2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0832
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
3CMEP 2L22A 2FACA 2NO8A 3G1IA 5JPAA 2GDYA 2M8NA 4U0DA 1M6EX 3DS2A 1YI2P 3CMAP 2K0XA 3H4EA 4U0AA 2P9XA 2LKIA 2CG5B 2FADA 5I4TG 3G28A 3DS4A 2LIWA 4XFZA 1UNKA 2XT1A 4COCA 2KGAA 2FVEA 2JU2A 4QKOA 2QEXP 2LOLA 1VQ4P 2K94A 5F2NA 5BS2A 5HGLA 2L0QA 1K8AQ 2JU1A 3RG2A 4WYMA 2N6ZA 2LF4A 4M0IA 2CWOA 2XZ1C 2PENA 3RG6C 2DNWA 2KW2A 1L0HA 1F80D 2VLQA 3MGEA 2KODA 3P05A 1IMQA 1X3OA 4BPFA 3CCJP 1VQ5P 2GDXA 2OTJP 2KG9A 1EMVA 3DTJA 1VQ8P 2LPKA 2XV6A 2JO0A 4U0BA 3CCSP 3G71P 1VQ6P 1YHQP 2ERHA 3EJDA 2N98A 3M1MA 2K93A 3NTEA 4BPGA 1AUMA 1T8KA 2PEIA 2LIUA 1GXHA 4PXHB 1ZNVA 4XRQA 2VLNA 2AVAA 2OTLP 1VQMP 2PEKA 1OR5A 2K2QA 2EHTA 2AF8A 3EJBA 2FHSC 1Q82Q 2MD9A 1IUQA 2PEQA 3EJEA 7CEIA 3B4QA 3B5IA 2KOPA 2VSQA 2AFEA 1GPJA 3GZMA 2L9FA 3WBHA 2CQ8A 2GZFA 1YJNP 2X2BA 4H2XC 2JBGA 1A43A 3H47A 2FAEA 1YJWP 3G21A 5KP8B 2KORA 4IPYA 3CCRP 4DG9A 3OW2O 1Q86Q 4UHPB 3Q20A 2PY8A 1L0IA 5HV8A 1HY8A 2GYKA 2DGYA 3CE7A 2EG5A 3G0VA 2FVAA 1YJ9P 1ACPA 2QNWA 1VHNA 3GZLA 1VQOP 1AF8A 2E1MA 2XXMA 2KOOA 5KP6B 3G6EP 2CNRA 4IZ6A 5CZDB 1EIAA 2FQ2A 4H2WC 5F2OA 1M1KQ 1Z6MA 4MRTC 1VQPP 1E6JP 2MY5A 2L4BA 1KQSO 1HQBA 2KG6A 2M8PA 4COPA 3CPWO 1JJ2O 4BPHA 2GZEA 2KGCA 1FR2A 1VKUA 3DPHA 2JYGA 4HKGA 3CXCO 2L6EA 5KP7B 1CEIA 2FVFA 2N6YA 2PEMA 1VQLP 1GXGA 1K9MQ 1AYIA 2JGPA 1BXIA 1Q81Q 3G1GA 2Z44A 1D1DA 1NJIQ 3CC2P 2PEJA 1RO2A 1S72P 1VQ7P 5HGMA 2BHVA 4QNBA 2GZGA 4XFXA 5EJDA 1QVGO 5HGNA 2GDWA 2LMLA 3LRYA 2FQ1A 2GZJA 2MVUA 2CGQA 2FQ0A 2KOSA 3G29A 1K30A 2N5HA 2KOQA 1MZ8A 2PEOA 1VQKP 3I56P 4PWVB 1EOQA 4F37A 3DS0A 1W2BO 1YITP 1IMPA 2JYLA 1Q7YQ 4CA3A 2WPTA 3CC7P 1VQNP 2JQ4A 5EW5E 2AFDA 2XZ0D 2KWLA 1RNIA 1NQ4A 5DCKA 4PH0A 2Z46A 2ONTA 1KC8Q 3CCMP 2KR5A 4XFYA 2K5XA 1QRJA 1M74A 2LL8A 2EFJA 3GKLC 1DNYA 3HZQA 2GZIA 4XROA 3CCLP 4U0EA 3CCQP 1VQ9P 2LTEA 3E2DA 4GR6A 1UJZA 2BUOA 4U0CA 4U0FA 1KD1Q 2QA4P 3CCEP 2ROQA 1K73Q 2KG8A 5HGOA 1E0HA 1N8RQ 2N50A 2VLOA 2MR8A 2PNGA 3DS5A 3CCUP 3CCVP 4R0MA 3DS1A 3G4SP 3GJNA 2M5RA 1BAJA 3VRLC 1YIJP 2M8LA 1RO0A 2N5IA 3NY7B 3CD6P 2K92A 1M90Q 2MVVA 3I55P 3LMOA 4H2YC 2KGDA 2OARA 1A8OA 3H0DA 2JAZA 2EHSA 2KGEA 3G26A 1ZMBA 5HVCA 3CC4P 4NEOA 1QVFO 1DV5A 2VLPA 2K0YA 5BS1A 2MF4A 3DS3A 2MR7A 2K0DX 4GR2A 4PH1A 2EIAA 2Z45A 1KLPA 2JB0A 1M6NA 3HYBA 5F2KA 3U43A
chains in the Genus database with same CATH topology
3CMEP 1E6JP 3G1IA 3HZQA 1KQSO 5JPAA 4XRQA 4XROA 3CCLP 2OTLP 2M8NA 2M8PA 4U0EA 4COPA 3CPWO 3CCQP 1VQMP 1JJ2O 2PEKA 4U0DA 1M6EX 1VQ9P 3DS2A 3E2DA 3CMAP 1YI2P 4GR6A 2BUOA 4U0CA 3H4EA 4U0FA 1KD1Q 3DPHA 2JYGA 4U0AA 2QA4P 3CCEP 2P9XA 1Q82Q 1K73Q 1IUQA 5HGOA 5I4TG 3CXCO 2L6EA 3G28A 2PEQA 3DS4A 1N8RQ 4XFZA 2PEMA 1VQLP 1K9MQ 3CCUP 3DS5A 3B5IA 3CCVP 2XT1A 4COCA 3DS1A 3G4SP 3G1GA 2QEXP 3VRLC 1BAJA 2Z44A 3WBHA 1D1DA 1VQ4P 5F2NA 1YJNP 2EFJA 1YIJP 1NJIQ 3CC2P 5BS2A 2PEJA 1RO2A 1S72P 1A43A 1VQ7P 5HGMA 2BHVA 1RO0A 4QNBA 3H47A 5HGLA 2M8LA 4XFXA 1QVGO 5HGNA 1YJWP 1K8AQ 3G21A 3CD6P 1M90Q 4WYMA 3LRYA 3I55P 4IPYA 2LF4A 4M0IA 3CCRP 3OW2O 1Q86Q 2CWOA 3G29A 1K30A 2OARA 2PEOA 2PENA 3RG6C 3Q20A 2PY8A 1A8OA 1VQKP 3I56P 3H0DA 3MGEA 2DGYA 1EOQA 2KODA 3DS0A 2EG5A 3P05A 1W2BO 1YITP 3G26A 3G0VA 2JYLA 1YJ9P 1ZMBA 3CC4P 1QVFO 3CCJP 1VQ5P 1Q7YQ 3CC7P 1VQNP 1VQOP 2OTJP 2E1MA 3DTJA 5BS1A 1VQ8P 2XXMA 3G6EP 3DS3A 1RNIA 2XV6A 2JO0A 4GR2A 4U0BA 2Z46A 5DCKA 4PH0A 3G71P 2ONTA 3CCSP 4PH1A 1YHQP 1KC8Q 1VQ6P 3CCMP 4XFYA 3M1MA 2EIAA 1EIAA 5F2OA 1M1KQ 3NTEA 1AUMA 1QRJA 1M74A 2Z45A 2PEIA 1M6NA 3HYBA 5F2KA 1Q81Q 1VQPP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 3CME P;  2L22 A;  2FAC A;  2NO8 A;  3G1I A;  5JPA A;  2GDY A;  2M8N A;  4U0D A;  1M6E X;  3DS2 A;  1YI2 P;  3CMA P;  2K0X A;  3H4E A;  4U0A A;  2P9X A;  2LKI A;  2CG5 B;  2FAD A;  5I4T G;  3G28 A;  3DS4 A;  2LIW A;  4XFZ A;  1UNK A;  2XT1 A;  4COC A;  2KGA A;  2FVE A;  2JU2 A;  4QKO A;  2QEX P;  2LOL A;  1VQ4 P;  2K94 A;  5F2N A;  5BS2 A;  5HGL A;  2L0Q A;  1K8A Q;  2JU1 A;  3RG2 A;  4WYM A;  2N6Z A;  2LF4 A;  4M0I A;  2CWO A;  2XZ1 C;  2PEN A;  3RG6 C;  2DNW A;  2KW2 A;  1L0H A;  1F80 D;  2VLQ A;  3MGE A;  2KOD A;  3P05 A;  1IMQ A;  1X3O A;  4BPF A;  3CCJ P;  1VQ5 P;  2GDX A;  2OTJ P;  2KG9 A;  1EMV A;  3DTJ A;  1VQ8 P;  2LPK A;  2XV6 A;  2JO0 A;  4U0B A;  3CCS P;  3G71 P;  1VQ6 P;  1YHQ P;  2ERH A;  3EJD A;  2N98 A;  3M1M A;  2K93 A;  3NTE A;  4BPG A;  1AUM A;  1T8K A;  2PEI A;  2LIU A;  1GXH A;  4PXH B;  1ZNV A;  4XRQ A;  2VLN A;  2AVA A;  2OTL P;  1VQM P;  2PEK A;  1OR5 A;  2K2Q A;  2EHT A;  2AF8 A;  3EJB A;  2FHS C;  1Q82 Q;  2MD9 A;  1IUQ A;  2PEQ A;  3EJE A;  7CEI A;  3B4Q A;  3B5I A;  2KOP A;  2VSQ A;  2AFE A;  1GPJ A;  3GZM A;  2L9F A;  3WBH A;  2CQ8 A;  2GZF A;  1YJN P;  2X2B A;  4H2X C;  2JBG A;  1A43 A;  3H47 A;  2FAE A;  1YJW P;  3G21 A;  5KP8 B;  2KOR A;  4IPY A;  3CCR P;  4DG9 A;  3OW2 O;  1Q86 Q;  4UHP B;  3Q20 A;  2PY8 A;  1L0I A;  5HV8 A;  1HY8 A;  2GYK A;  2DGY A;  3CE7 A;  2EG5 A;  3G0V A;  2FVA A;  1YJ9 P;  1ACP A;  2QNW A;  1VHN A;  3GZL A;  1VQO P;  1AF8 A;  2E1M A;  2XXM A;  2KOO A;  5KP6 B;  3G6E P;  2CNR A;  4IZ6 A;  5CZD B;  1EIA A;  2FQ2 A;  4H2W C;  5F2O A;  1M1K Q;  1Z6M A;  4MRT C;  1VQP P;  1E6J P;  2MY5 A;  2L4B A;  1KQS O;  1HQB A;  2KG6 A;  2M8P A;  4COP A;  3CPW O;  1JJ2 O;  4BPH A;  2GZE A;  2KGC A;  1FR2 A;  1VKU A;  3DPH A;  2JYG A;  4HKG A;  3CXC O;  2L6E A;  5KP7 B;  1CEI A;  2FVF A;  2N6Y A;  2PEM A;  1VQL P;  1GXG A;  1K9M Q;  1AYI A;  2JGP A;  1BXI A;  1Q81 Q;  3G1G A;  2Z44 A;  1D1D A;  1NJI Q;  3CC2 P;  2PEJ A;  1RO2 A;  1S72 P;  1VQ7 P;  5HGM A;  2BHV A;  4QNB A;  2GZG A;  4XFX A;  5EJD A;  1QVG O;  5HGN A;  2GDW A;  2LML A;  3LRY A;  2FQ1 A;  2GZJ A;  2MVU A;  2CGQ A;  2FQ0 A;  2KOS A;  3G29 A;  1K30 A;  2N5H A;  2KOQ A;  1MZ8 A;  2PEO A;  1VQK P;  3I56 P;  4PWV B;  1EOQ A;  4F37 A;  3DS0 A;  1W2B O;  1YIT P;  1IMP A;  2JYL A;  1Q7Y Q;  4CA3 A;  2WPT A;  3CC7 P;  1VQN P;  2JQ4 A;  5EW5 E;  2AFD A;  2XZ0 D;  2KWL A;  1RNI A;  1NQ4 A;  5DCK A;  4PH0 A;  2Z46 A;  2ONT A;  1KC8 Q;  3CCM P;  2KR5 A;  4XFY A;  2K5X A;  1QRJ A;  1M74 A;  2LL8 A;  2EFJ A;  3GKL C;  1DNY A;  3HZQ A;  2GZI A;  4XRO A;  3CCL P;  4U0E A;  3CCQ P;  1VQ9 P;  2LTE A;  3E2D A;  4GR6 A;  1UJZ A;  2BUO A;  4U0C A;  4U0F A;  1KD1 Q;  2QA4 P;  3CCE P;  2ROQ A;  1K73 Q;  2KG8 A;  5HGO A;  1E0H A;  1N8R Q;  2N50 A;  2VLO A;  2MR8 A;  2PNG A;  3DS5 A;  3CCU P;  3CCV P;  4R0M A;  3DS1 A;  3G4S P;  3GJN A;  2M5R A;  1BAJ A;  3VRL C;  1YIJ P;  2M8L A;  1RO0 A;  2N5I A;  3NY7 B;  3CD6 P;  2K92 A;  1M90 Q;  2MVV A;  3I55 P;  3LMO A;  4H2Y C;  2KGD A;  2OAR A;  1A8O A;  3H0D A;  2JAZ A;  2EHS A;  2KGE A;  3G26 A;  1ZMB A;  5HVC A;  3CC4 P;  4NEO A;  1QVF O;  1DV5 A;  2VLP A;  2K0Y A;  5BS1 A;  2MF4 A;  3DS3 A;  2MR7 A;  2K0D X;  4GR2 A;  4PH1 A;  2EIA A;  2Z45 A;  1KLP A;  2JB0 A;  1M6N A;  3HYB A;  5F2K A;  3U43 A; 
#chains in the Genus database with same CATH homology
 3CME P;  1E6J P;  3G1I A;  3HZQ A;  1KQS O;  5JPA A;  4XRQ A;  4XRO A;  3CCL P;  2OTL P;  2M8N A;  2M8P A;  4U0E A;  4COP A;  3CPW O;  3CCQ P;  1VQM P;  1JJ2 O;  2PEK A;  4U0D A;  1M6E X;  1VQ9 P;  3DS2 A;  3E2D A;  3CMA P;  1YI2 P;  4GR6 A;  2BUO A;  4U0C A;  3H4E A;  4U0F A;  1KD1 Q;  3DPH A;  2JYG A;  4U0A A;  2QA4 P;  3CCE P;  2P9X A;  1Q82 Q;  1K73 Q;  1IUQ A;  5HGO A;  5I4T G;  3CXC O;  2L6E A;  3G28 A;  2PEQ A;  3DS4 A;  1N8R Q;  4XFZ A;  2PEM A;  1VQL P;  1K9M Q;  3CCU P;  3DS5 A;  3B5I A;  3CCV P;  2XT1 A;  4COC A;  3DS1 A;  3G4S P;  3G1G A;  2QEX P;  3VRL C;  1BAJ A;  2Z44 A;  3WBH A;  1D1D A;  1VQ4 P;  5F2N A;  1YJN P;  2EFJ A;  1YIJ P;  1NJI Q;  3CC2 P;  5BS2 A;  2PEJ A;  1RO2 A;  1S72 P;  1A43 A;  1VQ7 P;  5HGM A;  2BHV A;  1RO0 A;  4QNB A;  3H47 A;  5HGL A;  2M8L A;  4XFX A;  1QVG O;  5HGN A;  1YJW P;  1K8A Q;  3G21 A;  3CD6 P;  1M90 Q;  4WYM A;  3LRY A;  3I55 P;  4IPY A;  2LF4 A;  4M0I A;  3CCR P;  3OW2 O;  1Q86 Q;  2CWO A;  3G29 A;  1K30 A;  2OAR A;  2PEO A;  2PEN A;  3RG6 C;  3Q20 A;  2PY8 A;  1A8O A;  1VQK P;  3I56 P;  3H0D A;  3MGE A;  2DGY A;  1EOQ A;  2KOD A;  3DS0 A;  2EG5 A;  3P05 A;  1W2B O;  1YIT P;  3G26 A;  3G0V A;  2JYL A;  1YJ9 P;  1ZMB A;  3CC4 P;  1QVF O;  3CCJ P;  1VQ5 P;  1Q7Y Q;  3CC7 P;  1VQN P;  1VQO P;  2OTJ P;  2E1M A;  3DTJ A;  5BS1 A;  1VQ8 P;  2XXM A;  3G6E P;  3DS3 A;  1RNI A;  2XV6 A;  2JO0 A;  4GR2 A;  4U0B A;  2Z46 A;  5DCK A;  4PH0 A;  3G71 P;  2ONT A;  3CCS P;  4PH1 A;  1YHQ P;  1KC8 Q;  1VQ6 P;  3CCM P;  4XFY A;  3M1M A;  2EIA A;  1EIA A;  5F2O A;  1M1K Q;  3NTE A;  1AUM A;  1QRJ A;  1M74 A;  2Z45 A;  2PEI A;  1M6N A;  3HYB A;  5F2K A;  1Q81 Q;  1VQP P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...