1DV5A

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transport protein
molecule keywords APO-D-ALANYL CARRIER PROTEIN
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dv5A00
3GZMA 3GZLA 4DG9A 2L9FA 2FHSC 2KOPA 5HVCA 5KP6B 2KGAA 4BPHA 2MD9A 2LIWA 2LTEA 3RG2A 2MF4A 4BPGA 2CGQA 2PNGA 1ACPA 2FVEA 4H2XC 2L0QA 2M5RA 2FQ2A 2N98A 1DV5A 4HKGA 3EJEA 2VSQA 2K2QA 2XZ1C 1T8KA 2KORA 4NEOA 2KG9A 2K0XA 2KG8A 1HY8A 2KG6A 2LL8A 1F80D 2KWLA 2AVAA 2KOSA 2LPKA 2KGEA 1L0IA 4R0MA 2FAEA 2GDWA 2LKIA 4MRTC 1DNYA 2L4BA 2LIUA 2AFEA 2MVVA 4H2YC 2FQ0A 1VKUA 2MR8A 2FVFA 5CZDB 5KP8B 1HQBA 2K0YA 2K94A 2KOOA 3NY7B 2KOQA 2FVAA 2EHSA 2LMLA 3EJDA 2KGDA 2N5HA 1OR5A 5KP7B 2K92A 2JU1A 2DNWA 2AF8A 2ROQA 3LMOA 2K93A 5HV8A 2CG5B 2GDYA 2FQ1A 2X2BA 4IZ6A 4H2WC 4CA3A 2N6YA 2EHTA 2FACA 4PXHB 3CE7A 2KGCA 2MR7A 2N5IA 2MY5A 4PWVB 2N50A 2CNRA 1L0HA 1NQ4A 1AF8A 5EJDA 1KLPA 2JU2A 2GDXA 4BPFA 2AFDA 2QNWA 2CQ8A 2KR5A 2L22A 3EJBA 2FADA 2LOLA 2MVUA 2XZ0D 1X3OA 2JGPA 2JQ4A 2KW2A 2N6ZA
chains in the Genus database with same CATH superfamily
1K30A 3GZLA 1QVGO 2KOPA 5F2NA 3DTJA 3HZQA 2LTEA 1N8RQ 3RG2A 2MF4A 4BPGA 4PH1A 2PNGA 1VQ8P 1RO0A 2L0QA 3G29A 2M5RA 2N98A 2DGYA 2PEJA 1DV5A 2VSQA 3E2DA 4GR2A 2PEQA 1YITP 4PH0A 1VQ9P 2KORA 2JBGA 2KG8A 1VQ7P 2EG5A 2KOSA 2LPKA 2JYLA 2VLNA 4MRTC 3G71P 4H2YC 2FQ0A 3G21A 2GZJA 5KP8B 2K0YA 2PEMA 1IUQA 3OW2O 1AUMA 2KOOA 3G1IA 4GR6A 3EJDA 5F2KA 2L6EA 4XROA 2K92A 2JU1A 4QNBA 1VQPP 3LMOA 2K93A 4UHPB 1BAJA 2PEIA 4H2WC 2OARA 2KODA 5HGMA 2MY5A 4PWVB 1VQOP 3GKLC 2XT1A 1AF8A 4U0BA 2AFDA 2QNWA 4U0DA 5JPAA 2KR5A 3DS4A 3G1GA 2LOLA 2VLOA 1UNKA 1L0IA 2KW2A 2GZGA 2NO8A 4U0FA 3CC4P 2ERHA 2KGAA 4BPHA 3M1MA 2GZEA 2GZIA 1ZNVA 2CGQA 1GXGA 1ACPA 2CWOA 1M6NA 4WYMA 1M1KQ 3GJNA 2JYGA 2OTLP 3G0VA 2VLPA 2K2QA 2XZ1C 2LF4A 2VLQA 3H47A 2KG6A 3CCSP 2KWLA 2AVAA 2QA4P 1KD1Q 2EIAA 3NTEA 1AYIA 1VQ6P 1Q86Q 2LKIA 2GYKA 2LIUA 1Q82Q 2P9XA 2QEXP 1VQ4P 1YJWP 1E6JP 3CCRP 4XFYA 1BXIA 2EHSA 2GZFA 1GPJA 2KGDA 3CCEP 5KP7B 2DNWA 2AF8A 2PENA 3CXCO 1RNIA 3DS1A 3CCLP 2Z44A 2X2BA 4IZ6A 1A8OA 1VQ5P 2FACA 3CE7A 4U0EA 3VRLC 1M90Q 3DS3A 2JB0A 5EJDA 3I55P 2JU2A 3RG6C 4BPFA 2CQ8A 1MZ8A 1EMVA 2M8NA 1IMPA 3CCMP 3G4SP 3EJBA 3I56P 4U0AA 2XZ0D 1X3OA 1Q81Q 2N6ZA 2CNRA 1EOQA 1D1DA 1KQSO 2L9FA 3CCVP 2FHSC 5DCKA 1K9MQ 1QRJA 2MD9A 5HGNA 4IPYA 3CD6P 1FR2A 3B5IA 1K73Q 4H2XC 3CCJP 1Q7YQ 5HGOA 1S72P 5EW5E 5F2OA 2KG9A 2K0XA 1HY8A 1E0HA 2LL8A 1F80D 3H0DA 3CCUP 1IMQA 4R0MA 2FAEA 1VQKP 2M8PA 2PY8A 4COCA 2AFEA 2MVVA 2MR8A 2FVFA 5CZDB 1CEIA 5I4TG 2Z45A 2KOQA 2FVAA 1NJIQ 1M74A 2N5HA 1OR5A 3WBHA 2Z46A 3CC2P 2PEKA 1Z6MA 3MGEA 4M0IA 4XFZA 1VQMP 2CG5B 1VQLP 3G28A 1YJ9P 2N6YA 2EHTA 2KGCA 2MR7A 3H4EA 2N5IA 2N50A 1K8AQ 3DS5A 2WPTA 1QVFO 1W2BO 2GDXA 3LRYA 1EIAA 2K0DX 2L22A 1M6EX 2E1MA 2MVUA 3CCQP 1VQNP 2JGPA 2XXMA 2FQ2A 3GZMA 4U0CA 4DG9A 4F37A 5HVCA 5KP6B 3CC7P 2LIWA 5BS1A 1ZMBA 3Q20A 5BS2A 3CMEP 4XRQA 3G26A 2FVEA 7CEIA 1RO2A 4HKGA 3EJEA 4QKOA 1T8KA 4NEOA 3CMAP 1GXHA 2JO0A 1YIJP 2KGEA 2GDWA 1DNYA 2BHVA 2K5XA 3B4QA 2L4BA 3DS0A 1YJNP 2M8LA 1VKUA 1HQBA 2OTJP 2XV6A 1JJ2O 2K94A 1VHNA 3NY7B 2LMLA 3HYBA 4XFXA 3U43A 2BUOA 2ROQA 1YHQP 3DPHA 5HV8A 2GDYA 1KC8Q 2ONTA 2FQ1A 5HGLA 2JAZA 2EFJA 4CA3A 4PXHB 3P05A 1L0HA 1YI2P 1NQ4A 3G6EP 4COPA 3CPWO 3DS2A 1A43A 2PEOA 1UJZA 2FADA 2JQ4A 1KLPA
chains in the Genus database with same CATH topology
3GZMA 3GZLA 4DG9A 2L9FA 2FHSC 2KOPA 5HVCA 5KP6B 2KGAA 4BPHA 2MD9A 2LIWA 2LTEA 3RG2A 2MF4A 4BPGA 2CGQA 2PNGA 1ACPA 2FVEA 4H2XC 2L0QA 2M5RA 2FQ2A 2N98A 1DV5A 4HKGA 3EJEA 2VSQA 2K2QA 2XZ1C 1T8KA 2KORA 4NEOA 2KG9A 2K0XA 2KG8A 1HY8A 2KG6A 2LL8A 1F80D 2KWLA 2AVAA 2KOSA 2LPKA 2KGEA 1L0IA 4R0MA 2FAEA 2GDWA 2LKIA 4MRTC 1DNYA 2L4BA 2LIUA 2AFEA 2MVVA 4H2YC 2FQ0A 1VKUA 2MR8A 2FVFA 5CZDB 5KP8B 1HQBA 2K0YA 2K94A 2KOOA 3NY7B 2KOQA 2FVAA 2EHSA 2LMLA 3EJDA 2KGDA 2N5HA 1OR5A 5KP7B 2K92A 2JU1A 2DNWA 2AF8A 2ROQA 3LMOA 2K93A 5HV8A 2CG5B 2GDYA 2FQ1A 2X2BA 4IZ6A 4H2WC 4CA3A 2N6YA 2EHTA 2FACA 4PXHB 3CE7A 2KGCA 2MR7A 2N5IA 2MY5A 4PWVB 2N50A 2CNRA 1L0HA 1NQ4A 1AF8A 5EJDA 1KLPA 2JU2A 2GDXA 4BPFA 2AFDA 2QNWA 2CQ8A 2KR5A 2L22A 3EJBA 2FADA 2LOLA 2MVUA 2XZ0D 1X3OA 2JGPA 2JQ4A 2KW2A 2N6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZM A;  3GZL A;  4DG9 A;  2L9F A;  2FHS C;  2KOP A;  5HVC A;  5KP6 B;  2KGA A;  4BPH A;  2MD9 A;  2LIW A;  2LTE A;  3RG2 A;  2MF4 A;  4BPG A;  2CGQ A;  2PNG A;  1ACP A;  2FVE A;  4H2X C;  2L0Q A;  2M5R A;  2FQ2 A;  2N98 A;  1DV5 A;  4HKG A;  3EJE A;  2VSQ A;  2K2Q A;  2XZ1 C;  1T8K A;  2KOR A;  4NEO A;  2KG9 A;  2K0X A;  2KG8 A;  1HY8 A;  2KG6 A;  2LL8 A;  1F80 D;  2KWL A;  2AVA A;  2KOS A;  2LPK A;  2KGE A;  1L0I A;  4R0M A;  2FAE A;  2GDW A;  2LKI A;  4MRT C;  1DNY A;  2L4B A;  2LIU A;  2AFE A;  2MVV A;  4H2Y C;  2FQ0 A;  1VKU A;  2MR8 A;  2FVF A;  5CZD B;  5KP8 B;  1HQB A;  2K0Y A;  2K94 A;  2KOO A;  3NY7 B;  2KOQ A;  2FVA A;  2EHS A;  2LML A;  3EJD A;  2KGD A;  2N5H A;  1OR5 A;  5KP7 B;  2K92 A;  2JU1 A;  2DNW A;  2AF8 A;  2ROQ A;  3LMO A;  2K93 A;  5HV8 A;  2CG5 B;  2GDY A;  2FQ1 A;  2X2B A;  4IZ6 A;  4H2W C;  4CA3 A;  2N6Y A;  2EHT A;  2FAC A;  4PXH B;  3CE7 A;  2KGC A;  2MR7 A;  2N5I A;  2MY5 A;  4PWV B;  2N50 A;  2CNR A;  1L0H A;  1NQ4 A;  1AF8 A;  5EJD A;  1KLP A;  2JU2 A;  2GDX A;  4BPF A;  2AFD A;  2QNW A;  2CQ8 A;  2KR5 A;  2L22 A;  3EJB A;  2FAD A;  2LOL A;  2MVU A;  2XZ0 D;  1X3O A;  2JGP A;  2JQ4 A;  2KW2 A;  2N6Z A; 
#chains in the Genus database with same CATH topology
 1K30 A;  3GZL A;  1QVG O;  2KOP A;  5F2N A;  3DTJ A;  3HZQ A;  2LTE A;  1N8R Q;  3RG2 A;  2MF4 A;  4BPG A;  4PH1 A;  2PNG A;  1VQ8 P;  1RO0 A;  2L0Q A;  3G29 A;  2M5R A;  2N98 A;  2DGY A;  2PEJ A;  1DV5 A;  2VSQ A;  3E2D A;  4GR2 A;  2PEQ A;  1YIT P;  4PH0 A;  1VQ9 P;  2KOR A;  2JBG A;  2KG8 A;  1VQ7 P;  2EG5 A;  2KOS A;  2LPK A;  2JYL A;  2VLN A;  4MRT C;  3G71 P;  4H2Y C;  2FQ0 A;  3G21 A;  2GZJ A;  5KP8 B;  2K0Y A;  2PEM A;  1IUQ A;  3OW2 O;  1AUM A;  2KOO A;  3G1I A;  4GR6 A;  3EJD A;  5F2K A;  2L6E A;  4XRO A;  2K92 A;  2JU1 A;  4QNB A;  1VQP P;  3LMO A;  2K93 A;  4UHP B;  1BAJ A;  2PEI A;  4H2W C;  2OAR A;  2KOD A;  5HGM A;  2MY5 A;  4PWV B;  1VQO P;  3GKL C;  2XT1 A;  1AF8 A;  4U0B A;  2AFD A;  2QNW A;  4U0D A;  5JPA A;  2KR5 A;  3DS4 A;  3G1G A;  2LOL A;  2VLO A;  1UNK A;  1L0I A;  2KW2 A;  2GZG A;  2NO8 A;  4U0F A;  3CC4 P;  2ERH A;  2KGA A;  4BPH A;  3M1M A;  2GZE A;  2GZI A;  1ZNV A;  2CGQ A;  1GXG A;  1ACP A;  2CWO A;  1M6N A;  4WYM A;  1M1K Q;  3GJN A;  2JYG A;  2OTL P;  3G0V A;  2VLP A;  2K2Q A;  2XZ1 C;  2LF4 A;  2VLQ A;  3H47 A;  2KG6 A;  3CCS P;  2KWL A;  2AVA A;  2QA4 P;  1KD1 Q;  2EIA A;  3NTE A;  1AYI A;  1VQ6 P;  1Q86 Q;  2LKI A;  2GYK A;  2LIU A;  1Q82 Q;  2P9X A;  2QEX P;  1VQ4 P;  1YJW P;  1E6J P;  3CCR P;  4XFY A;  1BXI A;  2EHS A;  2GZF A;  1GPJ A;  2KGD A;  3CCE P;  5KP7 B;  2DNW A;  2AF8 A;  2PEN A;  3CXC O;  1RNI A;  3DS1 A;  3CCL P;  2Z44 A;  2X2B A;  4IZ6 A;  1A8O A;  1VQ5 P;  2FAC A;  3CE7 A;  4U0E A;  3VRL C;  1M90 Q;  3DS3 A;  2JB0 A;  5EJD A;  3I55 P;  2JU2 A;  3RG6 C;  4BPF A;  2CQ8 A;  1MZ8 A;  1EMV A;  2M8N A;  1IMP A;  3CCM P;  3G4S P;  3EJB A;  3I56 P;  4U0A A;  2XZ0 D;  1X3O A;  1Q81 Q;  2N6Z A;  2CNR A;  1EOQ A;  1D1D A;  1KQS O;  2L9F A;  3CCV P;  2FHS C;  5DCK A;  1K9M Q;  1QRJ A;  2MD9 A;  5HGN A;  4IPY A;  3CD6 P;  1FR2 A;  3B5I A;  1K73 Q;  4H2X C;  3CCJ P;  1Q7Y Q;  5HGO A;  1S72 P;  5EW5 E;  5F2O A;  2KG9 A;  2K0X A;  1HY8 A;  1E0H A;  2LL8 A;  1F80 D;  3H0D A;  3CCU P;  1IMQ A;  4R0M A;  2FAE A;  1VQK P;  2M8P A;  2PY8 A;  4COC A;  2AFE A;  2MVV A;  2MR8 A;  2FVF A;  5CZD B;  1CEI A;  5I4T G;  2Z45 A;  2KOQ A;  2FVA A;  1NJI Q;  1M74 A;  2N5H A;  1OR5 A;  3WBH A;  2Z46 A;  3CC2 P;  2PEK A;  1Z6M A;  3MGE A;  4M0I A;  4XFZ A;  1VQM P;  2CG5 B;  1VQL P;  3G28 A;  1YJ9 P;  2N6Y A;  2EHT A;  2KGC A;  2MR7 A;  3H4E A;  2N5I A;  2N50 A;  1K8A Q;  3DS5 A;  2WPT A;  1QVF O;  1W2B O;  2GDX A;  3LRY A;  1EIA A;  2K0D X;  2L22 A;  1M6E X;  2E1M A;  2MVU A;  3CCQ P;  1VQN P;  2JGP A;  2XXM A;  2FQ2 A;  3GZM A;  4U0C A;  4DG9 A;  4F37 A;  5HVC A;  5KP6 B;  3CC7 P;  2LIW A;  5BS1 A;  1ZMB A;  3Q20 A;  5BS2 A;  3CME P;  4XRQ A;  3G26 A;  2FVE A;  7CEI A;  1RO2 A;  4HKG A;  3EJE A;  4QKO A;  1T8K A;  4NEO A;  3CMA P;  1GXH A;  2JO0 A;  1YIJ P;  2KGE A;  2GDW A;  1DNY A;  2BHV A;  2K5X A;  3B4Q A;  2L4B A;  3DS0 A;  1YJN P;  2M8L A;  1VKU A;  1HQB A;  2OTJ P;  2XV6 A;  1JJ2 O;  2K94 A;  1VHN A;  3NY7 B;  2LML A;  3HYB A;  4XFX A;  3U43 A;  2BUO A;  2ROQ A;  1YHQ P;  3DPH A;  5HV8 A;  2GDY A;  1KC8 Q;  2ONT A;  2FQ1 A;  5HGL A;  2JAZ A;  2EFJ A;  4CA3 A;  4PXH B;  3P05 A;  1L0H A;  1YI2 P;  1NQ4 A;  3G6E P;  4COP A;  3CPW O;  3DS2 A;  1A43 A;  2PEO A;  1UJZ A;  2FAD A;  2JQ4 A;  1KLP A; 
#chains in the Genus database with same CATH homology
 3GZM A;  3GZL A;  4DG9 A;  2L9F A;  2FHS C;  2KOP A;  5HVC A;  5KP6 B;  2KGA A;  4BPH A;  2MD9 A;  2LIW A;  2LTE A;  3RG2 A;  2MF4 A;  4BPG A;  2CGQ A;  2PNG A;  1ACP A;  2FVE A;  4H2X C;  2L0Q A;  2M5R A;  2FQ2 A;  2N98 A;  1DV5 A;  4HKG A;  3EJE A;  2VSQ A;  2K2Q A;  2XZ1 C;  1T8K A;  2KOR A;  4NEO A;  2KG9 A;  2K0X A;  2KG8 A;  1HY8 A;  2KG6 A;  2LL8 A;  1F80 D;  2KWL A;  2AVA A;  2KOS A;  2LPK A;  2KGE A;  1L0I A;  4R0M A;  2FAE A;  2GDW A;  2LKI A;  4MRT C;  1DNY A;  2L4B A;  2LIU A;  2AFE A;  2MVV A;  4H2Y C;  2FQ0 A;  1VKU A;  2MR8 A;  2FVF A;  5CZD B;  5KP8 B;  1HQB A;  2K0Y A;  2K94 A;  2KOO A;  3NY7 B;  2KOQ A;  2FVA A;  2EHS A;  2LML A;  3EJD A;  2KGD A;  2N5H A;  1OR5 A;  5KP7 B;  2K92 A;  2JU1 A;  2DNW A;  2AF8 A;  2ROQ A;  3LMO A;  2K93 A;  5HV8 A;  2CG5 B;  2GDY A;  2FQ1 A;  2X2B A;  4IZ6 A;  4H2W C;  4CA3 A;  2N6Y A;  2EHT A;  2FAC A;  4PXH B;  3CE7 A;  2KGC A;  2MR7 A;  2N5I A;  2MY5 A;  4PWV B;  2N50 A;  2CNR A;  1L0H A;  1NQ4 A;  1AF8 A;  5EJD A;  1KLP A;  2JU2 A;  2GDX A;  4BPF A;  2AFD A;  2QNW A;  2CQ8 A;  2KR5 A;  2L22 A;  3EJB A;  2FAD A;  2LOL A;  2MVU A;  2XZ0 D;  1X3O A;  2JGP A;  2JQ4 A;  2KW2 A;  2N6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...