2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0832
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
2LF4A 3DS2A 2OARA 3DS5A 2GDYA 3CCQP 4U0FA 1RO2A 2CWOA 1AYIA 4COCA 2N6YA 2XXMA 2GZJA 2JU1A 2K5XA 3U43A 2EIAA 2FADA 1E0HA 5KP6B 2P9XA 1VQ8P 3GZMA 1VKUA 3B5IA 3G21A 5CZDB 2M5RA 2JB0A 4GR6A 5DCKA 1M6EX 2KR5A 2MD9A 1YJWP 2AVAA 2E1MA 3H47A 4PH0A 4QKOA 2ONTA 2MF4A 2XZ0D 4IPYA 2VLOA 2K0YA 2LKIA 2JYGA 2GZIA 1VHNA 4U0DA 3LMOA 2LOLA 4H2XC 1K30A 1ACPA 2PEJA 2PY8A 1YI2P 1N8RQ 2VLNA 3I55P 1OR5A 1L0HA 2GDWA 2PNGA 3G71P 2KWLA 2MVVA 2KG8A 2JU2A 1KC8Q 1DV5A 4XFYA 2LL8A 2EG5A 2QNWA 4NEOA 1YJNP 1VQ9P 1VQ7P 5KP7B 4U0BA 2PEMA 4R0MA 1IMPA 3P05A 2L9FA 1M74A 3EJEA 5KP8B 3LRYA 3OW2O 4CA3A 4XFZA 1M1KQ 1VQ4P 3HYBA 1CEIA 4XRQA 2JO0A 4H2WC 2KOQA 2PEQA 4M0IA 2L4BA 2N5HA 3GJNA 1EMVA 2M8LA 4BPGA 3DS3A 3G1IA 3G1GA 2KGCA 3HZQA 3CD6P 1A8OA 1GXHA 3CMAP 2AFEA 1M6NA 1E6JP 2JQ4A 3CE7A 1YHQP 1YIJP 2JGPA 2OTLP 4UHPB 2L6EA 1X3OA 4QNBA 1VQPP 3CC4P 4U0AA 4MRTC 2L22A 5F2KA 3G26A 3CC2P 1A43A 5HGOA 2QEXP 2EHTA 1UNKA 2L0QA 2MR7A 1QVGO 5HGMA 1Q82Q 1VQKP 2LMLA 2FACA 1K9MQ 1VQ5P 3DS1A 5BS1A 1KD1Q 3E2DA 2LTEA 2MY5A 2FVFA 2Z46A 1GPJA 3CCMP 3DS0A 4BPHA 2FVAA 2FHSC 5HGNA 1S72P 2MR8A 2PEKA 2K2QA 3DS4A 1NJIQ 1K8AQ 2N50A 3H0DA 1UJZA 2GDXA 2KODA 3G29A 2VLPA 2GYKA 4XFXA 3I56P 2XV6A 2K94A 2K93A 3MGEA 2K0XA 1K73Q 2KORA 3GKLC 1M90Q 2FVEA 1ZMBA 2VSQA 3CCEP 1RO0A 1KLPA 2M8NA 1AUMA 2CNRA 1L0IA 3CCUP 2N6ZA 1VQ6P 2FAEA 1NQ4A 1EIAA 3RG2A 2Z44A 5HVCA 5JPAA 2BHVA 2M8PA 3Q20A 2FQ2A 2GZEA 1JJ2O 2JBGA 4U0CA 2PEOA 2K0DX 1VQOP 3M1MA 2WPTA 1GXGA 3NY7B 1HQBA 4COPA 2DNWA 2KGAA 1BXIA 2FQ0A 1YITP 5HGLA 3GZLA 1VQLP 1HY8A 4XROA 2LPKA 2X2BA 1MZ8A 2LIUA 2XZ1C 2CG5B 3DTJA 2CQ8A 2VLQA 2JYLA 2AF8A 5I4TG 3G28A 2GZGA 1IUQA 1ZNVA 7CEIA 1DNYA 1QVFO 3CCRP 1KQSO 3CMEP 2KG6A 1D1DA 1YJ9P 3B4QA 1Q81Q 1BAJA 2KGEA 4DG9A 2XT1A 5EW5E 4BPFA 4PWVB 2EFJA 2BUOA 1Q7YQ 2K92A 4HKGA 2KGDA 3CPWO 3G4SP 2PEIA 3WBHA 2JAZA 1AF8A 2KG9A 2FQ1A 3DPHA 3CXCO 2EHSA 3EJDA 1VQMP 2DGYA 4GR2A 3H4EA 1Q86Q 5BS2A 2KOOA 2ERHA 3CC7P 3NTEA 4F37A 1VQNP 1FR2A 1EOQA 2MVUA 3VRLC 4PH1A 3RG6C 2OTJP 2KOPA 1F80D 3CCLP 2LIWA 2NO8A 2PENA 4H2YC 1IMQA 2N5IA 1RNIA 1Z6MA 2KW2A 5F2NA 1W2BO 3G0VA 3CCVP 4PXHB 2QA4P 5F2OA 3G6EP 3CCSP 2Z45A 4WYMA 2AFDA 3CCJP 2GZFA 2N98A 3EJBA 2ROQA 1QRJA 4IZ6A 4U0EA 2KOSA 1T8KA 2CGQA 5HV8A 5EJDA
chains in the Genus database with same CATH topology
2LF4A 3DS4A 1K8AQ 1NJIQ 3P05A 3DS2A 3H0DA 1M74A 2OARA 3DS5A 1D1DA 3CCQP 1YJ9P 4U0FA 1RO2A 1Q81Q 2CWOA 1BAJA 2KODA 3G29A 3LRYA 3OW2O 1M1KQ 4XFZA 4COCA 4XFXA 2XT1A 3I56P 1VQ4P 2XV6A 3HYBA 2XXMA 4XRQA 2JO0A 3MGEA 2PEQA 1K73Q 2EIAA 4M0IA 1M90Q 2EFJA 2BUOA 1Q7YQ 2P9XA 3G4SP 3CPWO 1VQ8P 2PEIA 2M8LA 3B5IA 3G21A 1ZMBA 4GR6A 1M6EX 5DCKA 3WBHA 3CCEP 1RO0A 3DS3A 2M8NA 3G1IA 3G1GA 3HZQA 3CD6P 1AUMA 3DPHA 1A8OA 3CXCO 1YJWP 2E1MA 4PH0A 3H47A 3CMAP 1VQMP 2DGYA 2ONTA 4GR2A 3CCUP 3H4EA 1M6NA 1Q86Q 1VQ6P 1E6JP 5BS2A 4IPYA 1YHQP 1EIAA 1YIJP 2OTLP 2L6EA 3CC7P 4QNBA 1VQPP 3NTEA 2Z44A 4U0AA 3CC4P 1VQNP 1EOQA 5JPAA 3VRLC 2BHVA 2JYGA 2M8PA 3G26A 4PH1A 4U0DA 5F2KA 1A43A 3RG6C 3CC2P 3CCLP 2OTJP 3Q20A 5HGOA 2QEXP 1JJ2O 2PENA 4U0CA 2PEOA 1QVGO 1K30A 1VQOP 3M1MA 2PEJA 5HGMA 1Q82Q 2PY8A 1RNIA 4COPA 1YI2P 1VQKP 1YITP 1N8RQ 5HGLA 5F2NA 1K9MQ 1VQ5P 3DS1A 3I55P 1VQLP 1W2BO 5BS1A 3G0VA 4XROA 3CCVP 1KD1Q 3E2DA 2QA4P 5F2OA 3G6EP 3G71P 3CCSP 2Z45A 4WYMA 3CCJP 3DTJA 1KC8Q 2Z46A 4XFYA 2EG5A 2JYLA 1QRJA 3CCMP 1YJNP 1VQ9P 1VQ7P 5I4TG 3CMEP 4U0EA 3DS0A 3G28A 1IUQA 4U0BA 2PEMA 1QVFO 5HGNA 1S72P 3CCRP 1KQSO 2PEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 2LF4 A;  3DS2 A;  2OAR A;  3DS5 A;  2GDY A;  3CCQ P;  4U0F A;  1RO2 A;  2CWO A;  1AYI A;  4COC A;  2N6Y A;  2XXM A;  2GZJ A;  2JU1 A;  2K5X A;  3U43 A;  2EIA A;  2FAD A;  1E0H A;  5KP6 B;  2P9X A;  1VQ8 P;  3GZM A;  1VKU A;  3B5I A;  3G21 A;  5CZD B;  2M5R A;  2JB0 A;  4GR6 A;  5DCK A;  1M6E X;  2KR5 A;  2MD9 A;  1YJW P;  2AVA A;  2E1M A;  3H47 A;  4PH0 A;  4QKO A;  2ONT A;  2MF4 A;  2XZ0 D;  4IPY A;  2VLO A;  2K0Y A;  2LKI A;  2JYG A;  2GZI A;  1VHN A;  4U0D A;  3LMO A;  2LOL A;  4H2X C;  1K30 A;  1ACP A;  2PEJ A;  2PY8 A;  1YI2 P;  1N8R Q;  2VLN A;  3I55 P;  1OR5 A;  1L0H A;  2GDW A;  2PNG A;  3G71 P;  2KWL A;  2MVV A;  2KG8 A;  2JU2 A;  1KC8 Q;  1DV5 A;  4XFY A;  2LL8 A;  2EG5 A;  2QNW A;  4NEO A;  1YJN P;  1VQ9 P;  1VQ7 P;  5KP7 B;  4U0B A;  2PEM A;  4R0M A;  1IMP A;  3P05 A;  2L9F A;  1M74 A;  3EJE A;  5KP8 B;  3LRY A;  3OW2 O;  4CA3 A;  4XFZ A;  1M1K Q;  1VQ4 P;  3HYB A;  1CEI A;  4XRQ A;  2JO0 A;  4H2W C;  2KOQ A;  2PEQ A;  4M0I A;  2L4B A;  2N5H A;  3GJN A;  1EMV A;  2M8L A;  4BPG A;  3DS3 A;  3G1I A;  3G1G A;  2KGC A;  3HZQ A;  3CD6 P;  1A8O A;  1GXH A;  3CMA P;  2AFE A;  1M6N A;  1E6J P;  2JQ4 A;  3CE7 A;  1YHQ P;  1YIJ P;  2JGP A;  2OTL P;  4UHP B;  2L6E A;  1X3O A;  4QNB A;  1VQP P;  3CC4 P;  4U0A A;  4MRT C;  2L22 A;  5F2K A;  3G26 A;  3CC2 P;  1A43 A;  5HGO A;  2QEX P;  2EHT A;  1UNK A;  2L0Q A;  2MR7 A;  1QVG O;  5HGM A;  1Q82 Q;  1VQK P;  2LML A;  2FAC A;  1K9M Q;  1VQ5 P;  3DS1 A;  5BS1 A;  1KD1 Q;  3E2D A;  2LTE A;  2MY5 A;  2FVF A;  2Z46 A;  1GPJ A;  3CCM P;  3DS0 A;  4BPH A;  2FVA A;  2FHS C;  5HGN A;  1S72 P;  2MR8 A;  2PEK A;  2K2Q A;  3DS4 A;  1NJI Q;  1K8A Q;  2N50 A;  3H0D A;  1UJZ A;  2GDX A;  2KOD A;  3G29 A;  2VLP A;  2GYK A;  4XFX A;  3I56 P;  2XV6 A;  2K94 A;  2K93 A;  3MGE A;  2K0X A;  1K73 Q;  2KOR A;  3GKL C;  1M90 Q;  2FVE A;  1ZMB A;  2VSQ A;  3CCE P;  1RO0 A;  1KLP A;  2M8N A;  1AUM A;  2CNR A;  1L0I A;  3CCU P;  2N6Z A;  1VQ6 P;  2FAE A;  1NQ4 A;  1EIA A;  3RG2 A;  2Z44 A;  5HVC A;  5JPA A;  2BHV A;  2M8P A;  3Q20 A;  2FQ2 A;  2GZE A;  1JJ2 O;  2JBG A;  4U0C A;  2PEO A;  2K0D X;  1VQO P;  3M1M A;  2WPT A;  1GXG A;  3NY7 B;  1HQB A;  4COP A;  2DNW A;  2KGA A;  1BXI A;  2FQ0 A;  1YIT P;  5HGL A;  3GZL A;  1VQL P;  1HY8 A;  4XRO A;  2LPK A;  2X2B A;  1MZ8 A;  2LIU A;  2XZ1 C;  2CG5 B;  3DTJ A;  2CQ8 A;  2VLQ A;  2JYL A;  2AF8 A;  5I4T G;  3G28 A;  2GZG A;  1IUQ A;  1ZNV A;  7CEI A;  1DNY A;  1QVF O;  3CCR P;  1KQS O;  3CME P;  2KG6 A;  1D1D A;  1YJ9 P;  3B4Q A;  1Q81 Q;  1BAJ A;  2KGE A;  4DG9 A;  2XT1 A;  5EW5 E;  4BPF A;  4PWV B;  2EFJ A;  2BUO A;  1Q7Y Q;  2K92 A;  4HKG A;  2KGD A;  3CPW O;  3G4S P;  2PEI A;  3WBH A;  2JAZ A;  1AF8 A;  2KG9 A;  2FQ1 A;  3DPH A;  3CXC O;  2EHS A;  3EJD A;  1VQM P;  2DGY A;  4GR2 A;  3H4E A;  1Q86 Q;  5BS2 A;  2KOO A;  2ERH A;  3CC7 P;  3NTE A;  4F37 A;  1VQN P;  1FR2 A;  1EOQ A;  2MVU A;  3VRL C;  4PH1 A;  3RG6 C;  2OTJ P;  2KOP A;  1F80 D;  3CCL P;  2LIW A;  2NO8 A;  2PEN A;  4H2Y C;  1IMQ A;  2N5I A;  1RNI A;  1Z6M A;  2KW2 A;  5F2N A;  1W2B O;  3G0V A;  3CCV P;  4PXH B;  2QA4 P;  5F2O A;  3G6E P;  3CCS P;  2Z45 A;  4WYM A;  2AFD A;  3CCJ P;  2GZF A;  2N98 A;  3EJB A;  2ROQ A;  1QRJ A;  4IZ6 A;  4U0E A;  2KOS A;  1T8K A;  2CGQ A;  5HV8 A;  5EJD A; 
#chains in the Genus database with same CATH homology
 2LF4 A;  3DS4 A;  1K8A Q;  1NJI Q;  3P05 A;  3DS2 A;  3H0D A;  1M74 A;  2OAR A;  3DS5 A;  1D1D A;  3CCQ P;  1YJ9 P;  4U0F A;  1RO2 A;  1Q81 Q;  2CWO A;  1BAJ A;  2KOD A;  3G29 A;  3LRY A;  3OW2 O;  1M1K Q;  4XFZ A;  4COC A;  4XFX A;  2XT1 A;  3I56 P;  1VQ4 P;  2XV6 A;  3HYB A;  2XXM A;  4XRQ A;  2JO0 A;  3MGE A;  2PEQ A;  1K73 Q;  2EIA A;  4M0I A;  1M90 Q;  2EFJ A;  2BUO A;  1Q7Y Q;  2P9X A;  3G4S P;  3CPW O;  1VQ8 P;  2PEI A;  2M8L A;  3B5I A;  3G21 A;  1ZMB A;  4GR6 A;  1M6E X;  5DCK A;  3WBH A;  3CCE P;  1RO0 A;  3DS3 A;  2M8N A;  3G1I A;  3G1G A;  3HZQ A;  3CD6 P;  1AUM A;  3DPH A;  1A8O A;  3CXC O;  1YJW P;  2E1M A;  4PH0 A;  3H47 A;  3CMA P;  1VQM P;  2DGY A;  2ONT A;  4GR2 A;  3CCU P;  3H4E A;  1M6N A;  1Q86 Q;  1VQ6 P;  1E6J P;  5BS2 A;  4IPY A;  1YHQ P;  1EIA A;  1YIJ P;  2OTL P;  2L6E A;  3CC7 P;  4QNB A;  1VQP P;  3NTE A;  2Z44 A;  4U0A A;  3CC4 P;  1VQN P;  1EOQ A;  5JPA A;  3VRL C;  2BHV A;  2JYG A;  2M8P A;  3G26 A;  4PH1 A;  4U0D A;  5F2K A;  1A43 A;  3RG6 C;  3CC2 P;  3CCL P;  2OTJ P;  3Q20 A;  5HGO A;  2QEX P;  1JJ2 O;  2PEN A;  4U0C A;  2PEO A;  1QVG O;  1K30 A;  1VQO P;  3M1M A;  2PEJ A;  5HGM A;  1Q82 Q;  2PY8 A;  1RNI A;  4COP A;  1YI2 P;  1VQK P;  1YIT P;  1N8R Q;  5HGL A;  5F2N A;  1K9M Q;  1VQ5 P;  3DS1 A;  3I55 P;  1VQL P;  1W2B O;  5BS1 A;  3G0V A;  4XRO A;  3CCV P;  1KD1 Q;  3E2D A;  2QA4 P;  5F2O A;  3G6E P;  3G71 P;  3CCS P;  2Z45 A;  4WYM A;  3CCJ P;  3DTJ A;  1KC8 Q;  2Z46 A;  4XFY A;  2EG5 A;  2JYL A;  1QRJ A;  3CCM P;  1YJN P;  1VQ9 P;  1VQ7 P;  5I4T G;  3CME P;  4U0E A;  3DS0 A;  3G28 A;  1IUQ A;  4U0B A;  2PEM A;  1QVF O;  5HGN A;  1S72 P;  3CCR P;  1KQS O;  2PEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...