2P9XA

Crystal structure of ph0832 from pyrococcus horikoshii ot3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
98
Chain Sequence
SKGRDILTKTIILALREVAPGLEAVLEAHLRATLNSGIELAYDDPQKFKEAVSKLFGEYSARLLEMVIISKLKGRLGEDIEANSLEELVSEIRKIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0832 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PH0832
total genus 37
structure length 98
sequence length 98
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11537 NitrOD5 Nitrosopumilus output domain 5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.200 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2p9xA00
2P9XA
chains in the Genus database with same CATH superfamily
2M8PA 1KC8Q 1HQBA 3CCQP 2KGEA 4H2YC 4BPFA 2DGYA 5KP8B 3DS0A 3NTEA 2KOPA 1A8OA 5HGOA 2Z45A 2XV6A 1D1DA 1YJ9P 3G1IA 2K5XA 1ZMBA 1KLPA 2GDYA 3LMOA 1HY8A 4HKGA 3DS2A 4R0MA 2N5HA 2EFJA 1YJNP 2KG6A 2E1MA 3B4QA 1GPJA 2GZGA 4XFYA 2LF4A 3DS4A 1YIJP 2CNRA 2FAEA 1UJZA 5HGNA 2CG5B 3LRYA 3I56P 2OTJP 1FR2A 1VQLP 2OTLP 2EHSA 4XFZA 1YI2P 2JBGA 2PEOA 4NEOA 1L0HA 1VQKP 1RO0A 1X3OA 1L0IA 7CEIA 2M8NA 2PEQA 2PEKA 3DPHA 2LKIA 2MR8A 3H47A 3G6EP 2PNGA 2FVEA 2FVFA 2PEJA 4H2WC 2Z46A 2FHSC 1DV5A 3G1GA 2AFEA 3U43A 4H2XC 2QA4P 3G28A 3CCMP 1K30A 1Q7YQ 2M5RA 2K0XA 2VLNA 2KG8A 4QNBA 2JYGA 1W2BO 2JQ4A 3GKLC 2LPKA 2VLOA 2VSQA 3CCLP 4GR6A 3CCUP 1BAJA 4U0BA 4CA3A 2LIWA 1M90Q 1YITP 4GR2A 2AVAA 2FACA 2BUOA 2GZJA 4U0FA 2ROQA 1OR5A 2KORA 4UHPB 2MF4A 5F2KA 2KR5A 1JJ2O 3CD6P 3H0DA 2KOQA 2KGCA 2L0QA 1AYIA 2QNWA 5KP7B 1K73Q 1M6NA 4PXHB 2LMLA 2JU2A 4XRQA 1VHNA 3CMEP 3G4SP 3G29A 2AFDA 5HGLA 3EJBA 4DG9A 3DS1A 2ONTA 2P9XA 3EJDA 5HV8A 5EW5E 1CEIA 2FVAA 4F37A 4BPGA 2CGQA 1ACPA 5I4TG 4QKOA 1VQ6P 2JO0A 3DS3A 3OW2O 3P05A 1KD1Q 2VLQA 1IUQA 2MD9A 2QEXP 2N5IA 3H4EA 2FQ1A 2GZEA 2KG9A 1EIAA 2KGDA 2N98A 1NQ4A 4IZ6A 3G26A 2KOOA 1VQNP 1T8KA 1VQ7P 2GYKA 3VRLC 1IMPA 1Z6MA 3E2DA 4COPA 2K0DX 1E0HA 5F2NA 2K94A 3CCSP 3G0VA 3HYBA 4PWVB 2JAZA 3DTJA 5KP6B 1VQOP 3G21A 3GZMA 3CCRP 2MY5A 2KGAA 4MRTC 1IMQA 2CQ8A 2N6YA 1F80D 1NJIQ 4U0CA 1QVFO 1AF8A 1S72P 1VQ5P 5DCKA 1K8AQ 4PH1A 4PH0A 3G71P 2PEMA 3WBHA 2L9FA 2WPTA 2KW2A 2KOSA 2LIUA 2GZFA 3RG6C 2EG5A 2EIAA 2L4BA 5HVCA 2PY8A 1BXIA 2L22A 1VQ4P 2GDXA 3GZLA 1M6EX 2JYLA 2K93A 2LOLA 2VLPA 3B5IA 4U0DA 2DNWA 1VKUA 2FQ0A 2JU1A 3CCJP 1N8RQ 4U0EA 1Q81Q 5EJDA 4XROA 1KQSO 5BS1A 3HZQA 3CCEP 1ZNVA 4BPHA 2NO8A 1UNKA 2M8LA 5CZDB 1RNIA 1VQ8P 3I55P 5HGMA 2XZ1C 1Q82Q 1M74A 4WYMA 2Z44A 1EMVA 3CC7P 2L6EA 4M0IA 2LTEA 3RG2A 2MR7A 2EHTA 1VQ9P 2FQ2A 1GXHA 1QRJA 2PENA 4U0AA 2OARA 4XFXA 1AUMA 1K9MQ 2K0YA 5BS2A 2K92A 5F2OA 3Q20A 3GJNA 1M1KQ 2JB0A 1VQMP 1GXGA 3CPWO 1EOQA 4COCA 1A43A 4IPYA 2ERHA 2GZIA 2PEIA 1QVGO 1MZ8A 3NY7B 3DS5A 2KWLA 2MVVA 1E6JP 3CXCO 2BHVA 5JPAA 2FADA 2N50A 1RO2A 2AF8A 3CC2P 1YJWP 3CE7A 2JGPA 2CWOA 2KODA 2K2QA 1DNYA 2N6ZA 2MVUA 2XZ0D 2X2BA 2LL8A 1Q86Q 3CMAP 3CC4P 2XXMA 1YHQP 1VQPP 3EJEA 2GDWA 2XT1A 3CCVP 3M1MA 3MGEA
chains in the Genus database with same CATH topology
2M8PA 3E2DA 1KC8Q 4COPA 1Q82Q 3CCQP 1M74A 2JYGA 4QNBA 4WYMA 1W2BO 2Z44A 2DGYA 5F2NA 3DS0A 2L6EA 3CC7P 3NTEA 3CCSP 3G0VA 3HYBA 1A8OA 5HGOA 2Z45A 4M0IA 2XV6A 3CCLP 3DTJA 1D1DA 1YJ9P 1VQOP 3G1IA 3G21A 4GR6A 1VQ9P 1QRJA 2PENA 3CCRP 1ZMBA 2OARA 4U0AA 4XFXA 3CCUP 1AUMA 1BAJA 4U0BA 1K9MQ 5BS2A 5F2OA 1M90Q 1NJIQ 3Q20A 4GR2A 4U0CA 1YITP 1QVFO 2BUOA 1S72P 1VQMP 3DS2A 1M1KQ 2EFJA 1YJNP 3CPWO 1VQ5P 1EOQA 5DCKA 2E1MA 4COCA 1A43A 4U0FA 1K8AQ 4PH1A 4IPYA 5F2KA 4XFYA 4PH0A 3G71P 2PEMA 2LF4A 3WBHA 3DS4A 1YIJP 2PEIA 1QVGO 1JJ2O 3RG6C 3CD6P 3H0DA 5HGNA 2EG5A 3DS5A 2EIAA 3LRYA 3I56P 2OTJP 1E6JP 3CXCO 1VQLP 2OTLP 4XFZA 2PY8A 1K73Q 1YI2P 1M6NA 2PEOA 1VQ4P 2BHVA 4XRQA 3CMEP 3G4SP 5JPAA 3G29A 1RO2A 5HGLA 1M6EX 3CC2P 1VQKP 1YJWP 1RO0A 2JYLA 3DS1A 2ONTA 2CWOA 2P9XA 2KODA 2M8NA 2PEQA 2PEKA 3DPHA 1Q86Q 3H47A 3B5IA 3CMAP 3CC4P 3I55P 2XXMA 3G6EP 1YHQP 1VQPP 5I4TG 2PEJA 4U0DA 2Z46A 1VQ6P 2JO0A 3DS3A 3OW2O 3CCJP 3P05A 1N8RQ 3G1GA 1KD1Q 4U0EA 1IUQA 1Q81Q 2QEXP 3H4EA 4XROA 1KQSO 5BS1A 3HZQA 2XT1A 1EIAA 3CCEP 3CCVP 2QA4P 3M1MA 3G28A 3CCMP 1K30A 3G26A 1Q7YQ 1VQNP 2M8LA 1VQ7P 3MGEA 1RNIA 1VQ8P 3VRLC 5HGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9X A; 
#chains in the Genus database with same CATH topology
 2M8P A;  1KC8 Q;  1HQB A;  3CCQ P;  2KGE A;  4H2Y C;  4BPF A;  2DGY A;  5KP8 B;  3DS0 A;  3NTE A;  2KOP A;  1A8O A;  5HGO A;  2Z45 A;  2XV6 A;  1D1D A;  1YJ9 P;  3G1I A;  2K5X A;  1ZMB A;  1KLP A;  2GDY A;  3LMO A;  1HY8 A;  4HKG A;  3DS2 A;  4R0M A;  2N5H A;  2EFJ A;  1YJN P;  2KG6 A;  2E1M A;  3B4Q A;  1GPJ A;  2GZG A;  4XFY A;  2LF4 A;  3DS4 A;  1YIJ P;  2CNR A;  2FAE A;  1UJZ A;  5HGN A;  2CG5 B;  3LRY A;  3I56 P;  2OTJ P;  1FR2 A;  1VQL P;  2OTL P;  2EHS A;  4XFZ A;  1YI2 P;  2JBG A;  2PEO A;  4NEO A;  1L0H A;  1VQK P;  1RO0 A;  1X3O A;  1L0I A;  7CEI A;  2M8N A;  2PEQ A;  2PEK A;  3DPH A;  2LKI A;  2MR8 A;  3H47 A;  3G6E P;  2PNG A;  2FVE A;  2FVF A;  2PEJ A;  4H2W C;  2Z46 A;  2FHS C;  1DV5 A;  3G1G A;  2AFE A;  3U43 A;  4H2X C;  2QA4 P;  3G28 A;  3CCM P;  1K30 A;  1Q7Y Q;  2M5R A;  2K0X A;  2VLN A;  2KG8 A;  4QNB A;  2JYG A;  1W2B O;  2JQ4 A;  3GKL C;  2LPK A;  2VLO A;  2VSQ A;  3CCL P;  4GR6 A;  3CCU P;  1BAJ A;  4U0B A;  4CA3 A;  2LIW A;  1M90 Q;  1YIT P;  4GR2 A;  2AVA A;  2FAC A;  2BUO A;  2GZJ A;  4U0F A;  2ROQ A;  1OR5 A;  2KOR A;  4UHP B;  2MF4 A;  5F2K A;  2KR5 A;  1JJ2 O;  3CD6 P;  3H0D A;  2KOQ A;  2KGC A;  2L0Q A;  1AYI A;  2QNW A;  5KP7 B;  1K73 Q;  1M6N A;  4PXH B;  2LML A;  2JU2 A;  4XRQ A;  1VHN A;  3CME P;  3G4S P;  3G29 A;  2AFD A;  5HGL A;  3EJB A;  4DG9 A;  3DS1 A;  2ONT A;  2P9X A;  3EJD A;  5HV8 A;  5EW5 E;  1CEI A;  2FVA A;  4F37 A;  4BPG A;  2CGQ A;  1ACP A;  5I4T G;  4QKO A;  1VQ6 P;  2JO0 A;  3DS3 A;  3OW2 O;  3P05 A;  1KD1 Q;  2VLQ A;  1IUQ A;  2MD9 A;  2QEX P;  2N5I A;  3H4E A;  2FQ1 A;  2GZE A;  2KG9 A;  1EIA A;  2KGD A;  2N98 A;  1NQ4 A;  4IZ6 A;  3G26 A;  2KOO A;  1VQN P;  1T8K A;  1VQ7 P;  2GYK A;  3VRL C;  1IMP A;  1Z6M A;  3E2D A;  4COP A;  2K0D X;  1E0H A;  5F2N A;  2K94 A;  3CCS P;  3G0V A;  3HYB A;  4PWV B;  2JAZ A;  3DTJ A;  5KP6 B;  1VQO P;  3G21 A;  3GZM A;  3CCR P;  2MY5 A;  2KGA A;  4MRT C;  1IMQ A;  2CQ8 A;  2N6Y A;  1F80 D;  1NJI Q;  4U0C A;  1QVF O;  1AF8 A;  1S72 P;  1VQ5 P;  5DCK A;  1K8A Q;  4PH1 A;  4PH0 A;  3G71 P;  2PEM A;  3WBH A;  2L9F A;  2WPT A;  2KW2 A;  2KOS A;  2LIU A;  2GZF A;  3RG6 C;  2EG5 A;  2EIA A;  2L4B A;  5HVC A;  2PY8 A;  1BXI A;  2L22 A;  1VQ4 P;  2GDX A;  3GZL A;  1M6E X;  2JYL A;  2K93 A;  2LOL A;  2VLP A;  3B5I A;  4U0D A;  2DNW A;  1VKU A;  2FQ0 A;  2JU1 A;  3CCJ P;  1N8R Q;  4U0E A;  1Q81 Q;  5EJD A;  4XRO A;  1KQS O;  5BS1 A;  3HZQ A;  3CCE P;  1ZNV A;  4BPH A;  2NO8 A;  1UNK A;  2M8L A;  5CZD B;  1RNI A;  1VQ8 P;  3I55 P;  5HGM A;  2XZ1 C;  1Q82 Q;  1M74 A;  4WYM A;  2Z44 A;  1EMV A;  3CC7 P;  2L6E A;  4M0I A;  2LTE A;  3RG2 A;  2MR7 A;  2EHT A;  1VQ9 P;  2FQ2 A;  1GXH A;  1QRJ A;  2PEN A;  4U0A A;  2OAR A;  4XFX A;  1AUM A;  1K9M Q;  2K0Y A;  5BS2 A;  2K92 A;  5F2O A;  3Q20 A;  3GJN A;  1M1K Q;  2JB0 A;  1VQM P;  1GXG A;  3CPW O;  1EOQ A;  4COC A;  1A43 A;  4IPY A;  2ERH A;  2GZI A;  2PEI A;  1QVG O;  1MZ8 A;  3NY7 B;  3DS5 A;  2KWL A;  2MVV A;  1E6J P;  3CXC O;  2BHV A;  5JPA A;  2FAD A;  2N50 A;  1RO2 A;  2AF8 A;  3CC2 P;  1YJW P;  3CE7 A;  2JGP A;  2CWO A;  2KOD A;  2K2Q A;  1DNY A;  2N6Z A;  2MVU A;  2XZ0 D;  2X2B A;  2LL8 A;  1Q86 Q;  3CMA P;  3CC4 P;  2XXM A;  1YHQ P;  1VQP P;  3EJE A;  2GDW A;  2XT1 A;  3CCV P;  3M1M A;  3MGE A; 
#chains in the Genus database with same CATH homology
 2M8P A;  3E2D A;  1KC8 Q;  4COP A;  1Q82 Q;  3CCQ P;  1M74 A;  2JYG A;  4QNB A;  4WYM A;  1W2B O;  2Z44 A;  2DGY A;  5F2N A;  3DS0 A;  2L6E A;  3CC7 P;  3NTE A;  3CCS P;  3G0V A;  3HYB A;  1A8O A;  5HGO A;  2Z45 A;  4M0I A;  2XV6 A;  3CCL P;  3DTJ A;  1D1D A;  1YJ9 P;  1VQO P;  3G1I A;  3G21 A;  4GR6 A;  1VQ9 P;  1QRJ A;  2PEN A;  3CCR P;  1ZMB A;  2OAR A;  4U0A A;  4XFX A;  3CCU P;  1AUM A;  1BAJ A;  4U0B A;  1K9M Q;  5BS2 A;  5F2O A;  1M90 Q;  1NJI Q;  3Q20 A;  4GR2 A;  4U0C A;  1YIT P;  1QVF O;  2BUO A;  1S72 P;  1VQM P;  3DS2 A;  1M1K Q;  2EFJ A;  1YJN P;  3CPW O;  1VQ5 P;  1EOQ A;  5DCK A;  2E1M A;  4COC A;  1A43 A;  4U0F A;  1K8A Q;  4PH1 A;  4IPY A;  5F2K A;  4XFY A;  4PH0 A;  3G71 P;  2PEM A;  2LF4 A;  3WBH A;  3DS4 A;  1YIJ P;  2PEI A;  1QVG O;  1JJ2 O;  3RG6 C;  3CD6 P;  3H0D A;  5HGN A;  2EG5 A;  3DS5 A;  2EIA A;  3LRY A;  3I56 P;  2OTJ P;  1E6J P;  3CXC O;  1VQL P;  2OTL P;  4XFZ A;  2PY8 A;  1K73 Q;  1YI2 P;  1M6N A;  2PEO A;  1VQ4 P;  2BHV A;  4XRQ A;  3CME P;  3G4S P;  5JPA A;  3G29 A;  1RO2 A;  5HGL A;  1M6E X;  3CC2 P;  1VQK P;  1YJW P;  1RO0 A;  2JYL A;  3DS1 A;  2ONT A;  2CWO A;  2P9X A;  2KOD A;  2M8N A;  2PEQ A;  2PEK A;  3DPH A;  1Q86 Q;  3H47 A;  3B5I A;  3CMA P;  3CC4 P;  3I55 P;  2XXM A;  3G6E P;  1YHQ P;  1VQP P;  5I4T G;  2PEJ A;  4U0D A;  2Z46 A;  1VQ6 P;  2JO0 A;  3DS3 A;  3OW2 O;  3CCJ P;  3P05 A;  1N8R Q;  3G1G A;  1KD1 Q;  4U0E A;  1IUQ A;  1Q81 Q;  2QEX P;  3H4E A;  4XRO A;  1KQS O;  5BS1 A;  3HZQ A;  2XT1 A;  1EIA A;  3CCE P;  3CCV P;  2QA4 P;  3M1M A;  3G28 A;  3CCM P;  1K30 A;  3G26 A;  1Q7Y Q;  1VQN P;  2M8L A;  1VQ7 P;  3MGE A;  1RNI A;  1VQ8 P;  3VRL C;  5HGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...