2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0832
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
1YHQP 1K30A 2FQ2A 2LL8A 2AVAA 3CMAP 2N6YA 2L6EA 1VQPP 2ROQA 1K73Q 2OTJP 2FVFA 5HGNA 3NTEA 4XFYA 2CGQA 5EW5E 2FACA 1DV5A 2JO0A 2KOOA 5HGMA 2QNWA 2XT1A 2JGPA 2PNGA 2MY5A 4F37A 1CEIA 2N98A 2KGCA 3CC7P 1AUMA 2JBGA 5F2KA 1KQSO 2LOLA 2OTLP 2N5HA 1NQ4A 2LF4A 2FHSC 1OR5A 3MGEA 2ONTA 3NY7B 1M90Q 5HGLA 2CNRA 3Q20A 3HZQA 2JB0A 2KGEA 4XFZA 2VSQA 1VQOP 2EFJA 1ACPA 2JAZA 1VQNP 5F2NA 1IMQA 4XRQA 1VQ5P 5HVCA 4QNBA 1YITP 1GXGA 1QRJA 1RNIA 4IZ6A 2L4BA 3G26A 3G4SP 2K94A 2GZGA 3M1MA 2L0QA 2BHVA 4GR2A 2Z46A 4GR6A 4U0CA 2FQ0A 3LRYA 1JJ2O 2K5XA 2K92A 1DNYA 1BAJA 2Z45A 5KP7B 4U0DA 3DTJA 4U0BA 2N6ZA 2M8NA 2P9XA 3DS2A 2GYKA 3EJDA 2ERHA 2KGDA 1UNKA 2OARA 2AFDA 4BPGA 3GKLC 1M6NA 3WBHA 1Q86Q 2JYLA 5KP8B 4M0IA 2AFEA 1VKUA 1HQBA 2PY8A 3GZLA 4U0EA 1EMVA 1KD1Q 2N5IA 2JU2A 1RO2A 2VLOA 2PENA 2QA4P 2FVEA 4XFXA 1K8AQ 1GPJA 2PEKA 3GZMA 3CMEP 2PEMA 2VLPA 1BXIA 4CA3A 3RG2A 3G1GA 2K0XA 2MR8A 2KOQA 1ZMBA 4HKGA 2DGYA 3I56P 2MF4A 3CCEP 2LMLA 3G6EP 1YJWP 2K93A 2VLQA 3U43A 5CZDB 3G28A 5HV8A 4R0MA 3G71P 1AYIA 3CCRP 1VQ8P 2KG9A 2Z44A 3RG6C 2MVVA 1UJZA 2CG5B 2LPKA 1VHNA 2MD9A 1VQMP 2WPTA 3CCQP 2PEQA 2GZEA 2MVUA 4H2YC 1D1DA 2XV6A 3CD6P 2BUOA 2FQ1A 4XROA 2GDWA 1VQ7P 2L9FA 2KR5A 3H47A 2KGAA 2PEOA 2EG5A 1IMPA 3CCUP 3DS0A 2L22A 3CPWO 1YJ9P 2XZ1C 3EJBA 1QVGO 3CCVP 4MRTC 5EJDA 2EHTA 2E1MA 1MZ8A 1ZNVA 5I4TG 2PEIA 4U0FA 4BPFA 3VRLC 2PEJA 4PH0A 2JU1A 2DNWA 2GDXA 3B5IA 1RO0A 2MR7A 1EOQA 1X3OA 1Z6MA 1KC8Q 2VLNA 1YIJP 3G1IA 1L0HA 3I55P 2KODA 4COPA 1VQ6P 5BS1A 2XZ0D 3CCMP 1EIAA 4U0AA 5KP6B 2KOPA 2GDYA 3CC4P 1T8KA 2JYGA 1W2BO 2K0DX 3CC2P 2KW2A 4H2WC 4H2XC 2KOSA 2GZJA 2LTEA 1Q82Q 4PH1A 2KG6A 4BPHA 1F80D 1GXHA 3P05A 1A43A 2KORA 1E0HA 2NO8A 3CE7A 2LIWA 3G21A 3CCSP 2KWLA 4WYMA 2EHSA 2LIUA 4PWVB 1YJNP 1VQKP 1KLPA 2FVAA 3G0VA 2CQ8A 2N50A 2XXMA 1NJIQ 3GJNA 2FADA 1M74A 5F2OA 1M6EX 1IUQA 3DS5A 3G29A 1FR2A 5BS2A 1Q81Q 3CXCO 7CEIA 2GZFA 1S72P 2EIAA 1Q7YQ 3CCLP 4COCA 1VQLP 3DS3A 3EJEA 5DCKA 2CWOA 3DS1A 1YI2P 1VQ9P 3CCJP 2K0YA 1L0IA 2KG8A 3LMOA 2M5RA 3E2DA 2K2QA 2QEXP 1HY8A 2JQ4A 1M1KQ 2GZIA 5JPAA 3H0DA 4DG9A 3DPHA 4PXHB 2LKIA 3HYBA 1N8RQ 1VQ4P 3H4EA 3B4QA 2M8LA 5HGOA 1AF8A 3DS4A 2FAEA 2M8PA 4IPYA 2X2BA 1E6JP 1K9MQ 3OW2O 4UHPB 1QVFO 2AF8A 4QKOA 1A8OA 4NEOA
chains in the Genus database with same CATH topology
1YHQP 3P05A 1A43A 4U0DA 1D1DA 3DTJA 4U0BA 2M8NA 1K30A 2P9XA 2XV6A 3DS2A 3CD6P 3G21A 3CCSP 4WYMA 2BUOA 3CMAP 2OARA 4XROA 1YJNP 1VQ7P 2L6EA 1VQPP 1VQKP 1K73Q 2OTJP 1M6NA 3H47A 3WBHA 1Q86Q 2PEOA 5HGNA 2EG5A 3NTEA 4XFYA 3CCUP 2JYLA 3DS0A 3G0VA 3CPWO 1YJ9P 4M0IA 2JO0A 2XXMA 1QVGO 3CCVP 1NJIQ 5HGMA 2PY8A 1M74A 2XT1A 5F2OA 2E1MA 1M6EX 1IUQA 3DS5A 3G29A 4U0EA 5BS2A 1KD1Q 1Q81Q 5I4TG 3CC7P 3CXCO 1AUMA 2PEIA 5F2KA 4U0FA 3VRLC 2PEJA 1KQSO 1RO2A 4PH0A 2PENA 2QA4P 1S72P 2OTLP 2EIAA 4XFXA 1K8AQ 2LF4A 3B5IA 1Q7YQ 2PEKA 3CCLP 4COCA 1VQLP 3MGEA 3DS3A 2ONTA 3CMEP 2PEMA 1RO0A 1M90Q 5DCKA 5HGLA 3G1GA 1EOQA 1KC8Q 3Q20A 2CWOA 3HZQA 1YIJP 3DS1A 1YI2P 1ZMBA 4XFZA 1VQ9P 2DGYA 3G1IA 3I55P 3I56P 3CCJP 3CCEP 1VQOP 2KODA 4COPA 3G6EP 2EFJA 1YJWP 1VQ6P 3E2DA 5BS1A 1VQNP 3CCMP 1EIAA 4U0AA 2QEXP 1M1KQ 3CC4P 5F2NA 3G28A 5JPAA 3H0DA 2JYGA 4XRQA 1VQ5P 1W2BO 4QNBA 3CC2P 3G71P 1YITP 3DPHA 3HYBA 1N8RQ 1QRJA 1RNIA 3CCRP 1VQ4P 3H4EA 1VQ8P 3G26A 2M8LA 3G4SP 2Z44A 3RG6C 5HGOA 3DS4A 2M8PA 3M1MA 4IPYA 1E6JP 1K9MQ 2BHVA 3OW2O 1Q82Q 1QVFO 4GR2A 4PH1A 2Z46A 4GR6A 4U0CA 3LRYA 1VQMP 1JJ2O 1A8OA 3CCQP 2PEQA 1BAJA 2Z45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 1YHQ P;  1K30 A;  2FQ2 A;  2LL8 A;  2AVA A;  3CMA P;  2N6Y A;  2L6E A;  1VQP P;  2ROQ A;  1K73 Q;  2OTJ P;  2FVF A;  5HGN A;  3NTE A;  4XFY A;  2CGQ A;  5EW5 E;  2FAC A;  1DV5 A;  2JO0 A;  2KOO A;  5HGM A;  2QNW A;  2XT1 A;  2JGP A;  2PNG A;  2MY5 A;  4F37 A;  1CEI A;  2N98 A;  2KGC A;  3CC7 P;  1AUM A;  2JBG A;  5F2K A;  1KQS O;  2LOL A;  2OTL P;  2N5H A;  1NQ4 A;  2LF4 A;  2FHS C;  1OR5 A;  3MGE A;  2ONT A;  3NY7 B;  1M90 Q;  5HGL A;  2CNR A;  3Q20 A;  3HZQ A;  2JB0 A;  2KGE A;  4XFZ A;  2VSQ A;  1VQO P;  2EFJ A;  1ACP A;  2JAZ A;  1VQN P;  5F2N A;  1IMQ A;  4XRQ A;  1VQ5 P;  5HVC A;  4QNB A;  1YIT P;  1GXG A;  1QRJ A;  1RNI A;  4IZ6 A;  2L4B A;  3G26 A;  3G4S P;  2K94 A;  2GZG A;  3M1M A;  2L0Q A;  2BHV A;  4GR2 A;  2Z46 A;  4GR6 A;  4U0C A;  2FQ0 A;  3LRY A;  1JJ2 O;  2K5X A;  2K92 A;  1DNY A;  1BAJ A;  2Z45 A;  5KP7 B;  4U0D A;  3DTJ A;  4U0B A;  2N6Z A;  2M8N A;  2P9X A;  3DS2 A;  2GYK A;  3EJD A;  2ERH A;  2KGD A;  1UNK A;  2OAR A;  2AFD A;  4BPG A;  3GKL C;  1M6N A;  3WBH A;  1Q86 Q;  2JYL A;  5KP8 B;  4M0I A;  2AFE A;  1VKU A;  1HQB A;  2PY8 A;  3GZL A;  4U0E A;  1EMV A;  1KD1 Q;  2N5I A;  2JU2 A;  1RO2 A;  2VLO A;  2PEN A;  2QA4 P;  2FVE A;  4XFX A;  1K8A Q;  1GPJ A;  2PEK A;  3GZM A;  3CME P;  2PEM A;  2VLP A;  1BXI A;  4CA3 A;  3RG2 A;  3G1G A;  2K0X A;  2MR8 A;  2KOQ A;  1ZMB A;  4HKG A;  2DGY A;  3I56 P;  2MF4 A;  3CCE P;  2LML A;  3G6E P;  1YJW P;  2K93 A;  2VLQ A;  3U43 A;  5CZD B;  3G28 A;  5HV8 A;  4R0M A;  3G71 P;  1AYI A;  3CCR P;  1VQ8 P;  2KG9 A;  2Z44 A;  3RG6 C;  2MVV A;  1UJZ A;  2CG5 B;  2LPK A;  1VHN A;  2MD9 A;  1VQM P;  2WPT A;  3CCQ P;  2PEQ A;  2GZE A;  2MVU A;  4H2Y C;  1D1D A;  2XV6 A;  3CD6 P;  2BUO A;  2FQ1 A;  4XRO A;  2GDW A;  1VQ7 P;  2L9F A;  2KR5 A;  3H47 A;  2KGA A;  2PEO A;  2EG5 A;  1IMP A;  3CCU P;  3DS0 A;  2L22 A;  3CPW O;  1YJ9 P;  2XZ1 C;  3EJB A;  1QVG O;  3CCV P;  4MRT C;  5EJD A;  2EHT A;  2E1M A;  1MZ8 A;  1ZNV A;  5I4T G;  2PEI A;  4U0F A;  4BPF A;  3VRL C;  2PEJ A;  4PH0 A;  2JU1 A;  2DNW A;  2GDX A;  3B5I A;  1RO0 A;  2MR7 A;  1EOQ A;  1X3O A;  1Z6M A;  1KC8 Q;  2VLN A;  1YIJ P;  3G1I A;  1L0H A;  3I55 P;  2KOD A;  4COP A;  1VQ6 P;  5BS1 A;  2XZ0 D;  3CCM P;  1EIA A;  4U0A A;  5KP6 B;  2KOP A;  2GDY A;  3CC4 P;  1T8K A;  2JYG A;  1W2B O;  2K0D X;  3CC2 P;  2KW2 A;  4H2W C;  4H2X C;  2KOS A;  2GZJ A;  2LTE A;  1Q82 Q;  4PH1 A;  2KG6 A;  4BPH A;  1F80 D;  1GXH A;  3P05 A;  1A43 A;  2KOR A;  1E0H A;  2NO8 A;  3CE7 A;  2LIW A;  3G21 A;  3CCS P;  2KWL A;  4WYM A;  2EHS A;  2LIU A;  4PWV B;  1YJN P;  1VQK P;  1KLP A;  2FVA A;  3G0V A;  2CQ8 A;  2N50 A;  2XXM A;  1NJI Q;  3GJN A;  2FAD A;  1M74 A;  5F2O A;  1M6E X;  1IUQ A;  3DS5 A;  3G29 A;  1FR2 A;  5BS2 A;  1Q81 Q;  3CXC O;  7CEI A;  2GZF A;  1S72 P;  2EIA A;  1Q7Y Q;  3CCL P;  4COC A;  1VQL P;  3DS3 A;  3EJE A;  5DCK A;  2CWO A;  3DS1 A;  1YI2 P;  1VQ9 P;  3CCJ P;  2K0Y A;  1L0I A;  2KG8 A;  3LMO A;  2M5R A;  3E2D A;  2K2Q A;  2QEX P;  1HY8 A;  2JQ4 A;  1M1K Q;  2GZI A;  5JPA A;  3H0D A;  4DG9 A;  3DPH A;  4PXH B;  2LKI A;  3HYB A;  1N8R Q;  1VQ4 P;  3H4E A;  3B4Q A;  2M8L A;  5HGO A;  1AF8 A;  3DS4 A;  2FAE A;  2M8P A;  4IPY A;  2X2B A;  1E6J P;  1K9M Q;  3OW2 O;  4UHP B;  1QVF O;  2AF8 A;  4QKO A;  1A8O A;  4NEO A; 
#chains in the Genus database with same CATH homology
 1YHQ P;  3P05 A;  1A43 A;  4U0D A;  1D1D A;  3DTJ A;  4U0B A;  2M8N A;  1K30 A;  2P9X A;  2XV6 A;  3DS2 A;  3CD6 P;  3G21 A;  3CCS P;  4WYM A;  2BUO A;  3CMA P;  2OAR A;  4XRO A;  1YJN P;  1VQ7 P;  2L6E A;  1VQP P;  1VQK P;  1K73 Q;  2OTJ P;  1M6N A;  3H47 A;  3WBH A;  1Q86 Q;  2PEO A;  5HGN A;  2EG5 A;  3NTE A;  4XFY A;  3CCU P;  2JYL A;  3DS0 A;  3G0V A;  3CPW O;  1YJ9 P;  4M0I A;  2JO0 A;  2XXM A;  1QVG O;  3CCV P;  1NJI Q;  5HGM A;  2PY8 A;  1M74 A;  2XT1 A;  5F2O A;  2E1M A;  1M6E X;  1IUQ A;  3DS5 A;  3G29 A;  4U0E A;  5BS2 A;  1KD1 Q;  1Q81 Q;  5I4T G;  3CC7 P;  3CXC O;  1AUM A;  2PEI A;  5F2K A;  4U0F A;  3VRL C;  2PEJ A;  1KQS O;  1RO2 A;  4PH0 A;  2PEN A;  2QA4 P;  1S72 P;  2OTL P;  2EIA A;  4XFX A;  1K8A Q;  2LF4 A;  3B5I A;  1Q7Y Q;  2PEK A;  3CCL P;  4COC A;  1VQL P;  3MGE A;  3DS3 A;  2ONT A;  3CME P;  2PEM A;  1RO0 A;  1M90 Q;  5DCK A;  5HGL A;  3G1G A;  1EOQ A;  1KC8 Q;  3Q20 A;  2CWO A;  3HZQ A;  1YIJ P;  3DS1 A;  1YI2 P;  1ZMB A;  4XFZ A;  1VQ9 P;  2DGY A;  3G1I A;  3I55 P;  3I56 P;  3CCJ P;  3CCE P;  1VQO P;  2KOD A;  4COP A;  3G6E P;  2EFJ A;  1YJW P;  1VQ6 P;  3E2D A;  5BS1 A;  1VQN P;  3CCM P;  1EIA A;  4U0A A;  2QEX P;  1M1K Q;  3CC4 P;  5F2N A;  3G28 A;  5JPA A;  3H0D A;  2JYG A;  4XRQ A;  1VQ5 P;  1W2B O;  4QNB A;  3CC2 P;  3G71 P;  1YIT P;  3DPH A;  3HYB A;  1N8R Q;  1QRJ A;  1RNI A;  3CCR P;  1VQ4 P;  3H4E A;  1VQ8 P;  3G26 A;  2M8L A;  3G4S P;  2Z44 A;  3RG6 C;  5HGO A;  3DS4 A;  2M8P A;  3M1M A;  4IPY A;  1E6J P;  1K9M Q;  2BHV A;  3OW2 O;  1Q82 Q;  1QVF O;  4GR2 A;  4PH1 A;  2Z46 A;  4GR6 A;  4U0C A;  3LRY A;  1VQM P;  1JJ2 O;  1A8O A;  3CCQ P;  2PEQ A;  1BAJ A;  2Z45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...