2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0832
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
2PNGA 3CD6P 2EIAA 1VQ8P 1K9MQ 2GYKA 3U43A 2N98A 4PH1A 2JQ4A 3H4EA 4XROA 2OARA 2KOQA 1IMPA 1VQ5P 2MVVA 1UJZA 3E2DA 1Z6MA 3CE7A 5HGLA 5HGNA 2JO0A 5F2NA 4U0BA 2K5XA 1BAJA 3CC4P 2XXMA 2LIUA 2OTJP 2LF4A 2GDXA 2QNWA 2LL8A 4GR6A 7CEIA 2AF8A 3CCJP 2CGQA 2MVUA 3DPHA 2L22A 5HV8A 2GDYA 2PEOA 3G1GA 4U0FA 1N8RQ 3MGEA 2FVFA 3HYBA 1VQOP 2MF4A 2KODA 4BPFA 1EMVA 2WPTA 1YI2P 2CWOA 3EJBA 5CZDB 2QEXP 2KGEA 2PEKA 4PWVB 3WBHA 2CQ8A 3CCLP 3CCEP 1E0HA 1EIAA 3CCMP 1YJNP 1VQ9P 2M5RA 2EHSA 3I56P 1VQ6P 2K0DX 3I55P 2PEIA 3EJDA 2FQ1A 2PY8A 2FVEA 2ONTA 1VQNP 1JJ2O 3CMAP 1BXIA 2N6ZA 4U0DA 2XZ1C 3CXCO 2LIWA 3G6EP 1IMQA 2L6EA 1RNIA 2ROQA 1T8KA 4PH0A 3CPWO 1D1DA 1FR2A 4H2YC 2MY5A 2M8PA 5KP6B 1X3OA 4U0AA 2M8LA 3G71P 3CCSP 4F37A 2GZJA 4QNBA 3NY7B 2CNRA 2FAEA 2FVAA 4NEOA 2K94A 1AYIA 1L0IA 2VSQA 3B4QA 2CG5B 3NTEA 3G4SP 2DGYA 2KGCA 1E6JP 2AFEA 2L9FA 2LPKA 2FADA 2KG8A 3G26A 3B5IA 3CCRP 1VHNA 3GKLC 2K0XA 1F80D 1M6EX 3CCQP 2KGAA 1QVFO 3G21A 1UNKA 1GPJA 1HY8A 1KLPA 5I4TG 1YJWP 3LMOA 3EJEA 4DG9A 1QVGO 2NO8A 2GZGA 1Q7YQ 3G29A 2JU2A 2AVAA 1CEIA 1IUQA 5JPAA 1NJIQ 1Q86Q 1KQSO 2PEJA 2M8NA 2EG5A 2K93A 2MD9A 4MRTC 2K0YA 5BS2A 3M1MA 2GZEA 2GDWA 2ERHA 3G1IA 4CA3A 1KD1Q 4PXHB 4IZ6A 1NQ4A 2MR8A 2LTEA 2GZFA 2EFJA 1S72P 1Q82Q 4QKOA 3H47A 1ZMBA 3GZLA 1M74A 1MZ8A 1M6NA 1QRJA 5HGOA 2KOPA 4XFYA 3RG2A 2E1MA 2GZIA 3DS2A 2K2QA 1K8AQ 3G0VA 1VKUA 3VRLC 2L0QA 1EOQA 1ACPA 2LOLA 1VQLP 2KGDA 2AFDA 1DV5A 4R0MA 2X2BA 2FHSC 1RO2A 4U0CA 4GR2A 1GXHA 2PENA 1YIJP 2JB0A 4H2XC 2XT1A 1AUMA 2VLOA 5F2KA 1A8OA 3H0DA 2KG6A 3P05A 2VLNA 3GJNA 5KP8B 1AF8A 1VQ7P 2MR7A 3DS3A 2OTLP 2EHTA 1Q81Q 2VLPA 2KR5A 2Z45A 4HKGA 4XFZA 3CMEP 4COPA 2LMLA 2KOSA 2XV6A 2JGPA 4IPYA 2BHVA 1OR5A 2KG9A 5HVCA 2N5HA 2JAZA 2LKIA 1ZNVA 2JYLA 2JBGA 4XFXA 5EW5E 5BS1A 4XRQA 2XZ0D 2K92A 4H2WC 2KWLA 1DNYA 1HQBA 4BPHA 1YJ9P 3G28A 3OW2O 2KW2A 1YHQP 1K30A 1KC8Q 1VQKP 2KOOA 1A43A 1K73Q 5KP7B 1M1KQ 3CC7P 5DCKA 3DS1A 5HGMA 2PEQA 1M90Q 2VLQA 3DTJA 1VQMP 1L0HA 1VQPP 5EJDA 5F2OA 3HZQA 2DNWA 2FQ2A 2P9XA 2KORA 2L4BA 3DS0A 4BPGA 1YITP 2BUOA 2QA4P 2N6YA 1GXGA 4M0IA 3Q20A 2JU1A 4UHPB 2JYGA 2FACA 2N5IA 3CC2P 1W2BO 3CCUP 3GZMA 3CCVP 3LRYA 2N50A 2PEMA 1RO0A 2FQ0A 3RG6C 2Z44A 3DS4A 3DS5A 4WYMA 2Z46A 1VQ4P 4COCA 4U0EA
chains in the Genus database with same CATH topology
1EIAA 3CCMP 1YJNP 3CD6P 1VQ9P 2EIAA 1IUQA 1VQ8P 3I56P 1K9MQ 1VQ6P 2Z45A 5JPAA 3I55P 2PEIA 1NJIQ 4XFZA 3CMEP 1Q86Q 2PY8A 4COPA 1KQSO 4PH1A 2ONTA 2XV6A 1VQNP 4IPYA 2BHVA 2PEJA 3H4EA 1JJ2O 2M8NA 3CMAP 4XROA 2OARA 2EG5A 4U0DA 5BS2A 1VQ5P 2JYLA 3M1MA 4XFXA 3E2DA 5BS1A 3CXCO 3G6EP 4XRQA 2L6EA 5HGLA 5HGNA 3G1IA 2JO0A 5F2NA 1RNIA 4U0BA 1KD1Q 4PH0A 3CPWO 1YJ9P 3G28A 1D1DA 3OW2O 1YHQP 1BAJA 1K30A 2M8PA 3CC4P 2XXMA 2EFJA 1KC8Q 1VQKP 1S72P 1Q82Q 2OTJP 1A43A 2LF4A 4U0AA 3H47A 1K73Q 1ZMBA 2M8LA 1M74A 1M1KQ 3CC7P 1M6NA 3G71P 3CCSP 1QRJA 5HGOA 4GR6A 4XFYA 5DCKA 4QNBA 3DS1A 5HGMA 3CCJP 2PEQA 1M90Q 3DTJA 1VQMP 1VQPP 2E1MA 5F2OA 3DS2A 3HZQA 3DPHA 1K8AQ 2P9XA 3G0VA 3VRLC 3NTEA 3DS0A 3G4SP 2DGYA 1EOQA 1E6JP 1YITP 1VQLP 2PEOA 3G1GA 2BUOA 2QA4P 4U0FA 1N8RQ 3MGEA 3HYBA 1RO2A 3G26A 3B5IA 4U0CA 4M0IA 3CCRP 1VQOP 3Q20A 2JYGA 4GR2A 2PENA 1YIJP 1M6EX 2KODA 3CC2P 3CCQP 1W2BO 2XT1A 1AUMA 3CCUP 1YI2P 5F2KA 1QVFO 1A8OA 3G21A 3H0DA 3CCVP 2CWOA 3LRYA 3P05A 2QEXP 2PEMA 5I4TG 1YJWP 2PEKA 1RO0A 3RG6C 2Z44A 3DS4A 1VQ7P 3DS5A 3WBHA 3DS3A 4WYMA 1QVGO 2OTLP 3CCLP 2Z46A 1Q7YQ 1VQ4P 3G29A 4COCA 3CCEP 1Q81Q 4U0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 2PNG A;  3CD6 P;  2EIA A;  1VQ8 P;  1K9M Q;  2GYK A;  3U43 A;  2N98 A;  4PH1 A;  2JQ4 A;  3H4E A;  4XRO A;  2OAR A;  2KOQ A;  1IMP A;  1VQ5 P;  2MVV A;  1UJZ A;  3E2D A;  1Z6M A;  3CE7 A;  5HGL A;  5HGN A;  2JO0 A;  5F2N A;  4U0B A;  2K5X A;  1BAJ A;  3CC4 P;  2XXM A;  2LIU A;  2OTJ P;  2LF4 A;  2GDX A;  2QNW A;  2LL8 A;  4GR6 A;  7CEI A;  2AF8 A;  3CCJ P;  2CGQ A;  2MVU A;  3DPH A;  2L22 A;  5HV8 A;  2GDY A;  2PEO A;  3G1G A;  4U0F A;  1N8R Q;  3MGE A;  2FVF A;  3HYB A;  1VQO P;  2MF4 A;  2KOD A;  4BPF A;  1EMV A;  2WPT A;  1YI2 P;  2CWO A;  3EJB A;  5CZD B;  2QEX P;  2KGE A;  2PEK A;  4PWV B;  3WBH A;  2CQ8 A;  3CCL P;  3CCE P;  1E0H A;  1EIA A;  3CCM P;  1YJN P;  1VQ9 P;  2M5R A;  2EHS A;  3I56 P;  1VQ6 P;  2K0D X;  3I55 P;  2PEI A;  3EJD A;  2FQ1 A;  2PY8 A;  2FVE A;  2ONT A;  1VQN P;  1JJ2 O;  3CMA P;  1BXI A;  2N6Z A;  4U0D A;  2XZ1 C;  3CXC O;  2LIW A;  3G6E P;  1IMQ A;  2L6E A;  1RNI A;  2ROQ A;  1T8K A;  4PH0 A;  3CPW O;  1D1D A;  1FR2 A;  4H2Y C;  2MY5 A;  2M8P A;  5KP6 B;  1X3O A;  4U0A A;  2M8L A;  3G71 P;  3CCS P;  4F37 A;  2GZJ A;  4QNB A;  3NY7 B;  2CNR A;  2FAE A;  2FVA A;  4NEO A;  2K94 A;  1AYI A;  1L0I A;  2VSQ A;  3B4Q A;  2CG5 B;  3NTE A;  3G4S P;  2DGY A;  2KGC A;  1E6J P;  2AFE A;  2L9F A;  2LPK A;  2FAD A;  2KG8 A;  3G26 A;  3B5I A;  3CCR P;  1VHN A;  3GKL C;  2K0X A;  1F80 D;  1M6E X;  3CCQ P;  2KGA A;  1QVF O;  3G21 A;  1UNK A;  1GPJ A;  1HY8 A;  1KLP A;  5I4T G;  1YJW P;  3LMO A;  3EJE A;  4DG9 A;  1QVG O;  2NO8 A;  2GZG A;  1Q7Y Q;  3G29 A;  2JU2 A;  2AVA A;  1CEI A;  1IUQ A;  5JPA A;  1NJI Q;  1Q86 Q;  1KQS O;  2PEJ A;  2M8N A;  2EG5 A;  2K93 A;  2MD9 A;  4MRT C;  2K0Y A;  5BS2 A;  3M1M A;  2GZE A;  2GDW A;  2ERH A;  3G1I A;  4CA3 A;  1KD1 Q;  4PXH B;  4IZ6 A;  1NQ4 A;  2MR8 A;  2LTE A;  2GZF A;  2EFJ A;  1S72 P;  1Q82 Q;  4QKO A;  3H47 A;  1ZMB A;  3GZL A;  1M74 A;  1MZ8 A;  1M6N A;  1QRJ A;  5HGO A;  2KOP A;  4XFY A;  3RG2 A;  2E1M A;  2GZI A;  3DS2 A;  2K2Q A;  1K8A Q;  3G0V A;  1VKU A;  3VRL C;  2L0Q A;  1EOQ A;  1ACP A;  2LOL A;  1VQL P;  2KGD A;  2AFD A;  1DV5 A;  4R0M A;  2X2B A;  2FHS C;  1RO2 A;  4U0C A;  4GR2 A;  1GXH A;  2PEN A;  1YIJ P;  2JB0 A;  4H2X C;  2XT1 A;  1AUM A;  2VLO A;  5F2K A;  1A8O A;  3H0D A;  2KG6 A;  3P05 A;  2VLN A;  3GJN A;  5KP8 B;  1AF8 A;  1VQ7 P;  2MR7 A;  3DS3 A;  2OTL P;  2EHT A;  1Q81 Q;  2VLP A;  2KR5 A;  2Z45 A;  4HKG A;  4XFZ A;  3CME P;  4COP A;  2LML A;  2KOS A;  2XV6 A;  2JGP A;  4IPY A;  2BHV A;  1OR5 A;  2KG9 A;  5HVC A;  2N5H A;  2JAZ A;  2LKI A;  1ZNV A;  2JYL A;  2JBG A;  4XFX A;  5EW5 E;  5BS1 A;  4XRQ A;  2XZ0 D;  2K92 A;  4H2W C;  2KWL A;  1DNY A;  1HQB A;  4BPH A;  1YJ9 P;  3G28 A;  3OW2 O;  2KW2 A;  1YHQ P;  1K30 A;  1KC8 Q;  1VQK P;  2KOO A;  1A43 A;  1K73 Q;  5KP7 B;  1M1K Q;  3CC7 P;  5DCK A;  3DS1 A;  5HGM A;  2PEQ A;  1M90 Q;  2VLQ A;  3DTJ A;  1VQM P;  1L0H A;  1VQP P;  5EJD A;  5F2O A;  3HZQ A;  2DNW A;  2FQ2 A;  2P9X A;  2KOR A;  2L4B A;  3DS0 A;  4BPG A;  1YIT P;  2BUO A;  2QA4 P;  2N6Y A;  1GXG A;  4M0I A;  3Q20 A;  2JU1 A;  4UHP B;  2JYG A;  2FAC A;  2N5I A;  3CC2 P;  1W2B O;  3CCU P;  3GZM A;  3CCV P;  3LRY A;  2N50 A;  2PEM A;  1RO0 A;  2FQ0 A;  3RG6 C;  2Z44 A;  3DS4 A;  3DS5 A;  4WYM A;  2Z46 A;  1VQ4 P;  4COC A;  4U0E A; 
#chains in the Genus database with same CATH homology
 1EIA A;  3CCM P;  1YJN P;  3CD6 P;  1VQ9 P;  2EIA A;  1IUQ A;  1VQ8 P;  3I56 P;  1K9M Q;  1VQ6 P;  2Z45 A;  5JPA A;  3I55 P;  2PEI A;  1NJI Q;  4XFZ A;  3CME P;  1Q86 Q;  2PY8 A;  4COP A;  1KQS O;  4PH1 A;  2ONT A;  2XV6 A;  1VQN P;  4IPY A;  2BHV A;  2PEJ A;  3H4E A;  1JJ2 O;  2M8N A;  3CMA P;  4XRO A;  2OAR A;  2EG5 A;  4U0D A;  5BS2 A;  1VQ5 P;  2JYL A;  3M1M A;  4XFX A;  3E2D A;  5BS1 A;  3CXC O;  3G6E P;  4XRQ A;  2L6E A;  5HGL A;  5HGN A;  3G1I A;  2JO0 A;  5F2N A;  1RNI A;  4U0B A;  1KD1 Q;  4PH0 A;  3CPW O;  1YJ9 P;  3G28 A;  1D1D A;  3OW2 O;  1YHQ P;  1BAJ A;  1K30 A;  2M8P A;  3CC4 P;  2XXM A;  2EFJ A;  1KC8 Q;  1VQK P;  1S72 P;  1Q82 Q;  2OTJ P;  1A43 A;  2LF4 A;  4U0A A;  3H47 A;  1K73 Q;  1ZMB A;  2M8L A;  1M74 A;  1M1K Q;  3CC7 P;  1M6N A;  3G71 P;  3CCS P;  1QRJ A;  5HGO A;  4GR6 A;  4XFY A;  5DCK A;  4QNB A;  3DS1 A;  5HGM A;  3CCJ P;  2PEQ A;  1M90 Q;  3DTJ A;  1VQM P;  1VQP P;  2E1M A;  5F2O A;  3DS2 A;  3HZQ A;  3DPH A;  1K8A Q;  2P9X A;  3G0V A;  3VRL C;  3NTE A;  3DS0 A;  3G4S P;  2DGY A;  1EOQ A;  1E6J P;  1YIT P;  1VQL P;  2PEO A;  3G1G A;  2BUO A;  2QA4 P;  4U0F A;  1N8R Q;  3MGE A;  3HYB A;  1RO2 A;  3G26 A;  3B5I A;  4U0C A;  4M0I A;  3CCR P;  1VQO P;  3Q20 A;  2JYG A;  4GR2 A;  2PEN A;  1YIJ P;  1M6E X;  2KOD A;  3CC2 P;  3CCQ P;  1W2B O;  2XT1 A;  1AUM A;  3CCU P;  1YI2 P;  5F2K A;  1QVF O;  1A8O A;  3G21 A;  3H0D A;  3CCV P;  2CWO A;  3LRY A;  3P05 A;  2QEX P;  2PEM A;  5I4T G;  1YJW P;  2PEK A;  1RO0 A;  3RG6 C;  2Z44 A;  3DS4 A;  1VQ7 P;  3DS5 A;  3WBH A;  3DS3 A;  4WYM A;  1QVG O;  2OTL P;  3CCL P;  2Z46 A;  1Q7Y Q;  1VQ4 P;  3G29 A;  4COC A;  3CCE P;  1Q81 Q;  4U0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...