2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0832
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
4H2WC 1VKUA 1AF8A 4CA3A 4U0CA 2Z44A 3WBHA 2KG8A 2MR7A 2KOQA 3DS4A 5HV8A 2MD9A 1IMPA 2K93A 4IZ6A 1YJ9P 3CMEP 2K0XA 2GDYA 3NY7B 4H2XC 3CD6P 2JGPA 3H4EA 4XRQA 1X3OA 2PEIA 2PEMA 5F2NA 5BS1A 3I56P 3CCMP 5HVCA 1VQ5P 4XFZA 2M8NA 2GZFA 3DTJA 2LKIA 2KOSA 3G29A 2VLOA 1VQPP 1IMQA 2GZIA 2FVFA 2N5IA 5DCKA 1FR2A 3DS2A 2E1MA 2KGCA 2KG9A 5EJDA 3CCUP 4DG9A 2PENA 3MGEA 2PEKA 1HQBA 1Q7YQ 2ROQA 2MVUA 2Z46A 2L6EA 2CNRA 2FVAA 1M74A 2K2QA 4HKGA 2JU2A 1K9MQ 2L22A 1M1KQ 2L0QA 3G26A 1HY8A 2L4BA 5HGNA 4COCA 1VHNA 3I55P 2PNGA 1VQKP 1VQNP 2BHVA 1DNYA 3GZLA 1RO2A 1E6JP 3EJDA 2VLNA 2GDXA 2KOPA 3G21A 1GXHA 2N5HA 2KOOA 4GR6A 2KGEA 3LRYA 2MF4A 4GR2A 4UHPB 4U0FA 2JO0A 1Q86Q 2GYKA 1A43A 3GKLC 5F2KA 3H0DA 1VQ8P 4IPYA 1ZNVA 2LMLA 2JQ4A 1GXGA 5HGOA 4U0BA 3G4SP 2KGDA 3G0VA 2OTJP 1YI2P 2MVVA 2PEQA 1AUMA 1EMVA 2LF4A 3G28A 2WPTA 2GZGA 1Q81Q 2KWLA 1JJ2O 2KORA 2LPKA 1QVFO 1T8KA 2JYLA 2JYGA 5HGLA 2KR5A 3DPHA 1EIAA 1KD1Q 2MR8A 2OTLP 2N6ZA 2K0DX 3U43A 2EIAA 3EJEA 4F37A 3CPWO 1BXIA 3CCLP 2Z45A 4XFYA 2CGQA 4NEOA 1YITP 2VSQA 2N6YA 2PEJA 1F80D 4U0DA 2QA4P 1A8OA 2KODA 2XXMA 1KLPA 3H47A 1D1DA 2JAZA 5BS2A 2AFEA 3CCSP 2M8LA 5CZDB 1OR5A 3HYBA 1E0HA 3DS5A 4H2YC 3CCRP 2AVAA 2KGAA 3HZQA 3E2DA 3DS1A 4WYMA 2KW2A 2LL8A 4U0EA 2LIUA 2OARA 2K0YA 1L0HA 2XZ0D 3M1MA 2EG5A 4PH1A 3GJNA 3G71P 1M6EX 2LOLA 4COPA 2LIWA 3CCVP 1VQ9P 2JBGA 1RNIA 2N50A 3DS0A 5JPAA 3LMOA 3G1GA 2JU1A 3CCQP 1CEIA 3CC4P 1YJNP 4R0MA 3CE7A 1NJIQ 4QKOA 2CWOA 3RG2A 2X2BA 2L9FA 1IUQA 1BAJA 3VRLC 3CC7P 2CQ8A 1ACPA 2BUOA 2VLQA 3RG6C 2PY8A 1GPJA 2XZ1C 2JB0A 2GZJA 3Q20A 3GZMA 1VQ6P 3B4QA 2M5RA 2AFDA 3OW2O 1VQOP 2GZEA 5EW5E 4MRTC 2KG6A 1K8AQ 5I4TG 1VQ7P 1KC8Q 1YIJP 1YHQP 1VQ4P 5F2OA 1RO0A 1ZMBA 2EFJA 4QNBA 2QEXP 2PEOA 2P9XA 1VQLP 3G1IA 3CCEP 1DV5A 2FQ1A 3B5IA 5HGMA 5KP6B 2NO8A 2AF8A 2XV6A 1Z6MA 1M90Q 2N98A 2FQ0A 1L0IA 2K5XA 1S72P 3DS3A 2VLPA 3CXCO 1AYIA 1KQSO 1YJWP 1UNKA 3CMAP 3EJBA 1NQ4A 1UJZA 3CC2P 2FADA 4BPGA 2K92A 1EOQA 5KP7B 2FVEA 2LTEA 4XROA 4PWVB 2FHSC 1Q82Q 2QNWA 5KP8B 4BPHA 1K73Q 4XFXA 1N8RQ 1MZ8A 1W2BO 2EHTA 1K30A 2CG5B 3P05A 2M8PA 2ERHA 2FACA 3NTEA 2K94A 4BPFA 1QRJA 2DGYA 3G6EP 4M0IA 4PXHB 4U0AA 3CCJP 2GDWA 2MY5A 2ONTA 2XT1A 4PH0A 1QVGO 2FAEA 2EHSA 1M6NA 2DNWA 2FQ2A 1VQMP 7CEIA
chains in the Genus database with same CATH topology
1YIJP 1E6JP 5F2OA 3CCSP 2M8LA 1RO0A 4U0CA 1ZMBA 2EFJA 3HYBA 2Z44A 3WBHA 3G21A 4QNBA 3DS5A 2PEOA 2QEXP 2P9XA 3CCRP 4GR6A 3LRYA 1VQLP 4GR2A 3DS4A 3G1IA 3CCEP 4U0FA 2JO0A 3HZQA 3B5IA 1YJ9P 5HGMA 3E2DA 1Q86Q 3DS1A 3CMEP 2XV6A 4WYMA 1M90Q 4U0EA 1A43A 2OARA 5F2KA 3H0DA 1VQ8P 4IPYA 3CD6P 3H4EA 4XRQA 1S72P 2PEIA 3DS3A 3M1MA 2PEMA 3CXCO 2EG5A 4PH1A 5F2NA 1KQSO 5BS1A 1YJWP 3G71P 3CMAP 3I56P 5HGOA 3CCMP 3CC2P 4U0BA 1M6EX 1EOQA 4COPA 4XFZA 1VQ5P 3G4SP 3CCVP 2M8NA 1VQ9P 3G0VA 4XROA 3DTJA 2OTJP 1RNIA 3G29A 1YI2P 2PEQA 1AUMA 3DS0A 1VQPP 2LF4A 5JPAA 3G28A 3G1GA 1Q82Q 1Q81Q 5DCKA 3CCQP 1JJ2O 3DS2A 1QVFO 3CC4P 1YJNP 2JYLA 1K73Q 4XFXA 1N8RQ 2E1MA 2JYGA 3CCUP 1NJIQ 5HGLA 2CWOA 1W2BO 2PENA 3MGEA 3DPHA 2PEKA 1EIAA 1K30A 1Q7YQ 3P05A 1IUQA 1KD1Q 1BAJA 2M8PA 2Z46A 3VRLC 2L6EA 2OTLP 3CC7P 3NTEA 2EIAA 3CPWO 3CCLP 1QRJA 2BUOA 2DGYA 1M74A 2Z45A 4M0IA 4U0AA 3G6EP 3CCJP 4XFYA 1K9MQ 3RG6C 1M1KQ 2PY8A 2ONTA 1YITP 3G26A 2PEJA 2XT1A 4PH0A 4U0DA 2QA4P 3Q20A 1A8OA 5HGNA 1QVGO 4COCA 1VQ6P 2KODA 2XXMA 3I55P 3OW2O 1VQOP 3H47A 1VQKP 1VQNP 1M6NA 2BHVA 1K8AQ 1D1DA 5I4TG 1RO2A 1VQ7P 1KC8Q 5BS2A 1YHQP 1VQMP 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 4H2W C;  1VKU A;  1AF8 A;  4CA3 A;  4U0C A;  2Z44 A;  3WBH A;  2KG8 A;  2MR7 A;  2KOQ A;  3DS4 A;  5HV8 A;  2MD9 A;  1IMP A;  2K93 A;  4IZ6 A;  1YJ9 P;  3CME P;  2K0X A;  2GDY A;  3NY7 B;  4H2X C;  3CD6 P;  2JGP A;  3H4E A;  4XRQ A;  1X3O A;  2PEI A;  2PEM A;  5F2N A;  5BS1 A;  3I56 P;  3CCM P;  5HVC A;  1VQ5 P;  4XFZ A;  2M8N A;  2GZF A;  3DTJ A;  2LKI A;  2KOS A;  3G29 A;  2VLO A;  1VQP P;  1IMQ A;  2GZI A;  2FVF A;  2N5I A;  5DCK A;  1FR2 A;  3DS2 A;  2E1M A;  2KGC A;  2KG9 A;  5EJD A;  3CCU P;  4DG9 A;  2PEN A;  3MGE A;  2PEK A;  1HQB A;  1Q7Y Q;  2ROQ A;  2MVU A;  2Z46 A;  2L6E A;  2CNR A;  2FVA A;  1M74 A;  2K2Q A;  4HKG A;  2JU2 A;  1K9M Q;  2L22 A;  1M1K Q;  2L0Q A;  3G26 A;  1HY8 A;  2L4B A;  5HGN A;  4COC A;  1VHN A;  3I55 P;  2PNG A;  1VQK P;  1VQN P;  2BHV A;  1DNY A;  3GZL A;  1RO2 A;  1E6J P;  3EJD A;  2VLN A;  2GDX A;  2KOP A;  3G21 A;  1GXH A;  2N5H A;  2KOO A;  4GR6 A;  2KGE A;  3LRY A;  2MF4 A;  4GR2 A;  4UHP B;  4U0F A;  2JO0 A;  1Q86 Q;  2GYK A;  1A43 A;  3GKL C;  5F2K A;  3H0D A;  1VQ8 P;  4IPY A;  1ZNV A;  2LML A;  2JQ4 A;  1GXG A;  5HGO A;  4U0B A;  3G4S P;  2KGD A;  3G0V A;  2OTJ P;  1YI2 P;  2MVV A;  2PEQ A;  1AUM A;  1EMV A;  2LF4 A;  3G28 A;  2WPT A;  2GZG A;  1Q81 Q;  2KWL A;  1JJ2 O;  2KOR A;  2LPK A;  1QVF O;  1T8K A;  2JYL A;  2JYG A;  5HGL A;  2KR5 A;  3DPH A;  1EIA A;  1KD1 Q;  2MR8 A;  2OTL P;  2N6Z A;  2K0D X;  3U43 A;  2EIA A;  3EJE A;  4F37 A;  3CPW O;  1BXI A;  3CCL P;  2Z45 A;  4XFY A;  2CGQ A;  4NEO A;  1YIT P;  2VSQ A;  2N6Y A;  2PEJ A;  1F80 D;  4U0D A;  2QA4 P;  1A8O A;  2KOD A;  2XXM A;  1KLP A;  3H47 A;  1D1D A;  2JAZ A;  5BS2 A;  2AFE A;  3CCS P;  2M8L A;  5CZD B;  1OR5 A;  3HYB A;  1E0H A;  3DS5 A;  4H2Y C;  3CCR P;  2AVA A;  2KGA A;  3HZQ A;  3E2D A;  3DS1 A;  4WYM A;  2KW2 A;  2LL8 A;  4U0E A;  2LIU A;  2OAR A;  2K0Y A;  1L0H A;  2XZ0 D;  3M1M A;  2EG5 A;  4PH1 A;  3GJN A;  3G71 P;  1M6E X;  2LOL A;  4COP A;  2LIW A;  3CCV P;  1VQ9 P;  2JBG A;  1RNI A;  2N50 A;  3DS0 A;  5JPA A;  3LMO A;  3G1G A;  2JU1 A;  3CCQ P;  1CEI A;  3CC4 P;  1YJN P;  4R0M A;  3CE7 A;  1NJI Q;  4QKO A;  2CWO A;  3RG2 A;  2X2B A;  2L9F A;  1IUQ A;  1BAJ A;  3VRL C;  3CC7 P;  2CQ8 A;  1ACP A;  2BUO A;  2VLQ A;  3RG6 C;  2PY8 A;  1GPJ A;  2XZ1 C;  2JB0 A;  2GZJ A;  3Q20 A;  3GZM A;  1VQ6 P;  3B4Q A;  2M5R A;  2AFD A;  3OW2 O;  1VQO P;  2GZE A;  5EW5 E;  4MRT C;  2KG6 A;  1K8A Q;  5I4T G;  1VQ7 P;  1KC8 Q;  1YIJ P;  1YHQ P;  1VQ4 P;  5F2O A;  1RO0 A;  1ZMB A;  2EFJ A;  4QNB A;  2QEX P;  2PEO A;  2P9X A;  1VQL P;  3G1I A;  3CCE P;  1DV5 A;  2FQ1 A;  3B5I A;  5HGM A;  5KP6 B;  2NO8 A;  2AF8 A;  2XV6 A;  1Z6M A;  1M90 Q;  2N98 A;  2FQ0 A;  1L0I A;  2K5X A;  1S72 P;  3DS3 A;  2VLP A;  3CXC O;  1AYI A;  1KQS O;  1YJW P;  1UNK A;  3CMA P;  3EJB A;  1NQ4 A;  1UJZ A;  3CC2 P;  2FAD A;  4BPG A;  2K92 A;  1EOQ A;  5KP7 B;  2FVE A;  2LTE A;  4XRO A;  4PWV B;  2FHS C;  1Q82 Q;  2QNW A;  5KP8 B;  4BPH A;  1K73 Q;  4XFX A;  1N8R Q;  1MZ8 A;  1W2B O;  2EHT A;  1K30 A;  2CG5 B;  3P05 A;  2M8P A;  2ERH A;  2FAC A;  3NTE A;  2K94 A;  4BPF A;  1QRJ A;  2DGY A;  3G6E P;  4M0I A;  4PXH B;  4U0A A;  3CCJ P;  2GDW A;  2MY5 A;  2ONT A;  2XT1 A;  4PH0 A;  1QVG O;  2FAE A;  2EHS A;  1M6N A;  2DNW A;  2FQ2 A;  1VQM P;  7CEI A; 
#chains in the Genus database with same CATH homology
 1YIJ P;  1E6J P;  5F2O A;  3CCS P;  2M8L A;  1RO0 A;  4U0C A;  1ZMB A;  2EFJ A;  3HYB A;  2Z44 A;  3WBH A;  3G21 A;  4QNB A;  3DS5 A;  2PEO A;  2QEX P;  2P9X A;  3CCR P;  4GR6 A;  3LRY A;  1VQL P;  4GR2 A;  3DS4 A;  3G1I A;  3CCE P;  4U0F A;  2JO0 A;  3HZQ A;  3B5I A;  1YJ9 P;  5HGM A;  3E2D A;  1Q86 Q;  3DS1 A;  3CME P;  2XV6 A;  4WYM A;  1M90 Q;  4U0E A;  1A43 A;  2OAR A;  5F2K A;  3H0D A;  1VQ8 P;  4IPY A;  3CD6 P;  3H4E A;  4XRQ A;  1S72 P;  2PEI A;  3DS3 A;  3M1M A;  2PEM A;  3CXC O;  2EG5 A;  4PH1 A;  5F2N A;  1KQS O;  5BS1 A;  1YJW P;  3G71 P;  3CMA P;  3I56 P;  5HGO A;  3CCM P;  3CC2 P;  4U0B A;  1M6E X;  1EOQ A;  4COP A;  4XFZ A;  1VQ5 P;  3G4S P;  3CCV P;  2M8N A;  1VQ9 P;  3G0V A;  4XRO A;  3DTJ A;  2OTJ P;  1RNI A;  3G29 A;  1YI2 P;  2PEQ A;  1AUM A;  3DS0 A;  1VQP P;  2LF4 A;  5JPA A;  3G28 A;  3G1G A;  1Q82 Q;  1Q81 Q;  5DCK A;  3CCQ P;  1JJ2 O;  3DS2 A;  1QVF O;  3CC4 P;  1YJN P;  2JYL A;  1K73 Q;  4XFX A;  1N8R Q;  2E1M A;  2JYG A;  3CCU P;  1NJI Q;  5HGL A;  2CWO A;  1W2B O;  2PEN A;  3MGE A;  3DPH A;  2PEK A;  1EIA A;  1K30 A;  1Q7Y Q;  3P05 A;  1IUQ A;  1KD1 Q;  1BAJ A;  2M8P A;  2Z46 A;  3VRL C;  2L6E A;  2OTL P;  3CC7 P;  3NTE A;  2EIA A;  3CPW O;  3CCL P;  1QRJ A;  2BUO A;  2DGY A;  1M74 A;  2Z45 A;  4M0I A;  4U0A A;  3G6E P;  3CCJ P;  4XFY A;  1K9M Q;  3RG6 C;  1M1K Q;  2PY8 A;  2ONT A;  1YIT P;  3G26 A;  2PEJ A;  2XT1 A;  4PH0 A;  4U0D A;  2QA4 P;  3Q20 A;  1A8O A;  5HGN A;  1QVG O;  4COC A;  1VQ6 P;  2KOD A;  2XXM A;  3I55 P;  3OW2 O;  1VQO P;  3H47 A;  1VQK P;  1VQN P;  1M6N A;  2BHV A;  1K8A Q;  1D1D A;  5I4T G;  1RO2 A;  1VQ7 P;  1KC8 Q;  5BS2 A;  1YHQ P;  1VQM P;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...