1DV5A

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transport protein
molecule keywords APO-D-ALANYL CARRIER PROTEIN
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dv5A00
3EJDA 1NQ4A 2JQ4A 2KG6A 2K2QA 2MF4A 2M5RA 2FQ0A 4NEOA 2LMLA 2LTEA 2FQ1A 3LMOA 2KOPA 4CA3A 4H2XC 2KORA 2AF8A 2KG8A 2FHSC 2LPKA 2MVVA 2N6ZA 4MRTC 2AVAA 2QNWA 4BPHA 2KGDA 2N5HA 5HVCA 2L22A 2FVEA 2AFDA 2CNRA 2K93A 2KGCA 4BPGA 2CGQA 2VSQA 1OR5A 5EJDA 2L0QA 2N5IA 2KG9A 4R0MA 2LOLA 2XZ1C 4H2WC 3GZMA 2KOQA 2L9FA 2KGEA 4DG9A 5KP7B 2GDWA 1T8KA 1KLPA 1X3OA 2FADA 1DNYA 2MY5A 4BPFA 2LIWA 2KWLA 5HV8A 1L0IA 2CQ8A 2K92A 2KOOA 2FQ2A 2FACA 2L4BA 2GDXA 3EJBA 2JGPA 2PNGA 2KR5A 3EJEA 4PWVB 2ROQA 3NY7B 2X2BA 1HY8A 2XZ0D 2K0YA 2KGAA 2LIUA 2FAEA 1DV5A 2K94A 2CG5B 4H2YC 2JU2A 5KP6B 2LL8A 1VKUA 2GDYA 2AFEA 2K0XA 3GZLA 2MR7A 2JU1A 2FVFA 5KP8B 2FVAA 2N50A 5CZDB 1HQBA 2MVUA 2N98A 4HKGA 3RG2A 1AF8A 1F80D 4PXHB 2LKIA 2EHSA 1L0HA 2MR8A 2N6YA 3CE7A 2MD9A 2DNWA 2KOSA 2KW2A 1ACPA 4IZ6A 2EHTA
chains in the Genus database with same CATH superfamily
1Q7YQ 1NQ4A 3CC2P 1YJNP 3DS5A 5I4TG 1A43A 2PEQA 3G1IA 2LTEA 3CCVP 3G4SP 3CPWO 2KOPA 3H47A 4QKOA 4H2XC 2FHSC 2PEIA 2N6ZA 4BPHA 2KGDA 3MGEA 5HVCA 1Q86Q 3DS1A 3LRYA 1KQSO 2FVEA 2CNRA 1K30A 4U0EA 2CGQA 5HGMA 1KD1Q 3WBHA 4R0MA 2XZ1C 4H2WC 1D1DA 2XV6A 3G28A 2L9FA 1E6JP 1GXHA 1M6NA 5KP7B 3M1MA 5F2NA 4COPA 2PENA 1T8KA 5HGOA 2FADA 1X3OA 2GZEA 2GYKA 2BUOA 5HGNA 1Q82Q 4BPFA 2K0DX 2LIWA 5HV8A 4U0CA 3CC4P 2KOOA 2VLNA 2L6EA 2GZJA 1K8AQ 2PNGA 3EJEA 4PWVB 4PH0A 4M0IA 1VQ8P 2XZ0D 2KGAA 2LIUA 4H2YC 5KP6B 2AFEA 2ERHA 2MR7A 4U0AA 2FVAA 2N50A 2N98A 3I56P 1F80D 1S72P 2WPTA 2JBGA 2N6YA 1VQLP 2KOSA 1UJZA 3CCRP 1EMVA 2KW2A 1ACPA 1VQ6P 2KODA 2EHTA 3P05A 1N8RQ 3NTEA 2K2QA 2K5XA 2LF4A 2XT1A 4U0BA 2M8LA 2FQ1A 1GPJA 1IMPA 3DS3A 3LMOA 1CEIA 2KORA 5EW5E 2LPKA 2DGYA 2AVAA 2QNWA 2N5HA 1YJWP 3GKLC 2AFDA 3CD6P 3CCMP 2Z46A 2L0QA 2N5IA 3G1GA 3HYBA 3GZMA 2EFJA 2KOQA 1VQ4P 2KGEA 2VLPA 1VQMP 2CWOA 3DS2A 3OW2O 3G0VA 1KLPA 1E0HA 1FR2A 2MY5A 2FQ2A 3G71P 1IMQA 2GDXA 3EJBA 2QA4P 5BS1A 4U0FA 1M6EX 2X2BA 1HY8A 1VQNP 2JAZA 2Z44A 1M74A 1GXGA 1AYIA 3B5IA 1VKUA 2GDYA 1EIAA 1NJIQ 5KP8B 1BAJA 1AF8A 4PXHB 2Z45A 2MR8A 1VQOP 1KC8Q 3EJDA 2JQ4A 2KG6A 4XRQA 3DPHA 2MF4A 2M5RA 2LMLA 1JJ2O 2M8PA 4CA3A 4COCA 1VQKP 2MVVA 2PEOA 2GZIA 2L22A 2KGCA 3CC7P 1YIJP 3VRLC 3H4EA 1IUQA 1VQ7P 1MZ8A 1BXIA 3CCUP 1M1KQ 4DG9A 1QVGO 4XFXA 1VHNA 3G29A 2EIAA 2JO0A 2XXMA 3HZQA 4QNBA 2VLOA 1W2BO 1RNIA 1M90Q 2FACA 5JPAA 1VQ5P 2JGPA 2KR5A 1RO0A 2OARA 5F2OA 1ZMBA 2K0YA 3B4QA 4GR6A 1YITP 2FAEA 1DV5A 2K94A 3DS4A 2CG5B 2JU2A 1EOQA 3I55P 2LL8A 3DS0A 4XROA 4IPYA 2K0XA 1YI2P 5DCKA 2JU1A 1VQ9P 4GR2A 3CCLP 4HKGA 3RG2A 2EHSA 3CE7A 4XFZA 3RG6C 3CMAP 2MD9A 2OTLP 4IZ6A 3H0DA 2P9XA 3CMEP 3G26A 1QRJA 1QVFO 2FQ0A 4UHPB 4NEOA 1RO2A 1VQPP 2PEKA 2AF8A 2KG8A 2ONTA 4F37A 4MRTC 3CCJP 2JB0A 5F2KA 1AUMA 2M8NA 5HGLA 3Q20A 1UNKA 2K93A 1Z6MA 4BPGA 2VSQA 1OR5A 7CEIA 5EJDA 2KG9A 2LOLA 4U0DA 2JYLA 2QEXP 2EG5A 3G21A 4XFYA 2E1MA 2PEMA 4WYMA 3CCSP 2JYGA 2OTJP 2GDWA 1A8OA 1DNYA 2GZFA 1ZNVA 2KWLA 1L0IA 2CQ8A 2K92A 3CCQP 2L4BA 2ROQA 3NY7B 3E2DA 4PH1A 3U43A 3G6EP 3GJNA 2BHVA 2NO8A 2GZGA 3GZLA 1K9MQ 5BS2A 2FVFA 2VLQA 5CZDB 1YHQP 3DTJA 1HQBA 2MVUA 1K73Q 2LKIA 1L0HA 1YJ9P 2PEJA 2PY8A 3CXCO 2DNWA 1Q81Q 3CCEP
chains in the Genus database with same CATH topology
3EJDA 1NQ4A 2JQ4A 2KG6A 2K2QA 2MF4A 2M5RA 2FQ0A 4NEOA 2LMLA 2LTEA 2FQ1A 3LMOA 2KOPA 4CA3A 4H2XC 2KORA 2AF8A 2KG8A 2FHSC 2LPKA 2MVVA 2N6ZA 4MRTC 2AVAA 2QNWA 4BPHA 2KGDA 2N5HA 5HVCA 2L22A 2FVEA 2AFDA 2CNRA 2K93A 2KGCA 4BPGA 2CGQA 2VSQA 1OR5A 5EJDA 2L0QA 2N5IA 2KG9A 4R0MA 2LOLA 2XZ1C 4H2WC 3GZMA 2KOQA 2L9FA 2KGEA 4DG9A 5KP7B 2GDWA 1T8KA 1KLPA 1X3OA 2FADA 1DNYA 2MY5A 4BPFA 2LIWA 2KWLA 5HV8A 1L0IA 2CQ8A 2K92A 2KOOA 2FQ2A 2FACA 2L4BA 2GDXA 3EJBA 2JGPA 2PNGA 2KR5A 3EJEA 4PWVB 2ROQA 3NY7B 2X2BA 1HY8A 2XZ0D 2K0YA 2KGAA 2LIUA 2FAEA 1DV5A 2K94A 2CG5B 4H2YC 2JU2A 5KP6B 2LL8A 1VKUA 2GDYA 2AFEA 2K0XA 3GZLA 2MR7A 2JU1A 2FVFA 5KP8B 2FVAA 2N50A 5CZDB 1HQBA 2MVUA 2N98A 4HKGA 3RG2A 1AF8A 1F80D 4PXHB 2LKIA 2EHSA 1L0HA 2MR8A 2N6YA 3CE7A 2MD9A 2DNWA 2KOSA 2KW2A 1ACPA 4IZ6A 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJD A;  1NQ4 A;  2JQ4 A;  2KG6 A;  2K2Q A;  2MF4 A;  2M5R A;  2FQ0 A;  4NEO A;  2LML A;  2LTE A;  2FQ1 A;  3LMO A;  2KOP A;  4CA3 A;  4H2X C;  2KOR A;  2AF8 A;  2KG8 A;  2FHS C;  2LPK A;  2MVV A;  2N6Z A;  4MRT C;  2AVA A;  2QNW A;  4BPH A;  2KGD A;  2N5H A;  5HVC A;  2L22 A;  2FVE A;  2AFD A;  2CNR A;  2K93 A;  2KGC A;  4BPG A;  2CGQ A;  2VSQ A;  1OR5 A;  5EJD A;  2L0Q A;  2N5I A;  2KG9 A;  4R0M A;  2LOL A;  2XZ1 C;  4H2W C;  3GZM A;  2KOQ A;  2L9F A;  2KGE A;  4DG9 A;  5KP7 B;  2GDW A;  1T8K A;  1KLP A;  1X3O A;  2FAD A;  1DNY A;  2MY5 A;  4BPF A;  2LIW A;  2KWL A;  5HV8 A;  1L0I A;  2CQ8 A;  2K92 A;  2KOO A;  2FQ2 A;  2FAC A;  2L4B A;  2GDX A;  3EJB A;  2JGP A;  2PNG A;  2KR5 A;  3EJE A;  4PWV B;  2ROQ A;  3NY7 B;  2X2B A;  1HY8 A;  2XZ0 D;  2K0Y A;  2KGA A;  2LIU A;  2FAE A;  1DV5 A;  2K94 A;  2CG5 B;  4H2Y C;  2JU2 A;  5KP6 B;  2LL8 A;  1VKU A;  2GDY A;  2AFE A;  2K0X A;  3GZL A;  2MR7 A;  2JU1 A;  2FVF A;  5KP8 B;  2FVA A;  2N50 A;  5CZD B;  1HQB A;  2MVU A;  2N98 A;  4HKG A;  3RG2 A;  1AF8 A;  1F80 D;  4PXH B;  2LKI A;  2EHS A;  1L0H A;  2MR8 A;  2N6Y A;  3CE7 A;  2MD9 A;  2DNW A;  2KOS A;  2KW2 A;  1ACP A;  4IZ6 A;  2EHT A; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  1NQ4 A;  3CC2 P;  1YJN P;  3DS5 A;  5I4T G;  1A43 A;  2PEQ A;  3G1I A;  2LTE A;  3CCV P;  3G4S P;  3CPW O;  2KOP A;  3H47 A;  4QKO A;  4H2X C;  2FHS C;  2PEI A;  2N6Z A;  4BPH A;  2KGD A;  3MGE A;  5HVC A;  1Q86 Q;  3DS1 A;  3LRY A;  1KQS O;  2FVE A;  2CNR A;  1K30 A;  4U0E A;  2CGQ A;  5HGM A;  1KD1 Q;  3WBH A;  4R0M A;  2XZ1 C;  4H2W C;  1D1D A;  2XV6 A;  3G28 A;  2L9F A;  1E6J P;  1GXH A;  1M6N A;  5KP7 B;  3M1M A;  5F2N A;  4COP A;  2PEN A;  1T8K A;  5HGO A;  2FAD A;  1X3O A;  2GZE A;  2GYK A;  2BUO A;  5HGN A;  1Q82 Q;  4BPF A;  2K0D X;  2LIW A;  5HV8 A;  4U0C A;  3CC4 P;  2KOO A;  2VLN A;  2L6E A;  2GZJ A;  1K8A Q;  2PNG A;  3EJE A;  4PWV B;  4PH0 A;  4M0I A;  1VQ8 P;  2XZ0 D;  2KGA A;  2LIU A;  4H2Y C;  5KP6 B;  2AFE A;  2ERH A;  2MR7 A;  4U0A A;  2FVA A;  2N50 A;  2N98 A;  3I56 P;  1F80 D;  1S72 P;  2WPT A;  2JBG A;  2N6Y A;  1VQL P;  2KOS A;  1UJZ A;  3CCR P;  1EMV A;  2KW2 A;  1ACP A;  1VQ6 P;  2KOD A;  2EHT A;  3P05 A;  1N8R Q;  3NTE A;  2K2Q A;  2K5X A;  2LF4 A;  2XT1 A;  4U0B A;  2M8L A;  2FQ1 A;  1GPJ A;  1IMP A;  3DS3 A;  3LMO A;  1CEI A;  2KOR A;  5EW5 E;  2LPK A;  2DGY A;  2AVA A;  2QNW A;  2N5H A;  1YJW P;  3GKL C;  2AFD A;  3CD6 P;  3CCM P;  2Z46 A;  2L0Q A;  2N5I A;  3G1G A;  3HYB A;  3GZM A;  2EFJ A;  2KOQ A;  1VQ4 P;  2KGE A;  2VLP A;  1VQM P;  2CWO A;  3DS2 A;  3OW2 O;  3G0V A;  1KLP A;  1E0H A;  1FR2 A;  2MY5 A;  2FQ2 A;  3G71 P;  1IMQ A;  2GDX A;  3EJB A;  2QA4 P;  5BS1 A;  4U0F A;  1M6E X;  2X2B A;  1HY8 A;  1VQN P;  2JAZ A;  2Z44 A;  1M74 A;  1GXG A;  1AYI A;  3B5I A;  1VKU A;  2GDY A;  1EIA A;  1NJI Q;  5KP8 B;  1BAJ A;  1AF8 A;  4PXH B;  2Z45 A;  2MR8 A;  1VQO P;  1KC8 Q;  3EJD A;  2JQ4 A;  2KG6 A;  4XRQ A;  3DPH A;  2MF4 A;  2M5R A;  2LML A;  1JJ2 O;  2M8P A;  4CA3 A;  4COC A;  1VQK P;  2MVV A;  2PEO A;  2GZI A;  2L22 A;  2KGC A;  3CC7 P;  1YIJ P;  3VRL C;  3H4E A;  1IUQ A;  1VQ7 P;  1MZ8 A;  1BXI A;  3CCU P;  1M1K Q;  4DG9 A;  1QVG O;  4XFX A;  1VHN A;  3G29 A;  2EIA A;  2JO0 A;  2XXM A;  3HZQ A;  4QNB A;  2VLO A;  1W2B O;  1RNI A;  1M90 Q;  2FAC A;  5JPA A;  1VQ5 P;  2JGP A;  2KR5 A;  1RO0 A;  2OAR A;  5F2O A;  1ZMB A;  2K0Y A;  3B4Q A;  4GR6 A;  1YIT P;  2FAE A;  1DV5 A;  2K94 A;  3DS4 A;  2CG5 B;  2JU2 A;  1EOQ A;  3I55 P;  2LL8 A;  3DS0 A;  4XRO A;  4IPY A;  2K0X A;  1YI2 P;  5DCK A;  2JU1 A;  1VQ9 P;  4GR2 A;  3CCL P;  4HKG A;  3RG2 A;  2EHS A;  3CE7 A;  4XFZ A;  3RG6 C;  3CMA P;  2MD9 A;  2OTL P;  4IZ6 A;  3H0D A;  2P9X A;  3CME P;  3G26 A;  1QRJ A;  1QVF O;  2FQ0 A;  4UHP B;  4NEO A;  1RO2 A;  1VQP P;  2PEK A;  2AF8 A;  2KG8 A;  2ONT A;  4F37 A;  4MRT C;  3CCJ P;  2JB0 A;  5F2K A;  1AUM A;  2M8N A;  5HGL A;  3Q20 A;  1UNK A;  2K93 A;  1Z6M A;  4BPG A;  2VSQ A;  1OR5 A;  7CEI A;  5EJD A;  2KG9 A;  2LOL A;  4U0D A;  2JYL A;  2QEX P;  2EG5 A;  3G21 A;  4XFY A;  2E1M A;  2PEM A;  4WYM A;  3CCS P;  2JYG A;  2OTJ P;  2GDW A;  1A8O A;  1DNY A;  2GZF A;  1ZNV A;  2KWL A;  1L0I A;  2CQ8 A;  2K92 A;  3CCQ P;  2L4B A;  2ROQ A;  3NY7 B;  3E2D A;  4PH1 A;  3U43 A;  3G6E P;  3GJN A;  2BHV A;  2NO8 A;  2GZG A;  3GZL A;  1K9M Q;  5BS2 A;  2FVF A;  2VLQ A;  5CZD B;  1YHQ P;  3DTJ A;  1HQB A;  2MVU A;  1K73 Q;  2LKI A;  1L0H A;  1YJ9 P;  2PEJ A;  2PY8 A;  3CXC O;  2DNW A;  1Q81 Q;  3CCE P; 
#chains in the Genus database with same CATH homology
 3EJD A;  1NQ4 A;  2JQ4 A;  2KG6 A;  2K2Q A;  2MF4 A;  2M5R A;  2FQ0 A;  4NEO A;  2LML A;  2LTE A;  2FQ1 A;  3LMO A;  2KOP A;  4CA3 A;  4H2X C;  2KOR A;  2AF8 A;  2KG8 A;  2FHS C;  2LPK A;  2MVV A;  2N6Z A;  4MRT C;  2AVA A;  2QNW A;  4BPH A;  2KGD A;  2N5H A;  5HVC A;  2L22 A;  2FVE A;  2AFD A;  2CNR A;  2K93 A;  2KGC A;  4BPG A;  2CGQ A;  2VSQ A;  1OR5 A;  5EJD A;  2L0Q A;  2N5I A;  2KG9 A;  4R0M A;  2LOL A;  2XZ1 C;  4H2W C;  3GZM A;  2KOQ A;  2L9F A;  2KGE A;  4DG9 A;  5KP7 B;  2GDW A;  1T8K A;  1KLP A;  1X3O A;  2FAD A;  1DNY A;  2MY5 A;  4BPF A;  2LIW A;  2KWL A;  5HV8 A;  1L0I A;  2CQ8 A;  2K92 A;  2KOO A;  2FQ2 A;  2FAC A;  2L4B A;  2GDX A;  3EJB A;  2JGP A;  2PNG A;  2KR5 A;  3EJE A;  4PWV B;  2ROQ A;  3NY7 B;  2X2B A;  1HY8 A;  2XZ0 D;  2K0Y A;  2KGA A;  2LIU A;  2FAE A;  1DV5 A;  2K94 A;  2CG5 B;  4H2Y C;  2JU2 A;  5KP6 B;  2LL8 A;  1VKU A;  2GDY A;  2AFE A;  2K0X A;  3GZL A;  2MR7 A;  2JU1 A;  2FVF A;  5KP8 B;  2FVA A;  2N50 A;  5CZD B;  1HQB A;  2MVU A;  2N98 A;  4HKG A;  3RG2 A;  1AF8 A;  1F80 D;  4PXH B;  2LKI A;  2EHS A;  1L0H A;  2MR8 A;  2N6Y A;  3CE7 A;  2MD9 A;  2DNW A;  2KOS A;  2KW2 A;  1ACP A;  4IZ6 A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...