2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
b'SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0832
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
2L4BA 5EJDA 3CC4P 3GZMA 3CD6P 2PNGA 1YHQP 2VLQA 1VQMP 1A43A 1X3OA 2E1MA 1K8AQ 2N6YA 3CCEP 1RO2A 1ACPA 2JU1A 2MY5A 3OW2O 2VLPA 2AFDA 2KGAA 2OTJP 3G0VA 2L22A 2JBGA 4HKGA 2ERHA 2XV6A 3I56P 1M90Q 3Q20A 2PEQA 3MGEA 3CCRP 1M6EX 3LRYA 3DS1A 3DPHA 5CZDB 2XZ1C 1RO0A 3DTJA 1Q86Q 2P9XA 2LOLA 3CPWO 4BPHA 1EOQA 1OR5A 2WPTA 2N5IA 2ONTA 2LKIA 5BS2A 2KOSA 5F2OA 2BHVA 2KG6A 2PEOA 1Q82Q 2FQ0A 2MF4A 4U0FA 5EW5E 5F2KA 2EHSA 2CWOA 2JQ4A 4H2WC 2KWLA 1KLPA 1AUMA 2GZFA 2MVVA 1VQLP 2KG8A 2AF8A 5HGOA 3B4QA 1BAJA 1GXHA 2LPKA 2GZGA 1VQ5P 4U0CA 2KGDA 1AYIA 1VQ9P 3I55P 4QKOA 4WYMA 2DNWA 4U0BA 2CGQA 4GR6A 2L0QA 3G6EP 3CXCO 1IMPA 3H4EA 2JYGA 3G28A 2KR5A 3EJDA 1RNIA 1Q81Q 2N6ZA 1A8OA 2OARA 2GDXA 2Z45A 1DNYA 2GZIA 2FVAA 2MR7A 3G29A 2AVAA 3G1IA 1VKUA 4XFZA 1HY8A 3G21A 1T8KA 2FAEA 3LMOA 2LMLA 2CNRA 3CCJP 2EG5A 1Z6MA 2M8PA 3NY7B 3G1GA 2M5RA 2QA4P 4U0EA 1EIAA 2KW2A 3RG6C 3GZLA 1F80D 5HGNA 1M6NA 2X2BA 1VQ8P 5DCKA 2EIAA 2PEJA 4BPFA 5F2NA 3RG2A 4U0AA 2GYKA 4DG9A 2XZ0D 3DS2A 5HGMA 2Z46A 2DGYA 1L0IA 3CCUP 5KP8B 1L0HA 2KORA 2K2QA 1N8RQ 1E6JP 2CG5B 3HZQA 3CCLP 2N98A 2GDYA 4U0DA 5HVCA 3CCSP 1ZMBA 3E2DA 2JAZA 1ZNVA 3CC7P 3CE7A 1UNKA 3GKLC 2JYLA 2LIUA 2MD9A 4M0IA 2KG9A 2JU2A 1QVFO 2K5XA 4PXHB 4COCA 2QEXP 2AFEA 1MZ8A 1FR2A 2MR8A 2LF4A 1QVGO 4CA3A 1VQKP 1IUQA 1VQOP 2VLNA 4XROA 2PEMA 3G71P 1YIJP 1Q7YQ 2PENA 2LTEA 7CEIA 3CMEP 2BUOA 1DV5A 4PH0A 3CCVP 4IZ6A 4PH1A 2FHSC 1VHNA 1KD1Q 3CMAP 2VLOA 2XT1A 1HQBA 3P05A 4H2YC 2GZEA 5BS1A 1VQPP 2KGEA 1YJ9P 2N5HA 3CCMP 2K0YA 5KP6B 1YI2P 1E0HA 5HGLA 2JB0A 2JO0A 2K94A 1K30A 2GDWA 2ROQA 2N50A 2EHTA 2PEIA 1GPJA 3U43A 2PEKA 3G26A 4H2XC 3CC2P 2GZJA 3EJBA 1S72P 4XFXA 1JJ2O 2LL8A 5HV8A 1YITP 3VRLC 1CEIA 5JPAA 2K0DX 1VQ4P 4GR2A 2LIWA 2VSQA 2QNWA 1QRJA 1D1DA 1YJWP 2FADA 1KQSO 2KOPA 2KGCA 4QNBA 3G4SP 4BPGA 5I4TG 2KOOA 3H47A 1K9MQ 1AF8A 2EFJA 2M8LA 1K73Q 2FACA 1UJZA 2KOQA 3NTEA 2NO8A 4MRTC 1YJNP 2OTLP 2L6EA 1VQ7P 4NEOA 4IPYA 2K93A 3WBHA 4R0MA 3M1MA 2XXMA 2FQ1A 3DS5A 3GJNA 3HYBA 4F37A 2L9FA 2MVUA 2FVFA 2KODA 3B5IA 1BXIA 2K92A 2JGPA 1NQ4A 1M1KQ 1W2BO 2K0XA 2PY8A 4PWVB 1M74A 4UHPB 3H0DA 3DS4A 3DS0A 4XRQA 1GXGA 2FQ2A 4COPA 1VQ6P 4XFYA 1NJIQ 2FVEA 3DS3A 1EMVA 3EJEA 2M8NA 3CCQP 1KC8Q 2CQ8A 2Z44A 1IMQA 1VQNP 5KP7B
chains in the Genus database with same CATH topology
3G26A 5HGOA 3CC4P 3CC2P 1BAJA 1S72P 3CD6P 1N8RQ 1YHQP 4XFXA 1VQ5P 1VQMP 1JJ2O 1E6JP 4U0CA 1A43A 2E1MA 1YITP 1K8AQ 3VRLC 1VQ9P 3I55P 5JPAA 1VQ4P 3HZQA 4GR2A 3CCEP 1RO2A 3CCLP 3OW2O 4U0DA 4WYMA 4U0BA 1QRJA 3CCSP 1D1DA 4GR6A 1YJWP 3G6EP 3CXCO 1ZMBA 3E2DA 2OTJP 1KQSO 3H4EA 3G0VA 2JYGA 3CC7P 3G28A 1VQLP 2JYLA 4QNBA 3G4SP 4M0IA 5I4TG 2XV6A 3H47A 3I56P 1RNIA 1K9MQ 1QVFO 2EFJA 2M8LA 1Q81Q 1K73Q 1M90Q 1A8OA 2OARA 3Q20A 2PEQA 2Z45A 3MGEA 4COCA 3CCRP 1M6EX 2QEXP 3NTEA 3LRYA 3DS1A 3DPHA 1YJNP 3G29A 2LF4A 1RO0A 3G1IA 1QVGO 2OTLP 3DTJA 1Q86Q 2P9XA 2L6EA 1VQKP 1VQ7P 4XFZA 3G21A 3CPWO 1IUQA 1VQOP 4IPYA 1EOQA 3WBHA 4XROA 2PEMA 3G71P 3CCJP 2EG5A 3M1MA 1YIJP 1Q7YQ 2PENA 2XXMA 2M8PA 2ONTA 3CMEP 3G1GA 3DS5A 2QA4P 4U0EA 2BUOA 3HYBA 4PH0A 5BS2A 1EIAA 3RG6C 2KODA 3B5IA 4PH1A 3CCVP 1KD1Q 1M6NA 5HGNA 3CMAP 2XT1A 1M1KQ 1VQ8P 5DCKA 1W2BO 5F2OA 2PY8A 3P05A 5BS1A 2EIAA 1M74A 2BHVA 2PEJA 5F2NA 1VQPP 3H0DA 3DS4A 3DS0A 4XRQA 4U0AA 1YJ9P 4COPA 1VQ6P 3CCMP 4XFYA 1NJIQ 2PEOA 1YI2P 1Q82Q 5HGLA 3DS3A 4U0FA 2M8NA 3CCQP 2JO0A 5F2KA 1K30A 2CWOA 3DS2A 5HGMA 2Z46A 1KC8Q 2DGYA 3CCUP 1AUMA 2PEIA 2Z44A 1VQNP 2PEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 2L4B A;  5EJD A;  3CC4 P;  3GZM A;  3CD6 P;  2PNG A;  1YHQ P;  2VLQ A;  1VQM P;  1A43 A;  1X3O A;  2E1M A;  1K8A Q;  2N6Y A;  3CCE P;  1RO2 A;  1ACP A;  2JU1 A;  2MY5 A;  3OW2 O;  2VLP A;  2AFD A;  2KGA A;  2OTJ P;  3G0V A;  2L22 A;  2JBG A;  4HKG A;  2ERH A;  2XV6 A;  3I56 P;  1M90 Q;  3Q20 A;  2PEQ A;  3MGE A;  3CCR P;  1M6E X;  3LRY A;  3DS1 A;  3DPH A;  5CZD B;  2XZ1 C;  1RO0 A;  3DTJ A;  1Q86 Q;  2P9X A;  2LOL A;  3CPW O;  4BPH A;  1EOQ A;  1OR5 A;  2WPT A;  2N5I A;  2ONT A;  2LKI A;  5BS2 A;  2KOS A;  5F2O A;  2BHV A;  2KG6 A;  2PEO A;  1Q82 Q;  2FQ0 A;  2MF4 A;  4U0F A;  5EW5 E;  5F2K A;  2EHS A;  2CWO A;  2JQ4 A;  4H2W C;  2KWL A;  1KLP A;  1AUM A;  2GZF A;  2MVV A;  1VQL P;  2KG8 A;  2AF8 A;  5HGO A;  3B4Q A;  1BAJ A;  1GXH A;  2LPK A;  2GZG A;  1VQ5 P;  4U0C A;  2KGD A;  1AYI A;  1VQ9 P;  3I55 P;  4QKO A;  4WYM A;  2DNW A;  4U0B A;  2CGQ A;  4GR6 A;  2L0Q A;  3G6E P;  3CXC O;  1IMP A;  3H4E A;  2JYG A;  3G28 A;  2KR5 A;  3EJD A;  1RNI A;  1Q81 Q;  2N6Z A;  1A8O A;  2OAR A;  2GDX A;  2Z45 A;  1DNY A;  2GZI A;  2FVA A;  2MR7 A;  3G29 A;  2AVA A;  3G1I A;  1VKU A;  4XFZ A;  1HY8 A;  3G21 A;  1T8K A;  2FAE A;  3LMO A;  2LML A;  2CNR A;  3CCJ P;  2EG5 A;  1Z6M A;  2M8P A;  3NY7 B;  3G1G A;  2M5R A;  2QA4 P;  4U0E A;  1EIA A;  2KW2 A;  3RG6 C;  3GZL A;  1F80 D;  5HGN A;  1M6N A;  2X2B A;  1VQ8 P;  5DCK A;  2EIA A;  2PEJ A;  4BPF A;  5F2N A;  3RG2 A;  4U0A A;  2GYK A;  4DG9 A;  2XZ0 D;  3DS2 A;  5HGM A;  2Z46 A;  2DGY A;  1L0I A;  3CCU P;  5KP8 B;  1L0H A;  2KOR A;  2K2Q A;  1N8R Q;  1E6J P;  2CG5 B;  3HZQ A;  3CCL P;  2N98 A;  2GDY A;  4U0D A;  5HVC A;  3CCS P;  1ZMB A;  3E2D A;  2JAZ A;  1ZNV A;  3CC7 P;  3CE7 A;  1UNK A;  3GKL C;  2JYL A;  2LIU A;  2MD9 A;  4M0I A;  2KG9 A;  2JU2 A;  1QVF O;  2K5X A;  4PXH B;  4COC A;  2QEX P;  2AFE A;  1MZ8 A;  1FR2 A;  2MR8 A;  2LF4 A;  1QVG O;  4CA3 A;  1VQK P;  1IUQ A;  1VQO P;  2VLN A;  4XRO A;  2PEM A;  3G71 P;  1YIJ P;  1Q7Y Q;  2PEN A;  2LTE A;  7CEI A;  3CME P;  2BUO A;  1DV5 A;  4PH0 A;  3CCV P;  4IZ6 A;  4PH1 A;  2FHS C;  1VHN A;  1KD1 Q;  3CMA P;  2VLO A;  2XT1 A;  1HQB A;  3P05 A;  4H2Y C;  2GZE A;  5BS1 A;  1VQP P;  2KGE A;  1YJ9 P;  2N5H A;  3CCM P;  2K0Y A;  5KP6 B;  1YI2 P;  1E0H A;  5HGL A;  2JB0 A;  2JO0 A;  2K94 A;  1K30 A;  2GDW A;  2ROQ A;  2N50 A;  2EHT A;  2PEI A;  1GPJ A;  3U43 A;  2PEK A;  3G26 A;  4H2X C;  3CC2 P;  2GZJ A;  3EJB A;  1S72 P;  4XFX A;  1JJ2 O;  2LL8 A;  5HV8 A;  1YIT P;  3VRL C;  1CEI A;  5JPA A;  2K0D X;  1VQ4 P;  4GR2 A;  2LIW A;  2VSQ A;  2QNW A;  1QRJ A;  1D1D A;  1YJW P;  2FAD A;  1KQS O;  2KOP A;  2KGC A;  4QNB A;  3G4S P;  4BPG A;  5I4T G;  2KOO A;  3H47 A;  1K9M Q;  1AF8 A;  2EFJ A;  2M8L A;  1K73 Q;  2FAC A;  1UJZ A;  2KOQ A;  3NTE A;  2NO8 A;  4MRT C;  1YJN P;  2OTL P;  2L6E A;  1VQ7 P;  4NEO A;  4IPY A;  2K93 A;  3WBH A;  4R0M A;  3M1M A;  2XXM A;  2FQ1 A;  3DS5 A;  3GJN A;  3HYB A;  4F37 A;  2L9F A;  2MVU A;  2FVF A;  2KOD A;  3B5I A;  1BXI A;  2K92 A;  2JGP A;  1NQ4 A;  1M1K Q;  1W2B O;  2K0X A;  2PY8 A;  4PWV B;  1M74 A;  4UHP B;  3H0D A;  3DS4 A;  3DS0 A;  4XRQ A;  1GXG A;  2FQ2 A;  4COP A;  1VQ6 P;  4XFY A;  1NJI Q;  2FVE A;  3DS3 A;  1EMV A;  3EJE A;  2M8N A;  3CCQ P;  1KC8 Q;  2CQ8 A;  2Z44 A;  1IMQ A;  1VQN P;  5KP7 B; 
#chains in the Genus database with same CATH homology
 3G26 A;  5HGO A;  3CC4 P;  3CC2 P;  1BAJ A;  1S72 P;  3CD6 P;  1N8R Q;  1YHQ P;  4XFX A;  1VQ5 P;  1VQM P;  1JJ2 O;  1E6J P;  4U0C A;  1A43 A;  2E1M A;  1YIT P;  1K8A Q;  3VRL C;  1VQ9 P;  3I55 P;  5JPA A;  1VQ4 P;  3HZQ A;  4GR2 A;  3CCE P;  1RO2 A;  3CCL P;  3OW2 O;  4U0D A;  4WYM A;  4U0B A;  1QRJ A;  3CCS P;  1D1D A;  4GR6 A;  1YJW P;  3G6E P;  3CXC O;  1ZMB A;  3E2D A;  2OTJ P;  1KQS O;  3H4E A;  3G0V A;  2JYG A;  3CC7 P;  3G28 A;  1VQL P;  2JYL A;  4QNB A;  3G4S P;  4M0I A;  5I4T G;  2XV6 A;  3H47 A;  3I56 P;  1RNI A;  1K9M Q;  1QVF O;  2EFJ A;  2M8L A;  1Q81 Q;  1K73 Q;  1M90 Q;  1A8O A;  2OAR A;  3Q20 A;  2PEQ A;  2Z45 A;  3MGE A;  4COC A;  3CCR P;  1M6E X;  2QEX P;  3NTE A;  3LRY A;  3DS1 A;  3DPH A;  1YJN P;  3G29 A;  2LF4 A;  1RO0 A;  3G1I A;  1QVG O;  2OTL P;  3DTJ A;  1Q86 Q;  2P9X A;  2L6E A;  1VQK P;  1VQ7 P;  4XFZ A;  3G21 A;  3CPW O;  1IUQ A;  1VQO P;  4IPY A;  1EOQ A;  3WBH A;  4XRO A;  2PEM A;  3G71 P;  3CCJ P;  2EG5 A;  3M1M A;  1YIJ P;  1Q7Y Q;  2PEN A;  2XXM A;  2M8P A;  2ONT A;  3CME P;  3G1G A;  3DS5 A;  2QA4 P;  4U0E A;  2BUO A;  3HYB A;  4PH0 A;  5BS2 A;  1EIA A;  3RG6 C;  2KOD A;  3B5I A;  4PH1 A;  3CCV P;  1KD1 Q;  1M6N A;  5HGN A;  3CMA P;  2XT1 A;  1M1K Q;  1VQ8 P;  5DCK A;  1W2B O;  5F2O A;  2PY8 A;  3P05 A;  5BS1 A;  2EIA A;  1M74 A;  2BHV A;  2PEJ A;  5F2N A;  1VQP P;  3H0D A;  3DS4 A;  3DS0 A;  4XRQ A;  4U0A A;  1YJ9 P;  4COP A;  1VQ6 P;  3CCM P;  4XFY A;  1NJI Q;  2PEO A;  1YI2 P;  1Q82 Q;  5HGL A;  3DS3 A;  4U0F A;  2M8N A;  3CCQ P;  2JO0 A;  5F2K A;  1K30 A;  2CWO A;  3DS2 A;  5HGM A;  2Z46 A;  1KC8 Q;  2DGY A;  3CCU P;  1AUM A;  2PEI A;  2Z44 A;  1VQN P;  2PEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...