1DV5A

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-D-ALANYL CARRIER PROTEIN
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transport protein
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dv5A00
2CNRA 4NEOA 4PWVB 2JQ4A 2FHSC 1T8KA 2MD9A 2CG5B 2KGEA 2LL8A 1NQ4A 2KG8A 1X3OA 4MRTC 2FVFA 2MF4A 2GDYA 4R0MA 3EJEA 1VKUA 3EJBA 3LMOA 2XZ0D 2N6ZA 3EJDA 2KOPA 2KGDA 5KP7B 2FADA 4H2XC 5HV8A 5CZDB 4BPGA 2FQ0A 2LIWA 2L0QA 2FAEA 5HVCA 2JU1A 2N6YA 2N5HA 3RG2A 2CGQA 2XZ1C 2KORA 2FVAA 1HQBA 4PXHB 2N98A 2N5IA 2KOSA 1ACPA 2GDWA 2K0YA 2L4BA 4DG9A 3NY7B 4CA3A 2PNGA 1OR5A 1HY8A 3GZMA 2MY5A 5KP8B 2L22A 2KG6A 2L9FA 2MVVA 2FQ2A 2K94A 2AF8A 2LTEA 2EHSA 2AVAA 2FVEA 1KLPA 4BPHA 2N50A 2MR7A 3CE7A 2KOQA 4H2WC 2K93A 2CQ8A 2MVUA 2QNWA 3GZLA 1AF8A 2KG9A 2LIUA 1DNYA 2GDXA 2AFEA 2X2BA 4HKGA 4BPFA 2MR8A 2KOOA 2JU2A 2LKIA 2LOLA 4H2YC 2FQ1A 1F80D 2K0XA 2JGPA 2LMLA 2KR5A 1DV5A 5KP6B 2FACA 2VSQA 2K2QA 2KGAA 2K92A 1L0HA 2KWLA 2LPKA 2KGCA 4IZ6A 2DNWA 1L0IA 2EHTA 2ROQA 2AFDA 5EJDA 2M5RA 2KW2A
chains in the Genus database with same CATH superfamily
2CNRA 1T8KA 2CG5B 2KGEA 2KG8A 1X3OA 2Z46A 2OTJP 2MF4A 2GDYA 4U0FA 3LMOA 3CCQP 3DS4A 2N6ZA 2EFJA 3G21A 2M8NA 3MGEA 1N8RQ 5HV8A 2Z44A 5CZDB 1K73Q 2FQ0A 2L0QA 3G71P 3G1IA 3CC7P 1JJ2O 5HGLA 2N98A 2N5IA 1ACPA 1OR5A 3GZMA 4U0BA 2MY5A 3CD6P 4WYMA 1YJNP 2MVVA 2DGYA 2AF8A 2LTEA 3DS1A 3CCVP 1Q81Q 5I4TG 4U0AA 1M6NA 3CE7A 1KQSO 3CCRP 2K93A 2LIUA 1M74A 2GDXA 1UNKA 2X2BA 4H2YC 1F80D 1RNIA 2JGPA 3RG6C 3H4EA 1EMVA 2VSQA 2M8PA 5BS2A 2DNWA 1L0IA 3I55P 3DPHA 2AFDA 3G28A 5HGMA 2CWOA 2Z45A 3E2DA 4NEOA 1KC8Q 3H47A 1E6JP 2MD9A 4UHPB 3EJEA 4PH0A 3DS2A 3EJBA 2XZ0D 2PY8A 1VHNA 4M0IA 3GJNA 3EJDA 2PEIA 4H2XC 2JYLA 1Q7YQ 5HGOA 2NO8A 4BPGA 1D1DA 1BAJA 1S72P 1M1KQ 3DS3A 2PEJA 2PEMA 2JYGA 2VLPA 2N5HA 2K0DX 3Q20A 4PXHB 5F2KA 2GDWA 2K0YA 3NY7B 2PNGA 1HY8A 1K30A 2KG6A 5EW5E 2BUOA 4XFXA 5HGNA 2EHSA 2AVAA 4U0EA 2MR7A 2PENA 3CCSP 2PEKA 1BXIA 1GXGA 4H2WC 1DNYA 1M6EX 3CCEP 2M8LA 2KOOA 2MR8A 2JU2A 1E0HA 1A8OA 1GXHA 3HYBA 2QEXP 3M1MA 3G26A 1IMPA 1EIAA 1GPJA 1W2BO 1L0HA 2GZJA 2ROQA 1A43A 1RO0A 2VLQA 5F2NA 4GR6A 2KW2A 2JQ4A 1Q82Q 2JBGA 2VLOA 2KODA 3CMAP 3G0VA 1VQKP 5F2OA 4MRTC 4R0MA 1VQ5P 3CCLP 3I56P 1UJZA 2KGDA 1RO2A 2E1MA 1AYIA 3CCUP 1VQMP 1ZNVA 5BS1A 2BHVA 2LIWA 4XFYA 7CEIA 2XXMA 3DS0A 3OW2O 2N6YA 3RG2A 1MZ8A 2KORA 2FVAA 1HQBA 2GYKA 1VQNP 3CC4P 2L4BA 4DG9A 4CA3A 2EIAA 1VQ6P 2JO0A 2GZGA 5KP8B 2L22A 2L9FA 2K94A 1K8AQ 1AUMA 1VQLP 2KOQA 2L6EA 2MVUA 2QNWA 3CXCO 5DCKA 1YJWP 2P9XA 2WPTA 4BPFA 2K5XA 2LKIA 2LOLA 2GZEA 2JAZA 4IPYA 4QNBA 2ONTA 2QA4P 3G1GA 1FR2A 5KP6B 2FACA 1YHQP 2K2QA 2K92A 2LPKA 2KGCA 2GZIA 1QVFO 1Z6MA 2EHTA 1M90Q 5EJDA 1YIJP 3B5IA 4PWVB 2XT1A 2FHSC 4XRQA 2LL8A 1NQ4A 1VQ7P 3B4QA 4XROA 4COPA 4F37A 1YI2P 2FVFA 3CCJP 2PEOA 1VKUA 1QVGO 1YITP 2KOPA 5KP7B 3G6EP 2FADA 4GR2A 1CEIA 4XFZA 1IMQA 2FAEA 4U0DA 4QKOA 2XV6A 5HVCA 2JU1A 1KD1Q 2CGQA 2VLNA 2XZ1C 1VQPP 1K9MQ 2KOSA 2LF4A 4PH1A 3P05A 3CC2P 3DTJA 1EOQA 3WBHA 1VQ8P 2FQ2A 2OARA 2FVEA 1KLPA 4U0CA 3DS5A 4BPHA 2ERHA 2N50A 2PEQA 3H0DA 1YJ9P 3G4SP 2CQ8A 3GZLA 1AF8A 2KG9A 2OTLP 2AFEA 5JPAA 3VRLC 3NTEA 4HKGA 1VQ4P 2EG5A 3CPWO 1QRJA 1VQOP 2FQ1A 2K0XA 2GZFA 3LRYA 2LMLA 2KR5A 1DV5A 1IUQA 1ZMBA 3CCMP 3CMEP 2KGAA 2KWLA 4IZ6A 2JB0A 3G29A 1Q86Q 1NJIQ 3GKLC 1VQ9P 3HZQA 3U43A 4COCA 2M5RA
chains in the Genus database with same CATH topology
2CNRA 4NEOA 4PWVB 2JQ4A 2FHSC 1T8KA 2MD9A 2CG5B 2KGEA 2LL8A 1NQ4A 2KG8A 1X3OA 4MRTC 2FVFA 2MF4A 2GDYA 4R0MA 3EJEA 1VKUA 3EJBA 3LMOA 2XZ0D 2N6ZA 3EJDA 2KOPA 2KGDA 5KP7B 2FADA 4H2XC 5HV8A 5CZDB 4BPGA 2FQ0A 2LIWA 2L0QA 2FAEA 5HVCA 2JU1A 2N6YA 2N5HA 3RG2A 2CGQA 2XZ1C 2KORA 2FVAA 1HQBA 4PXHB 2N98A 2N5IA 2KOSA 1ACPA 2GDWA 2K0YA 2L4BA 4DG9A 3NY7B 4CA3A 2PNGA 1OR5A 1HY8A 3GZMA 2MY5A 5KP8B 2L22A 2KG6A 2L9FA 2MVVA 2FQ2A 2K94A 2AF8A 2LTEA 2EHSA 2AVAA 2FVEA 1KLPA 4BPHA 2N50A 2MR7A 3CE7A 2KOQA 4H2WC 2K93A 2CQ8A 2MVUA 2QNWA 3GZLA 1AF8A 2KG9A 2LIUA 1DNYA 2GDXA 2AFEA 2X2BA 4HKGA 4BPFA 2MR8A 2KOOA 2JU2A 2LKIA 2LOLA 4H2YC 2FQ1A 1F80D 2K0XA 2JGPA 2LMLA 2KR5A 1DV5A 5KP6B 2FACA 2VSQA 2K2QA 2KGAA 2K92A 1L0HA 2KWLA 2LPKA 2KGCA 4IZ6A 2DNWA 1L0IA 2EHTA 2ROQA 2AFDA 5EJDA 2M5RA 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNR A;  4NEO A;  4PWV B;  2JQ4 A;  2FHS C;  1T8K A;  2MD9 A;  2CG5 B;  2KGE A;  2LL8 A;  1NQ4 A;  2KG8 A;  1X3O A;  4MRT C;  2FVF A;  2MF4 A;  2GDY A;  4R0M A;  3EJE A;  1VKU A;  3EJB A;  3LMO A;  2XZ0 D;  2N6Z A;  3EJD A;  2KOP A;  2KGD A;  5KP7 B;  2FAD A;  4H2X C;  5HV8 A;  5CZD B;  4BPG A;  2FQ0 A;  2LIW A;  2L0Q A;  2FAE A;  5HVC A;  2JU1 A;  2N6Y A;  2N5H A;  3RG2 A;  2CGQ A;  2XZ1 C;  2KOR A;  2FVA A;  1HQB A;  4PXH B;  2N98 A;  2N5I A;  2KOS A;  1ACP A;  2GDW A;  2K0Y A;  2L4B A;  4DG9 A;  3NY7 B;  4CA3 A;  2PNG A;  1OR5 A;  1HY8 A;  3GZM A;  2MY5 A;  5KP8 B;  2L22 A;  2KG6 A;  2L9F A;  2MVV A;  2FQ2 A;  2K94 A;  2AF8 A;  2LTE A;  2EHS A;  2AVA A;  2FVE A;  1KLP A;  4BPH A;  2N50 A;  2MR7 A;  3CE7 A;  2KOQ A;  4H2W C;  2K93 A;  2CQ8 A;  2MVU A;  2QNW A;  3GZL A;  1AF8 A;  2KG9 A;  2LIU A;  1DNY A;  2GDX A;  2AFE A;  2X2B A;  4HKG A;  4BPF A;  2MR8 A;  2KOO A;  2JU2 A;  2LKI A;  2LOL A;  4H2Y C;  2FQ1 A;  1F80 D;  2K0X A;  2JGP A;  2LML A;  2KR5 A;  1DV5 A;  5KP6 B;  2FAC A;  2VSQ A;  2K2Q A;  2KGA A;  2K92 A;  1L0H A;  2KWL A;  2LPK A;  2KGC A;  4IZ6 A;  2DNW A;  1L0I A;  2EHT A;  2ROQ A;  2AFD A;  5EJD A;  2M5R A;  2KW2 A; 
#chains in the Genus database with same CATH topology
 2CNR A;  1T8K A;  2CG5 B;  2KGE A;  2KG8 A;  1X3O A;  2Z46 A;  2OTJ P;  2MF4 A;  2GDY A;  4U0F A;  3LMO A;  3CCQ P;  3DS4 A;  2N6Z A;  2EFJ A;  3G21 A;  2M8N A;  3MGE A;  1N8R Q;  5HV8 A;  2Z44 A;  5CZD B;  1K73 Q;  2FQ0 A;  2L0Q A;  3G71 P;  3G1I A;  3CC7 P;  1JJ2 O;  5HGL A;  2N98 A;  2N5I A;  1ACP A;  1OR5 A;  3GZM A;  4U0B A;  2MY5 A;  3CD6 P;  4WYM A;  1YJN P;  2MVV A;  2DGY A;  2AF8 A;  2LTE A;  3DS1 A;  3CCV P;  1Q81 Q;  5I4T G;  4U0A A;  1M6N A;  3CE7 A;  1KQS O;  3CCR P;  2K93 A;  2LIU A;  1M74 A;  2GDX A;  1UNK A;  2X2B A;  4H2Y C;  1F80 D;  1RNI A;  2JGP A;  3RG6 C;  3H4E A;  1EMV A;  2VSQ A;  2M8P A;  5BS2 A;  2DNW A;  1L0I A;  3I55 P;  3DPH A;  2AFD A;  3G28 A;  5HGM A;  2CWO A;  2Z45 A;  3E2D A;  4NEO A;  1KC8 Q;  3H47 A;  1E6J P;  2MD9 A;  4UHP B;  3EJE A;  4PH0 A;  3DS2 A;  3EJB A;  2XZ0 D;  2PY8 A;  1VHN A;  4M0I A;  3GJN A;  3EJD A;  2PEI A;  4H2X C;  2JYL A;  1Q7Y Q;  5HGO A;  2NO8 A;  4BPG A;  1D1D A;  1BAJ A;  1S72 P;  1M1K Q;  3DS3 A;  2PEJ A;  2PEM A;  2JYG A;  2VLP A;  2N5H A;  2K0D X;  3Q20 A;  4PXH B;  5F2K A;  2GDW A;  2K0Y A;  3NY7 B;  2PNG A;  1HY8 A;  1K30 A;  2KG6 A;  5EW5 E;  2BUO A;  4XFX A;  5HGN A;  2EHS A;  2AVA A;  4U0E A;  2MR7 A;  2PEN A;  3CCS P;  2PEK A;  1BXI A;  1GXG A;  4H2W C;  1DNY A;  1M6E X;  3CCE P;  2M8L A;  2KOO A;  2MR8 A;  2JU2 A;  1E0H A;  1A8O A;  1GXH A;  3HYB A;  2QEX P;  3M1M A;  3G26 A;  1IMP A;  1EIA A;  1GPJ A;  1W2B O;  1L0H A;  2GZJ A;  2ROQ A;  1A43 A;  1RO0 A;  2VLQ A;  5F2N A;  4GR6 A;  2KW2 A;  2JQ4 A;  1Q82 Q;  2JBG A;  2VLO A;  2KOD A;  3CMA P;  3G0V A;  1VQK P;  5F2O A;  4MRT C;  4R0M A;  1VQ5 P;  3CCL P;  3I56 P;  1UJZ A;  2KGD A;  1RO2 A;  2E1M A;  1AYI A;  3CCU P;  1VQM P;  1ZNV A;  5BS1 A;  2BHV A;  2LIW A;  4XFY A;  7CEI A;  2XXM A;  3DS0 A;  3OW2 O;  2N6Y A;  3RG2 A;  1MZ8 A;  2KOR A;  2FVA A;  1HQB A;  2GYK A;  1VQN P;  3CC4 P;  2L4B A;  4DG9 A;  4CA3 A;  2EIA A;  1VQ6 P;  2JO0 A;  2GZG A;  5KP8 B;  2L22 A;  2L9F A;  2K94 A;  1K8A Q;  1AUM A;  1VQL P;  2KOQ A;  2L6E A;  2MVU A;  2QNW A;  3CXC O;  5DCK A;  1YJW P;  2P9X A;  2WPT A;  4BPF A;  2K5X A;  2LKI A;  2LOL A;  2GZE A;  2JAZ A;  4IPY A;  4QNB A;  2ONT A;  2QA4 P;  3G1G A;  1FR2 A;  5KP6 B;  2FAC A;  1YHQ P;  2K2Q A;  2K92 A;  2LPK A;  2KGC A;  2GZI A;  1QVF O;  1Z6M A;  2EHT A;  1M90 Q;  5EJD A;  1YIJ P;  3B5I A;  4PWV B;  2XT1 A;  2FHS C;  4XRQ A;  2LL8 A;  1NQ4 A;  1VQ7 P;  3B4Q A;  4XRO A;  4COP A;  4F37 A;  1YI2 P;  2FVF A;  3CCJ P;  2PEO A;  1VKU A;  1QVG O;  1YIT P;  2KOP A;  5KP7 B;  3G6E P;  2FAD A;  4GR2 A;  1CEI A;  4XFZ A;  1IMQ A;  2FAE A;  4U0D A;  4QKO A;  2XV6 A;  5HVC A;  2JU1 A;  1KD1 Q;  2CGQ A;  2VLN A;  2XZ1 C;  1VQP P;  1K9M Q;  2KOS A;  2LF4 A;  4PH1 A;  3P05 A;  3CC2 P;  3DTJ A;  1EOQ A;  3WBH A;  1VQ8 P;  2FQ2 A;  2OAR A;  2FVE A;  1KLP A;  4U0C A;  3DS5 A;  4BPH A;  2ERH A;  2N50 A;  2PEQ A;  3H0D A;  1YJ9 P;  3G4S P;  2CQ8 A;  3GZL A;  1AF8 A;  2KG9 A;  2OTL P;  2AFE A;  5JPA A;  3VRL C;  3NTE A;  4HKG A;  1VQ4 P;  2EG5 A;  3CPW O;  1QRJ A;  1VQO P;  2FQ1 A;  2K0X A;  2GZF A;  3LRY A;  2LML A;  2KR5 A;  1DV5 A;  1IUQ A;  1ZMB A;  3CCM P;  3CME P;  2KGA A;  2KWL A;  4IZ6 A;  2JB0 A;  3G29 A;  1Q86 Q;  1NJI Q;  3GKL C;  1VQ9 P;  3HZQ A;  3U43 A;  4COC A;  2M5R A; 
#chains in the Genus database with same CATH homology
 2CNR A;  4NEO A;  4PWV B;  2JQ4 A;  2FHS C;  1T8K A;  2MD9 A;  2CG5 B;  2KGE A;  2LL8 A;  1NQ4 A;  2KG8 A;  1X3O A;  4MRT C;  2FVF A;  2MF4 A;  2GDY A;  4R0M A;  3EJE A;  1VKU A;  3EJB A;  3LMO A;  2XZ0 D;  2N6Z A;  3EJD A;  2KOP A;  2KGD A;  5KP7 B;  2FAD A;  4H2X C;  5HV8 A;  5CZD B;  4BPG A;  2FQ0 A;  2LIW A;  2L0Q A;  2FAE A;  5HVC A;  2JU1 A;  2N6Y A;  2N5H A;  3RG2 A;  2CGQ A;  2XZ1 C;  2KOR A;  2FVA A;  1HQB A;  4PXH B;  2N98 A;  2N5I A;  2KOS A;  1ACP A;  2GDW A;  2K0Y A;  2L4B A;  4DG9 A;  3NY7 B;  4CA3 A;  2PNG A;  1OR5 A;  1HY8 A;  3GZM A;  2MY5 A;  5KP8 B;  2L22 A;  2KG6 A;  2L9F A;  2MVV A;  2FQ2 A;  2K94 A;  2AF8 A;  2LTE A;  2EHS A;  2AVA A;  2FVE A;  1KLP A;  4BPH A;  2N50 A;  2MR7 A;  3CE7 A;  2KOQ A;  4H2W C;  2K93 A;  2CQ8 A;  2MVU A;  2QNW A;  3GZL A;  1AF8 A;  2KG9 A;  2LIU A;  1DNY A;  2GDX A;  2AFE A;  2X2B A;  4HKG A;  4BPF A;  2MR8 A;  2KOO A;  2JU2 A;  2LKI A;  2LOL A;  4H2Y C;  2FQ1 A;  1F80 D;  2K0X A;  2JGP A;  2LML A;  2KR5 A;  1DV5 A;  5KP6 B;  2FAC A;  2VSQ A;  2K2Q A;  2KGA A;  2K92 A;  1L0H A;  2KWL A;  2LPK A;  2KGC A;  4IZ6 A;  2DNW A;  1L0I A;  2EHT A;  2ROQ A;  2AFD A;  5EJD A;  2M5R A;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...