1DV5A

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-D-ALANYL CARRIER PROTEIN
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transport protein
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dv5A00
2AFDA 2FQ1A 2JGPA 2KG6A 2KG8A 3LMOA 3EJBA 5HV8A 2LIUA 3EJEA 2MY5A 3RG2A 1KLPA 4PXHB 2CQ8A 2KGEA 2FADA 3CE7A 2M5RA 1ACPA 2FHSC 2LTEA 4HKGA 2K2QA 2LKIA 2GDYA 2K93A 2X2BA 2FACA 1HY8A 2KOPA 2KOOA 3GZMA 5KP6B 4IZ6A 2KGDA 2L22A 2AFEA 2L0QA 2MVVA 2K0XA 2VSQA 2CNRA 2KORA 5KP8B 2N5IA 1HQBA 2PNGA 2XZ1C 4BPGA 1T8KA 2DNWA 3NY7B 2FQ2A 2MVUA 2FVFA 2GDWA 2LL8A 3EJDA 4CA3A 2MR7A 1X3OA 2FVAA 2KGAA 4H2WC 2JQ4A 2MD9A 2N6ZA 1NQ4A 2KGCA 2EHTA 2ROQA 4BPHA 2AVAA 4BPFA 2JU2A 2K0YA 1DNYA 5KP7B 5CZDB 2CGQA 2K92A 2N5HA 4H2YC 1AF8A 2MF4A 1DV5A 2XZ0D 5HVCA 2LMLA 2QNWA 4PWVB 2N6YA 2KW2A 2FAEA 2L4BA 2FQ0A 4MRTC 2L9FA 2KWLA 2KOQA 2LOLA 2CG5B 4NEOA 1L0HA 2EHSA 2GDXA 4DG9A 2LPKA 2KR5A 2JU1A 2MR8A 2N98A 1F80D 2K94A 2KG9A 4R0MA 2LIWA 3GZLA 2FVEA 2KOSA 1L0IA 2AF8A 2N50A 4H2XC 1OR5A 5EJDA 1VKUA
chains in the Genus database with same CATH superfamily
5HGNA 4IPYA 2KG8A 1Z6MA 3EJBA 3EJEA 3CD6P 2MY5A 3RG2A 2GZEA 4PXHB 2EFJA 1KQSO 1K30A 2M8PA 2FADA 3CE7A 1M6NA 1ACPA 1YJ9P 2K2QA 3DS2A 3CCMP 3G4SP 2CWOA 3HYBA 1JJ2O 1VHNA 3M1MA 2MVVA 2K0XA 3CC7P 1VQNP 3G1GA 5JPAA 2PNGA 3E2DA 3DPHA 2MVUA 2MR7A 3LRYA 2FVAA 3G26A 2M8NA 5BS2A 3HZQA 2EHTA 4BPHA 4GR6A 4BPFA 2JU2A 3DS3A 5BS1A 1E0HA 3H0DA 2VLNA 1DV5A 3G6EP 1ZMBA 5HVCA 2PEOA 1Q86Q 4QNBA 2LF4A 1Q7YQ 3B4QA 2KODA 3G0VA 2L4BA 1RO0A 1D1DA 2JBGA 4NEOA 1L0HA 2GDXA 2XXMA 4COCA 2OTLP 5I4TG 2Z44A 1M90Q 2PENA 2LIWA 4U0DA 2KOSA 1K73Q 2AF8A 4H2XC 5KP6B 1VKUA 1M74A 4QKOA 2FQ1A 2VLPA 5HGLA 1VQLP 3CXCO 2KGEA 1A43A 2M5RA 2VLQA 4HKGA 1GPJA 2JO0A 2GDYA 2GYKA 2K93A 2X2BA 3B5IA 1YI2P 1EMVA 2XT1A 2KOPA 5F2KA 2KOOA 5EW5E 4IZ6A 3CCSP 3DS0A 2VSQA 2CNRA 4XFYA 2DGYA 3H4EA 2VLOA 1HQBA 1T8KA 3NY7B 1BAJA 3EJDA 4CA3A 2M8LA 3G21A 1X3OA 1GXHA 1YITP 1CEIA 2OTJP 2AVAA 2K0YA 1DNYA 3CCQP 5KP7B 4PH0A 3GJNA 5CZDB 1KD1Q 4H2YC 1UNKA 2JYLA 1K9MQ 2XZ0D 2LMLA 2QNWA 4PWVB 3CMAP 1EOQA 3CMEP 2KW2A 3CCJP 2L6EA 2PEIA 2L9FA 1ZNVA 4UHPB 3CPWO 2KOQA 2PEMA 4COPA 2JU1A 2MR8A 3RG6C 3I55P 4XFXA 4XFZA 2K94A 4R0MA 2FVEA 1K8AQ 1L0IA 2N50A 4PH1A 5EJDA 2BUOA 2AFDA 2JGPA 2GZJA 2KG6A 1W2BO 5F2OA 1N8RQ 4F37A 2PY8A 1KLPA 2CQ8A 2E1MA 2Z45A 5HGMA 2LTEA 3MGEA 1Q82Q 1VQMP 3GZMA 2EIAA 2WPTA 2AFEA 2L0QA 1VQ7P 4U0BA 4M0IA 3CCRP 1RNIA 2KORA 1M1KQ 4XROA 4U0FA 5KP8B 3Q20A 4BPGA 2FVFA 1VQ5P 1GXGA 2JYGA 3CC4P 1S72P 4H2WC 2N6ZA 1NQ4A 2ERHA 3VRLC 3DS5A 5HGOA 2KGCA 1YHQP 2CGQA 2N5HA 1AF8A 3I56P 2PEKA 1RO2A 3P05A 1AYIA 2K5XA 1UJZA 2FAEA 3DTJA 1VQOP 3DS1A 3OW2O 5F2NA 2FQ0A 4MRTC 4U0CA 1AUMA 2KWLA 7CEIA 3DS4A 2LOLA 2CG5B 3CC2P 2EHSA 4U0EA 2BHVA 2LPKA 2KR5A 3GKLC 2KG9A 1VQ4P 1IMQA 1OR5A 1IMPA 4U0AA 3LMOA 5HV8A 2LIUA 2P9XA 5DCKA 3CCEP 1A8OA 1NJIQ 4WYMA 2FHSC 3G29A 2OARA 3G71P 2LKIA 1VQ6P 2QEXP 2FACA 1QVGO 1HY8A 2JAZA 1VQ8P 4XRQA 1YJWP 1Q81Q 2KGDA 2L22A 3WBHA 2PEJA 2GZGA 2XV6A 2PEQA 1VQPP 2N5IA 2ONTA 1YJNP 2QA4P 2XZ1C 3NTEA 2DNWA 2FQ2A 2GDWA 2LL8A 1E6JP 2KGAA 2JQ4A 2MD9A 1KC8Q 2ROQA 1VQKP 4GR2A 3G28A 3H47A 1BXIA 3U43A 1VQ9P 2K92A 2MF4A 1YIJP 2GZFA 2K0DX 1M6EX 2N6YA 2JB0A 1QVFO 3CCUP 2Z46A 3CCLP 2GZIA 3CCVP 1EIAA 3G1IA 4DG9A 1QRJA 2N98A 1F80D 1MZ8A 3GZLA 2NO8A 1IUQA 2EG5A 1FR2A
chains in the Genus database with same CATH topology
2AFDA 2FQ1A 2JGPA 2KG6A 2KG8A 3LMOA 3EJBA 5HV8A 2LIUA 3EJEA 2MY5A 3RG2A 1KLPA 4PXHB 2CQ8A 2KGEA 2FADA 3CE7A 2M5RA 1ACPA 2FHSC 2LTEA 4HKGA 2K2QA 2LKIA 2GDYA 2K93A 2X2BA 2FACA 1HY8A 2KOPA 2KOOA 3GZMA 5KP6B 4IZ6A 2KGDA 2L22A 2AFEA 2L0QA 2MVVA 2K0XA 2VSQA 2CNRA 2KORA 5KP8B 2N5IA 1HQBA 2PNGA 2XZ1C 4BPGA 1T8KA 2DNWA 3NY7B 2FQ2A 2MVUA 2FVFA 2GDWA 2LL8A 3EJDA 4CA3A 2MR7A 1X3OA 2FVAA 2KGAA 4H2WC 2JQ4A 2MD9A 2N6ZA 1NQ4A 2KGCA 2EHTA 2ROQA 4BPHA 2AVAA 4BPFA 2JU2A 2K0YA 1DNYA 5KP7B 5CZDB 2CGQA 2K92A 2N5HA 4H2YC 1AF8A 2MF4A 1DV5A 2XZ0D 5HVCA 2LMLA 2QNWA 4PWVB 2N6YA 2KW2A 2FAEA 2L4BA 2FQ0A 4MRTC 2L9FA 2KWLA 2KOQA 2LOLA 2CG5B 4NEOA 1L0HA 2EHSA 2GDXA 4DG9A 2LPKA 2KR5A 2JU1A 2MR8A 2N98A 1F80D 2K94A 2KG9A 4R0MA 2LIWA 3GZLA 2FVEA 2KOSA 1L0IA 2AF8A 2N50A 4H2XC 1OR5A 5EJDA 1VKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFD A;  2FQ1 A;  2JGP A;  2KG6 A;  2KG8 A;  3LMO A;  3EJB A;  5HV8 A;  2LIU A;  3EJE A;  2MY5 A;  3RG2 A;  1KLP A;  4PXH B;  2CQ8 A;  2KGE A;  2FAD A;  3CE7 A;  2M5R A;  1ACP A;  2FHS C;  2LTE A;  4HKG A;  2K2Q A;  2LKI A;  2GDY A;  2K93 A;  2X2B A;  2FAC A;  1HY8 A;  2KOP A;  2KOO A;  3GZM A;  5KP6 B;  4IZ6 A;  2KGD A;  2L22 A;  2AFE A;  2L0Q A;  2MVV A;  2K0X A;  2VSQ A;  2CNR A;  2KOR A;  5KP8 B;  2N5I A;  1HQB A;  2PNG A;  2XZ1 C;  4BPG A;  1T8K A;  2DNW A;  3NY7 B;  2FQ2 A;  2MVU A;  2FVF A;  2GDW A;  2LL8 A;  3EJD A;  4CA3 A;  2MR7 A;  1X3O A;  2FVA A;  2KGA A;  4H2W C;  2JQ4 A;  2MD9 A;  2N6Z A;  1NQ4 A;  2KGC A;  2EHT A;  2ROQ A;  4BPH A;  2AVA A;  4BPF A;  2JU2 A;  2K0Y A;  1DNY A;  5KP7 B;  5CZD B;  2CGQ A;  2K92 A;  2N5H A;  4H2Y C;  1AF8 A;  2MF4 A;  1DV5 A;  2XZ0 D;  5HVC A;  2LML A;  2QNW A;  4PWV B;  2N6Y A;  2KW2 A;  2FAE A;  2L4B A;  2FQ0 A;  4MRT C;  2L9F A;  2KWL A;  2KOQ A;  2LOL A;  2CG5 B;  4NEO A;  1L0H A;  2EHS A;  2GDX A;  4DG9 A;  2LPK A;  2KR5 A;  2JU1 A;  2MR8 A;  2N98 A;  1F80 D;  2K94 A;  2KG9 A;  4R0M A;  2LIW A;  3GZL A;  2FVE A;  2KOS A;  1L0I A;  2AF8 A;  2N50 A;  4H2X C;  1OR5 A;  5EJD A;  1VKU A; 
#chains in the Genus database with same CATH topology
 5HGN A;  4IPY A;  2KG8 A;  1Z6M A;  3EJB A;  3EJE A;  3CD6 P;  2MY5 A;  3RG2 A;  2GZE A;  4PXH B;  2EFJ A;  1KQS O;  1K30 A;  2M8P A;  2FAD A;  3CE7 A;  1M6N A;  1ACP A;  1YJ9 P;  2K2Q A;  3DS2 A;  3CCM P;  3G4S P;  2CWO A;  3HYB A;  1JJ2 O;  1VHN A;  3M1M A;  2MVV A;  2K0X A;  3CC7 P;  1VQN P;  3G1G A;  5JPA A;  2PNG A;  3E2D A;  3DPH A;  2MVU A;  2MR7 A;  3LRY A;  2FVA A;  3G26 A;  2M8N A;  5BS2 A;  3HZQ A;  2EHT A;  4BPH A;  4GR6 A;  4BPF A;  2JU2 A;  3DS3 A;  5BS1 A;  1E0H A;  3H0D A;  2VLN A;  1DV5 A;  3G6E P;  1ZMB A;  5HVC A;  2PEO A;  1Q86 Q;  4QNB A;  2LF4 A;  1Q7Y Q;  3B4Q A;  2KOD A;  3G0V A;  2L4B A;  1RO0 A;  1D1D A;  2JBG A;  4NEO A;  1L0H A;  2GDX A;  2XXM A;  4COC A;  2OTL P;  5I4T G;  2Z44 A;  1M90 Q;  2PEN A;  2LIW A;  4U0D A;  2KOS A;  1K73 Q;  2AF8 A;  4H2X C;  5KP6 B;  1VKU A;  1M74 A;  4QKO A;  2FQ1 A;  2VLP A;  5HGL A;  1VQL P;  3CXC O;  2KGE A;  1A43 A;  2M5R A;  2VLQ A;  4HKG A;  1GPJ A;  2JO0 A;  2GDY A;  2GYK A;  2K93 A;  2X2B A;  3B5I A;  1YI2 P;  1EMV A;  2XT1 A;  2KOP A;  5F2K A;  2KOO A;  5EW5 E;  4IZ6 A;  3CCS P;  3DS0 A;  2VSQ A;  2CNR A;  4XFY A;  2DGY A;  3H4E A;  2VLO A;  1HQB A;  1T8K A;  3NY7 B;  1BAJ A;  3EJD A;  4CA3 A;  2M8L A;  3G21 A;  1X3O A;  1GXH A;  1YIT P;  1CEI A;  2OTJ P;  2AVA A;  2K0Y A;  1DNY A;  3CCQ P;  5KP7 B;  4PH0 A;  3GJN A;  5CZD B;  1KD1 Q;  4H2Y C;  1UNK A;  2JYL A;  1K9M Q;  2XZ0 D;  2LML A;  2QNW A;  4PWV B;  3CMA P;  1EOQ A;  3CME P;  2KW2 A;  3CCJ P;  2L6E A;  2PEI A;  2L9F A;  1ZNV A;  4UHP B;  3CPW O;  2KOQ A;  2PEM A;  4COP A;  2JU1 A;  2MR8 A;  3RG6 C;  3I55 P;  4XFX A;  4XFZ A;  2K94 A;  4R0M A;  2FVE A;  1K8A Q;  1L0I A;  2N50 A;  4PH1 A;  5EJD A;  2BUO A;  2AFD A;  2JGP A;  2GZJ A;  2KG6 A;  1W2B O;  5F2O A;  1N8R Q;  4F37 A;  2PY8 A;  1KLP A;  2CQ8 A;  2E1M A;  2Z45 A;  5HGM A;  2LTE A;  3MGE A;  1Q82 Q;  1VQM P;  3GZM A;  2EIA A;  2WPT A;  2AFE A;  2L0Q A;  1VQ7 P;  4U0B A;  4M0I A;  3CCR P;  1RNI A;  2KOR A;  1M1K Q;  4XRO A;  4U0F A;  5KP8 B;  3Q20 A;  4BPG A;  2FVF A;  1VQ5 P;  1GXG A;  2JYG A;  3CC4 P;  1S72 P;  4H2W C;  2N6Z A;  1NQ4 A;  2ERH A;  3VRL C;  3DS5 A;  5HGO A;  2KGC A;  1YHQ P;  2CGQ A;  2N5H A;  1AF8 A;  3I56 P;  2PEK A;  1RO2 A;  3P05 A;  1AYI A;  2K5X A;  1UJZ A;  2FAE A;  3DTJ A;  1VQO P;  3DS1 A;  3OW2 O;  5F2N A;  2FQ0 A;  4MRT C;  4U0C A;  1AUM A;  2KWL A;  7CEI A;  3DS4 A;  2LOL A;  2CG5 B;  3CC2 P;  2EHS A;  4U0E A;  2BHV A;  2LPK A;  2KR5 A;  3GKL C;  2KG9 A;  1VQ4 P;  1IMQ A;  1OR5 A;  1IMP A;  4U0A A;  3LMO A;  5HV8 A;  2LIU A;  2P9X A;  5DCK A;  3CCE P;  1A8O A;  1NJI Q;  4WYM A;  2FHS C;  3G29 A;  2OAR A;  3G71 P;  2LKI A;  1VQ6 P;  2QEX P;  2FAC A;  1QVG O;  1HY8 A;  2JAZ A;  1VQ8 P;  4XRQ A;  1YJW P;  1Q81 Q;  2KGD A;  2L22 A;  3WBH A;  2PEJ A;  2GZG A;  2XV6 A;  2PEQ A;  1VQP P;  2N5I A;  2ONT A;  1YJN P;  2QA4 P;  2XZ1 C;  3NTE A;  2DNW A;  2FQ2 A;  2GDW A;  2LL8 A;  1E6J P;  2KGA A;  2JQ4 A;  2MD9 A;  1KC8 Q;  2ROQ A;  1VQK P;  4GR2 A;  3G28 A;  3H47 A;  1BXI A;  3U43 A;  1VQ9 P;  2K92 A;  2MF4 A;  1YIJ P;  2GZF A;  2K0D X;  1M6E X;  2N6Y A;  2JB0 A;  1QVF O;  3CCU P;  2Z46 A;  3CCL P;  2GZI A;  3CCV P;  1EIA A;  3G1I A;  4DG9 A;  1QRJ A;  2N98 A;  1F80 D;  1MZ8 A;  3GZL A;  2NO8 A;  1IUQ A;  2EG5 A;  1FR2 A; 
#chains in the Genus database with same CATH homology
 2AFD A;  2FQ1 A;  2JGP A;  2KG6 A;  2KG8 A;  3LMO A;  3EJB A;  5HV8 A;  2LIU A;  3EJE A;  2MY5 A;  3RG2 A;  1KLP A;  4PXH B;  2CQ8 A;  2KGE A;  2FAD A;  3CE7 A;  2M5R A;  1ACP A;  2FHS C;  2LTE A;  4HKG A;  2K2Q A;  2LKI A;  2GDY A;  2K93 A;  2X2B A;  2FAC A;  1HY8 A;  2KOP A;  2KOO A;  3GZM A;  5KP6 B;  4IZ6 A;  2KGD A;  2L22 A;  2AFE A;  2L0Q A;  2MVV A;  2K0X A;  2VSQ A;  2CNR A;  2KOR A;  5KP8 B;  2N5I A;  1HQB A;  2PNG A;  2XZ1 C;  4BPG A;  1T8K A;  2DNW A;  3NY7 B;  2FQ2 A;  2MVU A;  2FVF A;  2GDW A;  2LL8 A;  3EJD A;  4CA3 A;  2MR7 A;  1X3O A;  2FVA A;  2KGA A;  4H2W C;  2JQ4 A;  2MD9 A;  2N6Z A;  1NQ4 A;  2KGC A;  2EHT A;  2ROQ A;  4BPH A;  2AVA A;  4BPF A;  2JU2 A;  2K0Y A;  1DNY A;  5KP7 B;  5CZD B;  2CGQ A;  2K92 A;  2N5H A;  4H2Y C;  1AF8 A;  2MF4 A;  1DV5 A;  2XZ0 D;  5HVC A;  2LML A;  2QNW A;  4PWV B;  2N6Y A;  2KW2 A;  2FAE A;  2L4B A;  2FQ0 A;  4MRT C;  2L9F A;  2KWL A;  2KOQ A;  2LOL A;  2CG5 B;  4NEO A;  1L0H A;  2EHS A;  2GDX A;  4DG9 A;  2LPK A;  2KR5 A;  2JU1 A;  2MR8 A;  2N98 A;  1F80 D;  2K94 A;  2KG9 A;  4R0M A;  2LIW A;  3GZL A;  2FVE A;  2KOS A;  1L0I A;  2AF8 A;  2N50 A;  4H2X C;  1OR5 A;  5EJD A;  1VKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...