHKA 1LWNA 1Y3DE 3Q20A 2Y8EA 3SJCA 1RLUA 1WBDA 1NU6A 4IR7A 1OBVA 1OBFO 1Y1SA 4M98A 2AMYA 5L40A 4D8YA 1DAMA 1U3VA 2NO1A 4Q4JA 2FW8A 2ODTX 1Y8ZA 2YOGA 1XZPA 4GDFA 2L22A 4OFZA 3C3WA 1NF3A 1KBQA 1Y3AA 4P81A 2CDBA 4AN4A 5J2UB 3FWNA 4Z7JA 2LKDA 5JNTA 2JGIA 3O8OB 1DC3A 4LYFA 3AK4A 4Z3DA 3RYCB 4B3GA 1P75A 1QQ7A 2FPWA 2AFDA 2QN3A 3AQ4A 3FSRA 5I48A 3GJ6A 3S2IA 1AY0A 2OV4A 2E7ZA 3N0WA 2AXQA 4C3UA 4GPTA 1Q3KA 3KQSA 1W4CA 4FDVA 4DLKA 1G6KA 2AZXA 5EZ6B 2DHRA 2XQIA 3PUHA 3IUMA 1ZO8A 1H05A 1ZOLA 2FEWB 2J45A 4RPCA 2W22A 3VKWA 4P7FA 3EF1A 1N9ZA 4RKYA 3T3DA 1DJOA 5E4YA 2YZGA 1A9OA 2P6UA 1TF7A 3FMOB 4ZQGA 2ORYA 5EW5E 2CF6A 1GAWA 2Y0EA 5L9AA 2K5UA 1V3QE 3IO5A 3WRYC 3ZY2A 3K2IA 4D57A 4GEGA 5FQNA 1FUEA 2R1VB 2I3ZA 3O38A 1EGQA 2CLFB 3E15A 1GTSA 1T4CB 1XTPA 2CN1A 3VYVA 2AOTB 1Q1ZA 1Z62A 4QJ3A 1NQWA 5KNLA 3M5DA 4OHOA 3GJ5A 4Q3AA 4Q1DA 5BWMA 1O0CA 3TNJA 4YAFA 4ACAA 4I4TA 3U37A 4ARZA 1T24A 1G8YA 3CWCA 4PN3A 1BROA 1BXRB 4BN4A 5K6RA 1P0CA 2CVQA 2VSXA 1A69A 1RXYA 2AX4A 4DV0B 4IYJA 3G3EA 3EY4A 3F6EX 3NDRA 3IQDB 4BNZA 1HTWA 1EIWA 3PQ6A 4MX8A 1SQ0A 4HB0A 1D04A 1ZUHA 1ZJ5A 1YS6A 4IOKA 4DIDA 1O9GA 1JIJA 1K5GA 1MQAA 1VL2A 2ZWAA 1QVAA 3KHUA 3SZMA 4CIYA 2BGGA 3O93A 3VMFA 3VHXB 1VSQA 3AR3A 3OCYA 2NUTA 3BMNA 3EZ9A 1U63A 2JH8A 4U9UA 4PG5A 3DDOA 4BNJA 4Q4HA 2VP3A 3ANLA 4H15A 3ZBPA 5F4BA 5DGHA 4BQSA 5B2EA 3RK4A 1ZNWA 4ZZ1A 1W2BO 2WKWA 5A7HA 4DWVA 3TNFA 3DHEA 4QLBA 4Y7CA 4IG9A 2WT4A 5HE9A 1FVXA 3W6NA 2YBEA 2WWFA 3DBRB 3WB2A 1APBA 2R1ZA 3WNVA 3FYSA 1SVWA 2EYUA 2V7PA 1QGZA 2EG5A 3JZIA 3ZY5A 3FOCA 2W48A 1X87A 3QBDA 5BS1A 3WNDA 3DWFA 4NXNB 5FYQA 4ND5A 3QPBA 2BI7A 1EIAA 2IUTA 2C29D 4OHRA 4AS1A 1CIVA 5KZMB 3TGPA 1EVYA 3WIBA 4ZMSA 1GTG1 1RYHA 4U1RA 1C8BA 1BMFD 4TMFA 1O9BA 2JLQA 2JIZD 2XKAA 3N70A 5JJLA 3OE7D 1MNAA 4NZMA 1V45E 3D3QA 3UK0A 2R66A 3JVUA 3V4SA 1WTAA 2XNDD 2VLQA 3KZCA 4I1OA 4OXIA 1Z74A 1SCNE 1GGHA 3FPJA 1EG7A 4QBHA 1U6IA 1F7VA 3KKMA 4EGFA 3HTXA 1KR2A 3WTBA 1PFWA 1G21A 2O2JA 3JZDA 4ZVOA 3OJLA 3CD6P 1RU3A 1VA5A 1M7GA 4QPPA 5H3CA 5KPDA 1Q1BA 2L82A 1FQKA 1IHUA 3KRTA 3NEJA 4XYBA 1GZ3A 3V1YA 2XQFA 3MXOA 4H60A 3WGNA 1HQYE 4YP5A 4ZQBA 4KUEA 5E6UA 4BNGA 3ZHOA 3OFNA 3N3BC 5CYOA 4EFNA 1EDEA 1I1HA 1W4BA 1KFEB 4M8NE 5LMNB 2YFKA 4JASB 2J9YB 2IEDA 3GU3A 5DPMA 3IFSA 3AILA 2VZ0A 2BJHA 1K75A 2XYGA 3I72A 2B35A 4O5AA 4TTVA 5U4XA 3TX2A 4DSNA 3RNOA 3TW4A 2A9OA 1AGXA 1K8QA 1YKFA 2PUTA 3I23A 4F3CA 3A8TA 5IP5A 2PZFA 2H17A 4YJHA 1ACPA 1Z0IA 1O95A 3W4JA 1GRNA 2OCIA 3G0BA 4FDTA 4OMCA 3PS9A 4GMFA 4X6XA 2JA1A 4YP1A 4ZMBA 1ZY2A 3HY4A 5DP2A 4D25A 5CXSA 1F17A 3MYYA 3Q2IA 3B8HA 1CRWG 1GL7A 1OFGA 4KG7A 3A7DA 5DU2A 1CJVC 2GZ3A 4YV1A 3CLVA 1GO2A 1O94C 1U0LA 2NQ8A 3WLIA 1XEAA 1R0WA 4NIMA 2REOA 4Y1GA 2ZRQA 4TPKA 4AQDA 3NVMB 1A72A 1JDZA 1YQEA 4YFYA 1E9FA 1JQKA 1W85A 2GBPA 4LCJA 2O8BB 1N6PA 2Q8QA 3AU9A 3ZIUA 1MX9A 3DWGA 2O14A 3L01A 1GRCA 4IFTA 2VT6A 1DSSG 3L6UA 5GM1A 2NXWA 4HYEA 2QW0X 4JL8A 2VAVA 4P0QB 5BQ5A 1L7RA 1OUMA 1V1RB 3TJRA 1WMSA 3O4HA 3IDOA 2Z98A 1Z0KA 2JQ4A 1IUKA 3AMVA 4M6WA 1V8OA 5FAXA 4KNYA 1G64A 1LY1A 2HT6A 1DJMA 2ZWMA 1O95C 1DV2A 4INPA 4IRXA 3I34X 4DWOA 2IYNA 4QGFA 2GM3A 4DBVO 5FTLA 1O6ZA 2GZSA 3SBXA 1SC6A 2KGDA 2EIXA 3RVKA 1XF9A 4KQ1A 4FMDF 3JQGA 4MIOA 2YY7A 2QQ5A 3FFWA 1U2EA 4WAUA 4IILA 2FEXA 2PEIA 3SHOA 4W9NA 5CBKA 2R3SA 4GKAA 5BMVB 1I2DA 2E18A 2HA0A 1DAGA 3E7WA 2BFCA 4HPWA 1GCUA 2LKCA 4NFSA 4CM4A 3BZWA 4M0PA 2FWMX 4RF2A 2Z6UA 5IAGA 1M8FA 4XGIA 2JD0A 1E1QA 1ULZA 2ZI4A 1NF2A 5B3AA 2X15A 4Z4CA 1NJGA 3GJ0A 4I4LA 1U0RA 3Q0EA 1DS6A 4QQKA 4I5EA 4MINA 4WW0A 5IX8A 4KX3A 3LHDA 4DIMA 1EFVB 1YGYA 2CMDA 2VYNA 4CBVA 2VVTA 3INRA 4CMBA 5IAEA 4B0PA 4Y6GB 1ZRNA 3ONFA 3EMDA 3BG5A 3VJRA 4TLCA 4C05A 3FPKA 2GHIA 1XTVA 3QA3E 1NBME 4KXUA 5EKSA 3NHFA 4HNTA 5HJ2A 1B8PA 3E8MA 3NIGB 3Q5DA 4GEKA 4MULA 1P4AA 3MRVA 4UMDA 5FPQA 2ZIGA 3K20A 4MJ7A 4QBIA 1A7JA 1XQ9A 1UBCA 3DNPA 4MVJA 1R50A 1BEEA 1TW3A 1U3FA 3WGGA 3K0EA 1NT4A 4YRJA 1T10A 1NASA 2BGLA 1STOA 4II7A 4US0R 4F04A 4F60A 4BTEA 1U5BB 4D4GA 4U3JB 3GDWA 3SNKA 4JAVC 4Q1CA 4OQ4A 4YWJA 1OWMA 1Z22A 4M9ZA 2R6R1 5DTMA 2GBGA 2IJGX 3BTOA 3EMKA 4CVNA 3U49A 2QL9A 3KDPA 1WXFA 6ADHA 5J2TB 2IYFA 5AJXA 4O4IB 1DCFA 3RK1A 1NQVA 2JGNA 4OCZA 5JSZA 1LI4A 4AUKA 1P3JA 2PQMA 2NT3A 3PK0A 4BASA 4MWCA 5BMOA 3USZA 1VECA 3AEKA 4ZI3A 3D2LA 1XT6A 3FFTA 13PKA 2XTJA 4MMXB 3BH6A 2MCFA 5LJLA 4EMUA 2QM0A 2OXFA 3RI3A 4EYKA 5AKHA 4I9GA 3QYFA 8OHMA 4O4HA 3AYZB 2D1SA 3TNYA 1CVLA 4AL4A 5JECA 1FOEB 4NNOA 1Z6TA 1JIUA 2JF0A 2VIIA 1MIHA 4O2RA 2Q29A 2GTPA 3PV0A 4KYIB 2LP4Y 4ZHQB 1XDSA 3ZD8A 3DEJA 1EDDA 2VSNA 1MJNA 1H1LA 4AP9A 1OX6A 3H0KA 1P61B 4JYCA 1EINA 1Z4LA 4UQOA 5HIJA 3TZQA 3RT9A 3WMFA 1Q50A 4TMTA 4YJFA 3W5CA 5FHQA 4YRZA 5G53C 4M1MA 4Y0VA 3CG0A 1NJIQ 4PRYA 1I7PA 4AQYB 1OZGA 3HWSA 1QKIA 1SELA 1CJUC 2XCQA 3BK1A 3E8SA 5TMPA 3UC9A 1P72A 2L18A 3IEIA 3I62A 3RG8A 3ILYA 3EVNA 4DRXA 5L7WA 4HNVA 4MPTA 4NONA 4RA6A 4MICA 2JLWA 5FI1B 2Q3FA 3LDGA 4F91B 4LECA 1HFWA 4DA6A 5GQSA 1J1ZA 4F85A 2BBSA 3NEAA 1WUIS 3WQQA 1I3OA 1I30A 2ZRLA 1MC5A 1G9SA 4BE9A 1GXHA 3ZE6A 3FIJA 2VQ6A 1DOAA 4BFWA 4IV8A 4JLKA 4HN2A 4D26A 1P9RA 2EW2A 1JU9A 1F51E 2WT8A 1USIA 3R0XA 3U7JA 1KAOA 4X1IB 4CN9A 4UFNA 4FKBA 4TS3A 4U0AA 1MBZA 3O90A 3RKRA 2QVZX 3ENWA 1JIQA 4LMPA 3EMVA 3KKKA 3RFXA 4EFLA 4FDMA 4CCYB 1SFRA 4H2XC 4KQHA 3LNCA 4M99A 5HILA 4D46A 5BUQA 4BNNA 2Z2IA 4L85A 4MRNA 2RHLA 2FN7A 3SSMA 1P73A 3NHAA 3FKJA 3FTPA 5ALGA 1ETUA 5FWAA 4ZV9A 4BOYA 5KYWA 2HB6A 3UT5B 4II3A 2J09A 3I3SR 3I2JA 4XIJA 3VPDA 5A0TA 1XI2A 4CQMA 5HCNA 3EDMA 4LVOA 2HUPA 3FJ1A 3LPCA 3M1YA 3QFCA 5KNCA 5CH8A 1KZHA 1FTWA 1RTKA 3BQ9A 1TZ2A 3TSWA 4PNEA 3ZJVA 1GZ7A 3QPUA 2ZJ5A 4HGPA 3LT0A 1VHNA 2HR1A 4GYYA 4FN4A 3BT7A 1YBHA 3HB4X 3CH5A 3SXJA 1EFHA 1RYDA 2WF9A 5D5HA 4XXHA 3ZK9A 5C35A 3KT8A 1HEIA 1GPBA 3DZHA 4GLFA 1ODCA 4JODA 1O94A 4A0FA 2I4IA 4PWYA 3WBJA 2HU2A 1ZD2P 1FMTA 3AOEA 1NN3A 3FPEA 3H42B 3N5KA 4N5DA 4B17A 4F9TA 3MTAA 2UUCB 2ZI3A 3RLIA 5K6AC 2R25B 3A0UA 1G3UA 3GLHE 2NQ2C 1TECE 4F5ZA 4Q03A 4V1CI 4NU6A 4JSRA 1WUYA 4WVLA 1ZNYA 3UUGA 2O57A 3RSHA 3TOVA 1IC6A 4OXXA 3BSFA 3PPVA 1EA7A 1D2GA 1WDKA 4ASUA 1QVFO 4R1MA 1RKVA 2W6QA 1HT3A 2JK0A 4OH7A 3GCZA 4W8OA 3LL4A 5H4HA 2VWPA 3PSAA 9GPBA 4QTZA 3QLEA 2EZ9A 2ZZNA 2QORA 2QNBA 2XMPA 1XQ6A 1GG8A 2DSTA 3L1VA 4A8JC 4CMKA 4UTPA 2Q21A 5C3MA 3HCNA 2UVQA 4YJ2A 1VHJA 3KSZO 1RHKA 2HXGA 3GFTA 1UOQA 5J5AA 4IQGA 3C74A 4HFMA 2AR0A 3Q9SA 4MVJP 2GFHA 4NOKA 1QYVA 2ODPA 2PL9A 3ABQB 4MS4A 1GLVA 2VYVA 3FZGA 3GO4A 4TYMA 1QG4A 2FSIA 4HZUA 3AI3A 3PNVA 1AHIA 3LC1O 5DE3A 2FW0A 5JLAA 4ZOQI 3ZWDA 5AUQA 5KKCA 1IONA 3GUYA 5K99A 1M2VA 1U0GA 3B1VA 4BCCA 4RTKA 4BO8A 1SG0A 2IQIA 2Y4OA 1IPFA 3DE1X 1C0KA 1Q86Q 2F48A 2WTNA 3HJBA 4F9EA 4O4JF 4K81B 3FH0A 5C8DA 1Z2OX 1T0BA 5HIIA 3M9LA 4IVRA 3QKUA 1NVEA 4Z4EA 1PBNA 1PR2A 3G8YA 421PA 5FLXA 3QPVA 4XJVA 2DTXA 4QU9A 3JQPA 2XUGA 4K88A 4D6XA 2VHYA 3F2IA 5JAPA 2AZMA 1EJ6A 1GGMA 3DFIA 1JEEA 2WICA 2CQ8A 3RFCA 1KEEA 4B47A 1GNTA 4RLHA 3QLVC 2E1RA 3PWSA 1UK6A 4CF4A 1U0SY 3ZHXA 1QGED 1W19A 2PRYA 4MW7A 2X2EA 4FLMA 2ADFA 4TYPA 2X4LA 3K1TA 2PUHA 1YJCA 1KQNA 3DDZX 1W88B 2BHSA 3HUFA 3I04A 1NBWB 3RDPA 1V1RA 3NHJA 1LDNA 2DOKA 2JH9A 2VJYA 3T7SA 1BMTA 1RJWA 1VQMP 2WWXA 3ZK7A 1IMJA 1DADA 1QZ3A 1NJ8A 2AH5A 1M1NA 2QT1A 2YCLA 3SEAA 3WIEA 1K3UB 4DLWA 3AEXA 4E08A 5CBPB 3EHEA 1LLDA 1Y7HA 4O8ZA 1NA5A 1X7XB 1CIJA 2HIHA 2OYCA 1A76A 4ARIA 2ROQA 1W85B 1ZJJA 2O8BA 4HUQA 2SCUB 3AM3A 2PRJA 4JX8A 5U1PA 1QJCA 3BWXA 2OHFA 5M2QA 2PY8A 3DTVA 3LL7A 1KQSO 4IIEA 1R66A 3GFQA 1JGTA 5DWDA 3G2MA 3CH6A 1OFUX 1XDGA 2PA3A 3N86A 1VQPP 2BUBA 4JB0A 5FNVB 4A5OA 3QYAA 5ADWA 2OQ2A 1U8EA 1JEJA 2P9JA 4WFKA 2JD1A 1NP3A 1TT7A 5H4GA 3VDXA 2WNSA 1LQUA 1GSAA 2YDYA 3SPXA 2LMLA 2IUFA 4KZPA 3TVDA 3WFZA 4E2XA 5BSVA 3IV6A 4IQ8A 2AN5A 4JVMA 4M7PA 5EL0A 1OYOA 2VHJA 5ED0A 3DQQA 4ILEA 5LIRA 1WDWB 1JG2A 5CLGA 1CW2B 2C1XA 3UWOA 1AGYA 4WZZA 1NYTA 2R00C 2LTAA 1E2UA 2PQ0A 1JAIA 3B48A 1CCWA 1TJNA 4IJUA 5AW6A 3SFZA 4WDRA 2LGJA 3NHBA 1YCHA 4L4XA 4OSEA 3OESA 2I1WA 5KDLA 4NJEB 5JCZA 3Q3VA 4KX5A 1P1JA 2G09A 2X0FA 4KVZA 3ZWKA 5AVOA 1X8KA 4WESB 5FOXA 3PQEA 4GLLA 1CZHA 2XYPA 3H5RA 3E3AA 4XSGA 5HGMA 3QEBZ 5KU1A 4ZVNA 2YWJA 5E4JA 4EJFA 1BXGB 2O7RA 3HUUA 3DD1A 1PJBA 1F8FA 4HYTA 4QQRA 1B43A 3BWEA 2VZ8A 4BX2A 3Q5EA 4NI5A 4HWOA 2EF1A 4WXRA 3MJSA 4BE7B 2XUPA 1UZLA 3ELDA 4NEHB 4PZCA 3ZVKA 1CPYA 2XNCA 1DQNA 2X5NA 4AX4A 1D1SA 1EU1A 2CFSA 2Y05A 4UHBA 3FCUB 3GG2A 4FMBB 1MEJA 2ZRPA 1DRJA 1YQ9A 1MVNA 5B58C 3MWGA 4MW9A 1Y63A 3P9ZA 4YRPA 3BMXA 1LW7A 4V0SA 4C1BA 3QNMA 4U0FA 1M2JA 1ZK1A 2QP3A 1LX6A 1TTTA 1Z5UA 3JRNA 3C48A 2L0QA 3NALA 1KSFX 5IMSA 1GUFA 3K70B 3BX1A 2DH6A 1G7SA 2BEVA 3RT7A 1PS8A 4XJTA 4CUKA 1ZXXA 1XWIA 1X1CA 2HI0A 4CLDA 4N0QA 1DBQA 1JXAA 1T2NA 4FB4A 5ALLA 2QAGA 1NHGA 2EFGA 3JQ9A 4PW0A 3DBRA 4YACA 3LVFO 3NRJA 1T9KA 2JI9A 3B6JA 4P0PB 3WWEA 5KAMA 1T2UA 2OECA 5A3VA 4DLXA 1PSDA 2YMQA 3WSWA 3F4BA 3DBOB 1VCMA 3CB4A 3GLRA 4JC4A 3L8EA 5FOVA 4FBMA 1JR3A 2Q28A 3SZGA 5CYGA 5CDYA 3UEOA 3HVHA 3U4QA 1GARA 5KVVA 1EAYA 2XBUA 1GGKA 5FPTA 2M8LA 3I56P 4S1OA 4L9RA 4E15A 4P33A 2V7UA 2PGLA 4IXWA 2VSYA 2I54A 2HHLA 3AJDA 1KRXA 1Q15A 5FQOA 4UPEA 2ZPUA 4JL6A 4I9FA 3ZXXA 3ZHUA 4E5UA 3GLFB 1PDWA 4NJMA 4JP3A 5DLPA 1GPH1 2VJCA 3COJA 4AKHA 1HZZA 2FOIA 1QHSA 2NU6B 1B16A 3DMYA 3UJAA 4DCSA 1AKQA 1YDHA 2Q99A 1KU6A 1KYYA 1YB6A 2PWAA 4MKXA 5COQA 1E2BA 2RBGA 4KQWA 3P0FA 3N8KA 5E9QA 2NIPA 4LFBB 4NYMQ 4F71A 1RZUA 1HG0A 3LRPA 5A02A 5E7IA 3SIPA 4CLHA 3KR2A 1A0OA 3I6YA 2R1VA 2VH2A 2OILA 2FR8C 2JKYA 2QB5A 3G7NA 4R9SA 4C3VA 2JIDA 3OUTA 4C07A 5CB4F 1CUDA 2Y67A 3EUAA 4FJ1A 4I8IA 3PTLA 4NH0A 3GEDA 5DYGA 2I7CA 2PS1A 4RH0A 3IT0A 3N7UA 4JJ4A 1RPJA 3ESBA 4OV6B 1GPJA 4D9GA 4UULA 1RQ2A 2H2DA 4UEOA 4HXYA 4WKOA 3CUKA 1FP6A 2K2WA 2XOEA 3AVQA 3RIMA 1Y98A 4A92A 4YUZA 1V5EA 4TT3A 3CFYA 3SDSA 3H4EA 2XQJA 2DNWA 1SVKA 4MI3A 1D8AA 1SU4A 3S3TA 3SICE 4H1WA 1Z6AA 5JEEA 4N5IX 3VXKA 4YT4A 4AF6A 4O25A 5ITSA 1JPNA 4HRYA 1XWFA 4ZVUA 2VOEA 3AZOA 2JLAA 4G86A 3HCFA 3COYA 5HKKA 4KCGA 1SH7A 5B1SA 4PBRA 3DMDA 2F8SA 2EHJA 2ZBDA 1ZAKA 1ORDA 4RMNA 3PR1A 2RGCA 3LW8A 4PQFA 4RACA 5AT1A 4M9UA 5D8DA 1LRLA 2CGQA 2EGGA 5D86A 3RM3A 3ZWAA 1E6UA 2WHYA 1W5AA 3JALA 3QUQA 4JBHA 4O2AA 4H1HA 4O8CA 4X41A 5F3WB 3NJRA 4F3NA 3JARA 5IDYA 1L5KA 3C5HA 1K5DA 1X1DA 3MTEA 4S35A 3MS2A 2HBQA 3NV7A 2JH3A 2NZVG 5EYPA 2WPDD 1F3OA 5JEDA 1PVOA 4UVEA 3B5JA 3LUGA 4Z9XA 3S29A 4KLRA 1TRHA 3OJ0A 4IHJF 3VH3A 3PFKA 3L7CA 4RANA 1V1MB 3L43A 4X60A 3MUNA 1L4FA 5A3RA 1W5BA 5ALNA 1TVMA 2Q5JA 1E3QA 1BVRA 1T13A 2XVXA 3R3YA 3A28A 3CV3A 3G2LA 4Y9RA 1M90Q 5EA2A 1FNMA 3WDLA 1VL6A 4QUGA 3JAMA 4JYMA 2YWEA 4D4KA 2JDID 3STUA 1KI6A 2MR5A 1SCJA 5ALIA 1PR6A 2I2CA 4F11A 5CDGA 3W7VA 2ATXA 5BXYA 2Q5HA 5AJYA 5TIIA 5AWFC 3HSSA 5JG7A 2V6JA 4CEHA 1I4TD 1NW6A 1ISMA 3C0KA 2IWHA 3T5CA 3S2UA 5JBNA 4DIOA 4GKVA 4EHIA 2Y2UA 1PDOA 3CPJB 2XYHA 3VZCA 4FOLA 2G0NA 1XMPA 1H3NA 1LDMA 4HDMB 1K98A 3NTEA 4KQEA 4YXFA 2JLRA 4L22A 2XMSA 2JFXA 1NIPA 5MFZA 2IY8A 1VIMA 3HP1A 1GT6A 1C3JA 2NXEA 1ECCA 4UQPA 2QTLA 3EC7A 2BPOA 1V3VA 4C0LA 1FNDA 4P2GA 1GXSB 3K2QA 1ILWA 3DV2A 3H5IA 3TLAA 4X3CA 1LTKA 2ZITA 1ID8A 3I5UA 1K06A 1HOXA 1W9HA 5DM70 3VNUA 4TVSA 1FDUA 1QHNA 4LFCB 2FG5A 3GPBA 3BIOA 4QDUA 4TS9A 2XQVA 3WP0A 5BORA 5CA1F 3WGMA 2QMQA 1J06A 4TMVA 3V4ZA 1KDPA 4NJEA 4PIVA 2Q27A 3KFVA 3RIGA 5EPEA 4JB8A 1XPOA 1VE5A 4JP8A 3O74A 4QNRA 1HE3A 3ICWA 3OKPA 2BTEA 3NOXA 3HDVA 1ADJA 1KERA 3WYCA 4HZIA 4X9XA 1GU7A 2BUCA 2J67A 2WIGA 3O9MA 1MDFA 3OIVA 4RDXA 1RZ3A 2O8EA 2QMYA 5HMMA 5TY0A 3T3GA 3WLAA 1H2EA 1RHUA 2J3HA 3ZU6A 1WQ1R 3OY7A 1WPGA 2O5RA 2F1JA 4FLEA 1VRVA 4R1PA 1KOJA 3GLKA 2C59A 4B82A 5HHTA 1MJ5A 2VHTA 2IXGA 3QE4A 4H6XA 4N0DA 3D4BA 3RIXA 1AKWA 5A06A 1IWBB 3A36A 3RT1A 2QP4A 5P8WA 4FFWA 1RAEA 2IDMA 3WDMA 1GQYA 1VBNA 1YFJA 2PR2A 3MLEA 4B4WA 2VTKA 4EYQA 5TJ9A 1R0SA 3JXEA 3PQ8A 1EK5A 4HUQB 4M7RA 1OBHA 4UD6A 2PVSA 2Z56A 3HXKA 4ZVLA 1MTOA 5FI0B 3Q3HA 1KI8A 4UJ5A 1R16A 2PRZA 2XDQA 4NCKA 3IHTA 1KEKA 2K0YA 3C1OA 1RPTA 3MA0A 1IVSA 2POQX 2GZMA 4ZOLB 3HB1A 3L4BA 5C1BA 4FBLA 4YTEA 5T4BA 4LXUA 4C88A 4QHTA 2WFAA 2KW2A 1R6VA 1BJKA 1P0QA 2DQYA 3NP9A 3CA8A 4L3WA 4R81A 1BW9A 3T3IA 3ZGOA 1YZYA 4BRSA 4YT2A 2Z8XA 3DBLB 3TBKA 3UY4A 5TQ0A 1MG0A 3DJFA 4PHGA 4FD2A 1N8KA 2MSNA 2GHRA 4MUAA 2ZR9A 3ETGA 1ULSA 1GTL1 3IEXA 4K9PA 4U7WA 4UM8B 4Y2RA 3SLKA 4OPMA 3MJTA 4F3KA 1KEEB 1PJ3A 3B9RA 4LGVA 4M1TA 4XQ0A 3EH1A 1ZX1A 5D1NA 5DCUA 2EGHA 3S5UA 5K5EA 1JYSA 4CF5A 3JWPA 4J29A 5LMCA 1UDWA 1H65A 1TUIA 1U5CA 3LBAA 3GXBA 4UDYX 3PXCX 4C0KA 1FU4A 4AM8A 1NONA 4PS1A 1IAQA 3ODGA 4UATA 3QQ5A 2R8EA 1IHOA 3K4PA 1IQ0A 1I33A 4XJXA 4F96A 2PUWA 1W4RA 5AIBA 3KCNA 1RJEA 1XALA 1MD9A 1SZJG 1CSEE 3MZ0A 4V2IA 3RUIA 2CUTA 2IHYA 4S1NA 1YRLA 4Q18A 1ONPA 4W9RA 1I13A 4RD6A 1VGVA 1MC8A 4QRHA 6REQA 4C4XA 3PRKE 4NHOA 2WZCA 4KGDA 2HV8A 4R9NA 4E5YA 2XCRB 3HKEA 4KLNA 4Q02A 1QANA 2NTEA 4I5GA 1DTSA 4EMBA 4MDHA 2CZQA 5L6MB 1TO6A 5A6SA 4NYIR 2C4KA 3G28A 5HPYB 5IAOA 4IKEA 3ZQUA 1GPDG 3WICA 2ZREA 5KYGA 1MW8X 2H0QA 1UWLA 2GBCA 3ZWVA 2P65A 5BO5A 2PSEA 1X1RA 1VMAA 5EPOA 4EEZA 2ZE8A 3VH4A 2J6IA 3A1FA 3WISA 1RC8A 5G1PA 1G5RA 4WMLA 1R5OA 5ALDA 1Q1QA 1RMQA 1A8OA 1CQZA 2Q3MA 2WINI 4Q3EA 3SIRA 4MHSA 3TECE 2R0QC 3G2PA 2H1IA 4P54A 1NMSA 3E7PA 1G2QA 1N2BA 3LCCA 3HNRA 3Q40A 1OLUB 2FEKA 3G0DA 3T7KA 2VK8A 1JIKA 2IXEA 2ZTSA 4M0CA 3BSWA 1HORA 4U2FA 3GBSA 1VQOP 5B57C 1L4BA 1ZA2A 4BEBA 5FV4A 5K3OA 1QMPA 4GR2A 3MD0A 5JWHA 4PGFA 1JYFA 2WZBA 3ELYA 2YRWA 4LRUA 5CVEA 4CM8A 2NO0A 1CF9A 4AY2A 4ITVA 1FX0B 3D7LA 2HQOA 3QHPA 1PQUA 5EXEA 2TS1A 3ZDFA 3A3PA 5DM60 3OM8A 5HXAA 4YMVA 4Y3UA 3FGNA 1Q0UA 4QUBA 3QVTA 4INZA 5H9VA 2HLDD 3IOBA 2C9BA 1XVLA 1A9ZA 4YT5A 1LZLA 2Q1SA 4ZU6X 5KSPA 2B1IA 1NMQA 2ZSHA 1JEOA 3DO5A 3MRTA 4NMHA 2GCIA 2YOHA 3HN6A 2PEYA 5I9MA 2VF5X 1ILEA 5CFMA 3ECCA 3ET4A 3IV9A 2PUFA 1NXXA 1RXUA 1JL3A 3C97A 4KN8A 4KQIA 4Q24A 1NXWA 3TEJA 4A23A 3WMRA 3U4CA 5JJIA 5A5EA 3IOYA 1SN7A 1U0OC 3WK4A 2HSEA 3IURA 3GA0A 1I6MA 3WKBA 4K5QA 1G5QA 3MJRA 4F7DA 1O8CA 3TZCA 4EY3A 1LDGA 2COEA 1UKZA 2QE6A 2NXJA 5A5VA 4CCYA 4BMCA 1XHEA 4FI3F 1O57A 3G5TA 4OB6A 3C4QA 5D6OA 1VL8A 2QM7A 4AUNA 5DISB 3H83A 1JDNA 2FMFA 3GLUA 4KC0A 3IUYA 1M34B 4QDZA 4X1IA 2WWRA 5TSDA 4Z7QB 1WMBA 1GZUA 2FDRA 2DTEA 4XD2A 1CRPA 2WPTA 1ISHA 3FHCB 5I8WA 5AOCA 2NPOA 6NULA 3AIOA 3NYRA 4XIIA 4OGFA 2C31A 1Z8FA 1TD9A 2G1UA 2OAP1 2P6NA 1YRQA 2V5VA 2VJDA 1J56A 3G0IA 5CCBA 3PXXA 2CV0A 5HGOA 3LDHA 3TTXA 2KG9A 2ZRMA 3D6FA 3H05A 3TW8A 2QLMA 3OVMA 4RA6B 4B6OA 1ARZA 5HRAA 2GNAA 4NH4A 4N03A 4DDTA 4URUR 2HD4A 3H7AA 1ADFA 1ZQ9A 1PDVA 2I55A 3IILA 2YHUA 5AVXA 4G24A 1XB2A 2WYHA 3CSDA 3FX2A 1P1CA 2P7HA 3EOAI 3LY5A 3VBCA 5LD2B 3B3AA 3DZIA 4RHEA 4KN9S 3GDFA 3M6FA 4IDHA 4NZOA 1T3LA 3D8NA 5U9CA 3H19A 4GBED 5IVIA 5EWLA 3E22A 5F52A 2HO5A 1O89A 1PX0A 2VUSA 5DTJA 4QVIA 3K16A 4ZHQA 1PX2A 4EI9A 5C37A 1Q77A 2FN4A 3ZN2A 5JCOA 1R0BA 3EJWA 4P5DA 5G2OA 4DMFA 1ECJA 3I32A 2K0XA 3KQOA 3NWOA 3TRHA 2N5HA 1ZS9A 2VRWA 4HGOA 1WXEA 3UJCA 4FSDA 1FA9A 3ZDRA 1P4RA 2G06A 1KH2A 4KMOA 3PA6A 4L8WB 4RA9B 2HWYA 5T41A 1M1XB 3F5SA 2WBLC 4ZO8A 5CT6A 5K4AA 4G6ZA 2UUPA 1I10A 4YRLA 1GG9A 2GCOB 3HV0A 1I3MA 2C5GA 3HZZA 3RNLA 5J2TA 3KR0A 2IYPA 2A33A 2PNGA 1VYVA 4ILKA 3U3DA 1EHIA 4PAOA 5DYYA 4JJZA 2MD9A 1KZGB 2B82A 4LDRA 1CHNA 1EZZA 2A1TS 4TVBA 2WJ6A 4YO7A 1OB5A 3R7WA 2OTJP 1Z0DA 1WP4A 3H2JA 3CPHA 1T9HA 3LC2O 1NIJA 3MWKA 3AVPA 3TR5A 5KIAA 1QVRA 4PRLA 2PD3A 4EG6A 2F62A 1JFLA 4TWZA 1HO3A 1S3IA 2CFOA 1IJBA 1LS1A 4ZGGA 3R4VA 1MOSA 1YZNA 821PA 1I1NA 2Z2XA 5A4AA 2REBA 3GZNB 1NBAA 4F0JA 3LIPA 2L0XA 2LOLA 1VSBA 4DZRA 3F3SA 5LUAA 3MAGA 1J0DA 4OXYA 4HDNB 4P4UA 1QQ5A 2OGSA 2DEUA 4KR2A 5D7NA 2B20A 1QU3A 4AP5A 3OO0A 1LA2A 5LQKA 2AMLA 4MTLA 2ORED 1UOEA 4OBBA 4JLPA 3WLEA 5IBCA 5AI0A 1L6IA 1EDZA 2MINA 1FDWA 4V03A 1DLJA 3NT4A 1FY2A 1RLJA 2EFYA 3EAQA 4PM4A 1YDFA 1QIDA 2Q3DA 3L7NA 3NC1C 4XOUA 4L15A 4KAXA 3TMAA 4WBNF 2BMEA 4TYQA 2ZWPA 3JQGB 1ESCA 2MF4A 2Q4EA 4ZI2A 1PFGA 1M54A 4EG7A 4GX2A 1NKTA 1PVDA 5EMHA 3I5XA 1XLUA 3CG4A 4D9FA 1UT6A 2C58A 1KO8A 5HS6A 1H2HA 3J7AC 1P8JA 3WNQA 3FCSB 3PNLA 4C7OA 3KOXA 4OBWA 3ROKA 1US8B 1VZ2A 2GYUA 3Q7EA 3WLNA 2GKGA 3T3EA 1CYEA 3CHYA 1G20A 4XROA 2WHPB 4U5XA 3V46A 4Y9SA 3TNDA 1CWUA 5DHRA 3G8AA 4QUHA 6LDHA 3ZZMA 4HFJA 4W5RA 4BPFA 3D4PA 1VIDA 3NIBA 4IVPA 3ZU3A 3TLMA 1AQYA 2QTZA 4WUTA 3STXA 2JLCA 2FFJA 3BTSA 3RIEA 3QGMA 2BSQA 1K73Q 1HPLA 2AK3A 4OAQA 1HMYA 3FHJA 1KO1A 3UB4A 3TMKA 4FEYA 3LXRA 4DA9A 5A2GA 1I01A 3GQVA 3OFND 3PEVA 4YR9A 3X1ZA 4WZAE 2ODAA 2W6JD 4EAQA 1IHXA 1DC7A 1KZ9A 2AZTA 5KOIA 4N3NA 3RC8A 2BDUA 1XJ5A 1FUUA 1IY8A 4Z2AA 4BLOA 3QMMA 3PHHA 1BXIA 1GR0A 1TA9A 2XA9A 3BGDA 5HTKA 4HO1X 4NDZA 1ZSVA 1XZFA 2LCFA 2XDAA 2FN8A 3F2VA 1HNNA 1W4AA 4BPRA 3D6AA 3QIAA 1MKYA 1CR2A 4X63A 1AZWA 3U4HA 2Q2NA 2W0MA 1DNYA 3AL3A 4DQDA 1KYQA 1ZCAA 3ONEA 3DYIA 5K3FA 3EPLA 1W0KD 2HLDA 5JD3A 4BNYA 1ONBA 3AKCA 4BBJA 5BT8A 1FYDA 3WIOA 4BN5A 1FXWF 5CB0A 3X0DA 1PYOA 2QTBA 1C0EA 2I2WA 3BL5A 4KWTA 5C80A 4HG2A 1F4LA 4HAVA 2X19A 5KQSA 1JDVA 4B45A 2PD4A 4WI1A 3UFXA 2JFVA 3KB6A 5TVKA 4YRCA 2D6FA 1Y1RA 2P9HA 2XZ1C 5HF9A 4DCJA 5JVDF 1YA6A 1X74A 4D9MA 3U5TA 4EENA 2B34A 5AM0A 5KINB 4U0KA 3BERA 2XUAA 3RLFA 5FORA 1N2OA 1KK2A 2P5SA 3HO6A 4PY2A 1GAEO 3ZY3A 1E2DA 4XCXA 4KRFA 3F6SA 2DX7A 5E7JA 2E1PA 4JVOA 3SS9X 1H1DA 1XP5A 1B6GA 3PUZA 4LV5B 3U3MA 3KKLA 2Q5FA 5AW4A 2BM8A 2BZGA 2SKEA 3BMQB 1NQUA 2N3ZA 3D02A 3EXIA 3Q9LA 4PZ0A 3LO5A 4CT0A 2G9RA 2QGNA 4YUXA 1M7BA 4PLZA 2ZRBA 4IO0A 1GNRA 1DINA 3ABOB 3C3AA 3DEYX 1HDCA 3SOZA 2JLYA 3RBAA 4D82A 4NFLA 4PNPA 1YFLA 4Q1VA 3X1YA 3FCCA 1ZXLA 1GHTA 5DBGA 4GG1A 4KHZA 5BSHA 2NVOA 1NVUQ 1WW2A 1RI3A 2ZVQX 5CP8A 2FZKA 3R75A 4ZYXA 4EHKA 5KDDA 1T36B 1I80A 2ECPA 2EJUA 4F8EA 2KGAA 1F1JA 4ZREA 1LC0A 4TN5A 1BVHA 2WHPA 2JGLA 4RTRA 1N5OX 1PZGA 4E2WA 2ECQA 3IQFA 4W9MC 3H0EA 4RJLA 5ILGA 5DN6D 4ZI5A 3VR6H 1US8A 1VQKP 4L51A 1IU9A 3VH2A 3RUAA 1HTTA 2EZ4A 3HLKA 3P4YA 2AEJA 2CXUA 4RZHA 1C9JA 4YVFA 4CLXA 5AW2A 4UUBA 1IN8A 3CEJA 2GK3A 3HU5A 5L51A 2C54A 3N2EA 1M5RA 3WOHA 3LPMA 4CUJA 3ROFA 3LP5A 1E98A 3HVKA 1ML4A 3UXEA 1IY9A 1NDHA 4Q47A 3D3NA 3BE6A 1AN9A 1R0CA 4OXKA 4MRSA 4INAA 2AFHA 1TK9A 3GRFA 1M1UA 2X6RA 3TLEA 4GRIA 3R44A 1I9CA 4PZEA 3PIIA 4KXLA 1U2ZA 4N0EA 1FLDA 2FJ0A 1MHPA 1GGJA 3EGDB 3QY0A 3HLTA 1KSGA 4FYPA 2QDXA 4BKRA 3G1GA 1YRBA 4JQZA 3AOGA 4U7DA 4X7MA 2JGFA 4PLFA 4F9GA 1ZZEA 1Q0ZA 3OPVA 1U7DA 1FXWA 3ZGNA 2XI4A 1BYUA 4O2LA 3DLHA 2R7KA 4E32A 2DT5A 3FYUC 4PINA 2OG1A 4MDYA 1B00A 2HHHB 4F97A 2G6BA 4LSWA 2GJ9A 2PZJA 2YDXA 4P80A 5HGLA 2FSHA 5TQVA 2D2VA 2B99A 3WR5A 4H2WC 1TE2A 3KUDA 1RPNA 1XDUA 2GEUA 3RGGA 2V7VA 1E3DA 3A3OA 4J7AA 1GUAA 2QDKA 2O8VA 3ZVRA 4EF5A 1EVZA 1FSFA 4PC6A 1TAQA 2MOKA 1GR1A 4NY1A 2HU5A 1AS2A 4D56A 3L4EA 2VP0A 2EW8A 2VJKA 4ETNA 3VA7A 3EPKA 1DKUA 2AQ8A 2PNJA 2GQ0A 2WE7A 2AF4C 2YIVX 3OCVA 5LZ5A 1RQPA 1DIRA 1F14A 1C7FA 1YR9A 3ANXA 3R7WB 1CUBA 2CVFA 1DIBA 3OZWA 3KU4A 2PEJA 3T61A 5LLDA 3FYCA 1B73A 1W46A 3R6DA 1XZ8A 2OK7A 4NAHA 4CM1A 2NVUA 4X6UA 3LUKA 3C41J 4HDKB 3AHHA 2W2XA 1D2CA 3RYIB 3V80A 2QVBA 3CY6A 4QU5A 5AK6A 5EKDA 1G2OA 2H54A 8ATCA 4RV9A 1IEVA 3LHFA 5IKXA 1ISRA 3KKEA 3HJHA 2WKQA 4JSYA 3DAYA 1JH9A 5C46F 3L8GA 4WGFA 2HDOA 2XRYA 3EE6A 1UBFA 4S24A 5KBYA 1COWD 5AQEA 3AB3A 1KOFA 2KGEA 3KWLA 3Q3EA 4N12A 3SYLA 4M2LA 1M73E 4MGEA 4NV1A 4RJJA 2WFZA 2K2QA 3EIWA 3ME5A 3R23A 3DVLA 4PO3X 2Q8NA 4X8HA 5D2CA 4CLOB 5KNBA 2GZ2A 5F9HA 3VYUB 1ZNVA 1OXBB 4GOXA 4Q3BA 4ZZIA 1S96A 5GZ3A 3SX0A 3NFYA 1KI2A 3UWMA 1PR4A 3ESCA 5EWLB 3VPXA 1EJ2A 3K6KA 4CFSA 1DHTA 5KB3A 4CQLA 1R0RE 1ZN9A 4XWKA 3R77A 3IO3A 4A2CA 6YASA 5GJCA 2G4LA 2YMMA 4QPCA 2BMVA 5TMDA 1T25A 4JP1A 2JLBA 5HIKA 4RVDA 1EFLA 1L4GA 1XFAA 2HIAA 2JRLA 1CR6A 1E2MA 2XH8A 3LT1A 2XZLA 5HM6A 2GZJA 1YQUA 3P9SA 3LUHA 3SMVA 1U0EA 4BO2A 4N5HX 4HDRA 1UWKA 2RCYA 2H51A 3VNBA 1ECFA 1ZP6A 3ITKA 3JTEA 2AJCA 1L0HA 3F4KA 2YXBA 1PK7A 1VXOA 2KHZA 1HQBA 3HU3A 5CX1B 3ST7A 4XE5A 4LSZA 1H4QA 4W82A 3PIDA 1A88A 1BHO1 4BFCA 4LY6A 4MS3B 3K5PA 3COSA 1F8XA 3V97A 4BLUA 1NHWA 3FAZA 5MGNA 2GPSA 3DDUA 2XE8A 4Q15A 5BPFA 4FQ5A 1EUCB 2Z6QA 1ML3A 2IU3A 3DGFC 3MWDB 3OLWA 4TKUB 1XVTA 1LVHA 5BV2P 4E3ZA 5IVHA 1TA0A 2WUWE 2DKNA 2C9CA 1ITZA 2DFDA 3LLUA 3PKIA 3GZMA 3ZWXA 5E4FA 4F2WA 3KQNA 5AW0A 1JQEA 4MB2A 1PGJA 5ETJA 1KETA 3QVSA 3ZQ6A 3R41A 5JAZA 4DAEA 5BWNA 3G2KA 1SWVA 5BN3B 4TV8B 1Z2PX 4MUYA 2I6GA 2NAFA 2NLOA 2X5OA 5I9LA 3FDJA 4QFDA 4PGAA 3ICPA 3VGJA 1M6HA 4Q9LA 5EE9A 4B31A 3S1AA 2ZYSA 2PT6A 1QHIA 1HE1C 1H85A 4GRAA 2Z8ZA 2BKVA 4BHTA 3GDOA 4YO8A 3NRCA 5IHXA 1QM5A 4PHCA 3NLLA 1P0FA 4XDYA 3V1NA 3HKDB 2X0KA 4BNTA 4NRDA 4DLBA 2WLSA 4P82A 4A8PA 4DCTA 2CXXA 1PJTA 4B3MB 5SICE 1RWNA 3YASA 3RFTA 1IZ9A 3B3JA 4ZDKA 1C1HA 2QRLA 3N2NA 2X4IA 4TXLA 1VG0B 2RONA 1Q14A 2VK4A 4YC7A 3K73O 3RIHA 2JIOA 3MUFA 2G7ZA 4JXZA 1QYIA 4YROA 3TUZC 5GY7A 2XGMA 2EJBA 3I73A 3AV3A 1UOPA 3OT4A 4O63O 2AFRA 1ULUA 1QK5A 5FL7D 2L4BA 2RGRA 2XT1A 2DQKA 3JQRA 1Z9BA 5DLDA 3SLRA 1UK8A 2W2LA 4IOLA 5BWOA 4AB1A 3TTSA 2BFMA 1FSZA 5CVCA 1NXSA 1YBVA 1ZU4A 2BGRA 2BKUA 1E9DA 4OTZA 1A4IA 1W581 3KJXA 1FFDA 2C3MA 3FNBA 4Z4IA 4OHFA 1UT5A 3I9V1 5CB8A 5A6SB 3V2IA 4DCCA 1UBHS 2CSUA 5IJAA 3NUGA 2BBOA 2WPDA 3HUEA 4KXWA 1ZC3A 2CLIB 3SIXA 5AVVA 1BNCA 1JQJC 4KAFA 5JYEA 2JAPA 3EG9B 1GA1A 3Q5GA 3QKSA 3UOWA 2BFDA 1UNKA 3EIOA 4IQFA 1ICEA 2I6UA 4UBMA 4NYIQ 4UXJA 3VHQA 5A3QA 1R64A 1FVHA 3EXHB 1UKCA 5AI5A 3RR2A 2Q5IA 4BQNA 1N3BA 3B6MA 3BK7A 3ETCA 1A2BA 2WU0A 5IN4A 5JHHB 1KKMA 4B4DA 1JHOA 1OPRA 2HJWA 3C3CA 3H9JA 3TSOA 1KSJA 1BQ3A 2XF8A 1GZHB 4JIGA 4J90A 2YXPX 2XB6A 4CDRA 4KO3S 4PZDA 3QF7A 2R2GA 3WRYA 3ZCQA 4C7KA 5AVWA 3NANA 2F3SA 2REQA 2WWWA 2X8WA 3CZAA 5A0FA 4IMRA 2P3OA 2QNRA 1KXZA 4IIJA 3W9UA 2VC2B 2WMOB 2YUTA 2YV2A 3I6MA 3R76A 1BXZA 2Y4NA 4IIHA 2GLUA 2C8VA 3AUJB 3N2ZB 1AKEA 4L0DA 2G80A 3ICEA 2K4MA 5INTA 4Y2JA 4HMOA 1P9NA 3LPLA 2TYSB 2ZS9A 3LO8A 4HDAA 2JFZA 2OZKA 4RENA 3PDCA 5A3JA 1Y1LA 3CKLA 2KW5A 3FLEA 5ILOA 4M0EA 1BW9B 1YC5A 1NVTA 4FOPA 1MB9A 1EI9A 4WZAA 2X13A 2R8ZA 2EZUA 5CA1A 1GPNA 4CUZA 4D3SA 3JQ7A 3PVCA 3K4HA 1LPBB 3H4MA 1FCJA 3E5NA 1OXMA 1WOYA 3R3HA 1YBMA 4HF7A 5TPWA 3LAWA 4EZEA 1Z7YA 1BZYA 2B2XA 3GELA 1AF4A 1K4MA 2WP0A 4JVLA 3UAWA 4ICIA 1VQ9P 3CT4A 1L4NA 3I58A 4MUNA 1V2GA 4G07A 2I1VB 3H5TA 4EKYA 4MR7A 1KP9A 2YIMA 3QWIA 2RHWA 2V8BA 4JOCA 3RK0A 4IWXA 5BN3A 4P92A 5KHOC 2C7OA 5FI5A 3JX9A 5LMZA 4MWBA 3KD2A 2V7BA 3QKTA 3SKXA 3W7AA 4EJSA 2HIMA 1GSOA 4N6OA 2CMGA 2D2XA 2P5YA 4FIZA 4GQAA 3S27A 1J0EA 4OD0A 4EGAA 1K3TA 5DASA 1UM8A 4UEJA 2O8EB 4PGMA 1Y6ZA 4KPYA 1UFKA 3MGEA 4J75A 2NADA 4J7CA 4I9HA 4TKUA 3NBMA 2I7XA 3ORFA 4ZO4A 4DGSA 4P08A 7REQB 3DUFB 4PSCA 3SS8A 3AF6A 2PO5A 3OMXA 4GLOA 2BFEA 5DSXA 1GNLA 1N5JA 3VU0A 4CV2A 4MUKA 5CA0B 3PYLA 1HV8A 2K5XA 1T6YA 1BE6A 1UBRS 2UDPA 3DPUA 3FOEC 4MS3A 3UGTA 3ORYA 3EJ6A 1WCYA 2ZM6B 1SB9A 4CG0A 2Q49A 5D87A 2A5FA 4I3FA 4MK4A 1QGDA 3A9UA 1I2MA 3LVRE 4X1KB 4RYLA 3DZDA 1C0LA 1PRYA 3MNFA 4G9EA 4HDCA 2EKDA 1BAPA 1FMCA 4NYJR 4Q39A 2E49A 4I3HA 3VO8A 3FGZA 1ISPA 4DR7B 2R79A 2EWVA 2H1WA 3F8WA 1TQ4A 5ICCA 2UVDA 4YY3B 3A27A 3DHWC 4W6QA 1D1DA 3F47A 2QUKA 3JV7A 2AYYA 4MQFA 5MN6A 2CV1A 4TS4A 2DJ5A 2WAAA 5FOWA 2J5KA 3A1NA 3DT8A 3VMMA 1OI4A 4DQKA 4CL2A 4GP9A 5AVTA 2XMDA 2RHGB 3THWA 1N2JA 5LYYA 1EH5A 4EGQA 3LZCA 3Q3CA 1QIIA 2XE6A 2ZJYA 3MT9A 4HDMA 1AKNA 2YXDA 2UXCB 5EMMA 5HQJA 1P5ZB 3L6CA 2HHCA 3S2SA 4CLOA 2K2QB 4A5SA 2GRJA 3VYSB 1NZFA 3LBYA 2H5LA 3LGXA 3UENA 3ETJA 4ER3A 1R0YA 2BP7B 3KEFA 4UFOA 2BFBA 2ZYTX 4J3JA 4TUYF 1Z6MA 2V7WA 3P9CA 4J4HA 1GFWA 1KSHA 4J0CA 3TD9A 2IIBA 4RMGA 3N53A 2I67A 4LDNA 4N3GA 1V25A 3R2JA 4N5LA 1JEYB 4FXOA 3IULA 1JA1A 4IWNA 1VA4A 1RXVA 4OHXA 5JRJA 3AR9A 2OWEA 1AQ6A 4FUTA 4HDKA 3RYIA 4KSCA 3DE5X 2QSYA 3CLUD 2ATVA 1DL5A 1SVMA 3ND9A 2D59A 5L3QB 4CGZA 2BEKA 1IHPA 3QF4B 2JGRA 4LKOA 1EVEA 4W63A 3RJZA 3IOEA 5K9ZA 5HZKA 3G88A 1J9GA 4FQ7A 4QTTB 1UINA 3Q7QA 4NEQA 5IABA 4ND2A 1FIUA 4AKGA 1UIMA 3LHSA 4C5BA 4QYWA 3CX7A 4AK9A 3Q8XB 2VKTA 4FBGA 1QIFA 1KEWA 3QPDA 4HRXA 4QDTA 4GR9A 4BFTA 3OU7A 2VLPA 1H9BA 2IW3A 1TUBA 2O7VA 2YXEA 3E2MA 3A26A 1D07A 1GG2A 2P1RA 3HDYA 1KYTA 3WGLA 2A58A 3OPNA 4UHFA 1MENA 2OZVA 4P22A 3OZAA 2IUEA 3O73A 4MVYA 3AHEA 5K4GA 3IQXA 3KD3A 3QBEA 3O4JA 4OBEA 3V8PA 4AJEA 1A98A 2DGYA 3Q2OA 4PLPA 4YRSA 3P4XA 1VDZA 2EFEB 1UJMA 2P40A 4IXMA 4NOLA 3E3OA 4AULA 2BL4A 1MV5A 4NECA 3UH0A 1RKXA 4AO7A 3T7EA 5J59A 1KYIA 4IJVA 2XECA 4OU5A 3ZWWA 3IBYA 2W6OA 3C5VA 3KTAA 3I9FA 2XHEA 4PR3A 2O59A 3GY0A 4WY8A 3VPBA 1XDBA 4RO0A 1E69A 3RUHA 4HH1A 3TDKA 3NT5A 4R0VA 3D3KA 4LOJA 4LJLA 1OGIA 1U7WA 1FMLA 2B36A 4R1UA 4BJ6A 4BNWA 2W4QA 4XWYA 5CGZA 2JCVA 4PANA 4RZSA 4DA7A 2CLSA 2ZUTA 2CDRA 3MUEA 2AFHB 5F2KA 3FF1A 3KZNA 4QXPA 1DRKA 2GD2A 4OMFG 1IWOA 3OEWA 3LFUA 1E2EA 1KVSA 2QLBA 2YJ5A 3NBUA 4F5WA 1FYEA 2IP2A 4I14A 4NDNE 4LF9B 1ODSA 4JMPA 2A9FA 2PZGA 2PZEA 1D6NA 1DFIA 2J0QA 4C0XA 2XBMA 1W52X 4MS1B 3B13B 4F2GA 4US2R 4NQZA 2QN7A 2CNWA 5LKAA 4OL0A 4JT8A 4UCWA 3UC5A 1S9DA 2BKEA 1JW9B 1XZJA 4FWBA 3SHQA 3KXDA 1L1QA 1Y3IA 3M82A 4FWTA 1TAGA 3BXEA 2OORA 1J8VA 3UWDA 1R0LA 2LIVA 1NLUA 4IGEA 4KQFA 2Q7OE 3RSCA 1SKYB 1PJSA 2N1BA 2YVUA 1T36A 4JUBA 5G3ZA 4BC0A 2XXBA 3T15A 4DSZA 4ZI7B 3U4QB 2B8WA 4EB8A 3EOBI 3ZVLA 3GIDA 1A8HA 2HBZA 5K3EA 4QGAA 5LUBA 3WFIA 1U9JA 1WDLA 4AP6A 4ZZ0A 1W94A 2YZ2A 5BP7A 2NSYA 3B1FA 1L8QA 2I3GA 2JIRA 4X20A 3TG8A 1U1IA 2GN8A 3MIIA 4GI5A 5HZGA 5C4IA 2PLRA 4EJ2A 4KVFA 1V3TA 2AG1A 2CMHA 5FA5A 3D43A 1PR9A 1YJ8A 3QVVA 3ZIAD 4GNRA 4KQ9A 1MGOA 3LE8A 3DLBA 4KE6A 3D8RA 3L7DA 1CY1A 2R7LA 2BFFB 1KJ8A 2CUKA 4N5MA 4IDAA 1CQJB 4OQYA 3U7EB 2Y2VA 5COBA 3QZUA 5EXTA 3U7GA 1LJUA 2RMKA 1GAXA 5C53B 2D7DA 5K1ZA 5HRCA 1COZA 4FE3A 3ZVMA 1JHRA 3U1TA 2P9BA 4U7JA 5G0VA 1XXHB 3IP3A 4HATA 2W83A 1V96A 4M88A 4C7JA 1QHGA 3SQLA 2DG2A 1JQ5A 1VBKA 2C4MA 3GMDA 4F72A 2N5IA 4UNRA 5KTPA 4ZFNA 2B37A 4QO7A 2X23A 3SHVA 3B6IA 3UWPA 3OEHA 2WUDA 3QI7A 2JI6A 1G63A 3WS7A 2AKAB 3TQHA 3B53X 5LXTB 4KKVA 4BJ5A 4OQZA 1DB3A 4RDHA 3T5PA 4XD7A 1JXQA 2W93A 1Y33E 2XZPA 4FDUA 4HQKA 2BFWA 1KPIA 3U13A 4ETWA 3CLKA 3FPBA 1BHQ1 4RMIA 2FHPA 3HZOA 1TFUA 3B12A 1PL6A 5DI3B 3V2UA 4B80A 1WEHA 2QJTA 5KHAA 4Q3DA 3UK6A 4HLUC 4IZOA 5DTRA 2IW1A 4QQNA 1Q20A 4BQEA 2INGX 1NU8A 3FTDA 1VCNA 3Q85A 3QW4B 4E7OA 1T2FA 2ISQA 2OOKA 4FN5A 5H1YA 1N4AA 3F4LA 4PC2A 5K0JA 2W00A