1DV5A

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords APO-D-ALANYL CARRIER PROTEIN
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dv5A00
4NEOA 1DV5A 2GDYA 2L4BA 2ROQA 2KOQA 2FAEA 4H2WC 2JU1A 2L9FA 2LOLA 2K2QA 2M5RA 2XZ0D 4R0MA 5KP6B 4H2XC 2LIWA 2FQ1A 2K93A 2VSQA 2K92A 2XZ1C 1AF8A 2CNRA 1T8KA 2MD9A 2DNWA 2KG8A 2K94A 2AFDA 2L0QA 1NQ4A 2N98A 2K0XA 2KG9A 2GDWA 2CG5B 1L0HA 2CQ8A 2JU2A 5CZDB 4DG9A 2KORA 2KG6A 2FVFA 2FHSC 4H2YC 1HY8A 4MRTC 2FQ2A 2CGQA 2KR5A 1VKUA 1HQBA 1X3OA 1F80D 2LIUA 2N5IA 2X2BA 5HV8A 2MVVA 5KP7B 5HVCA 2EHSA 3EJBA 2KOOA 2LPKA 2KGAA 2MR7A 3GZMA 4CA3A 1L0IA 1OR5A 2K0YA 3CE7A 2AVAA 2FADA 2GDXA 2KGEA 2MF4A 4PXHB 2LKIA 2LL8A 2LTEA 5KP8B 3EJDA 1KLPA 3RG2A 2KGCA 4BPGA 2FQ0A 2MY5A 2N5HA 2KWLA 4PWVB 2N6ZA 2FVAA 2PNGA 2N50A 2EHTA 2KOSA 2L22A 3LMOA 2MR8A 2AF8A 2QNWA 2KGDA 3NY7B 4HKGA 4BPHA 2JGPA 2FACA 2KOPA 2FVEA 1DNYA 2LMLA 2AFEA 2KW2A 1ACPA 2MVUA 2JQ4A 3EJEA 5EJDA 4BPFA 4IZ6A 2N6YA 3GZLA
chains in the Genus database with same CATH superfamily
1GXGA 2QEXP 2JB0A 2FAEA 2LOLA 2M5RA 2XZ0D 4PH1A 2Z46A 2LIWA 1YI2P 1M90Q 3RG6C 2XXMA 1T8KA 1Q86Q 1YIJP 2MD9A 1YJNP 2K94A 3CCQP 1IMPA 2K0XA 3G4SP 1IUQA 1GPJA 2CG5B 2ERHA 3NTEA 5CZDB 3GKLC 2FHSC 3OW2O 1M6EX 2FQ2A 1VKUA 2LIUA 1VQ4P 1Q7YQ 3GZMA 3U43A 4CA3A 1YHQP 4QKOA 1A43A 1BXIA 5BS2A 1S72P 2L6EA 2KGEA 1VQ5P 1AYIA 1M6NA 2K0DX 3WBHA 2FQ0A 2MY5A 2KWLA 4XFZA 2N6ZA 2ONTA 2PEJA 2Z45A 2GZEA 1E0HA 3P05A 1KQSO 5HGLA 4XFYA 1A8OA 3DTJA 2MR8A 3NY7B 2OARA 3H47A 1K73Q 2KOPA 2FVEA 3CC4P 3DPHA 5F2KA 2KODA 2VLOA 2JQ4A 4IZ6A 2K5XA 3H4EA 2GDYA 2ROQA 1NJIQ 2KOQA 2L9FA 3G26A 2K2QA 1VQ9P 2K92A 1AF8A 2JBGA 3G28A 3CCJP 3G0VA 2OTJP 2AFDA 1NQ4A 2LF4A 2GDWA 1K8AQ 3CCVP 2CQ8A 2JU2A 3H0DA 5HGOA 2FVFA 3CCUP 1HY8A 2KR5A 1IMQA 4COPA 3I55P 1F80D 2XV6A 3B5IA 2PEQA 2M8LA 2X2BA 1RNIA 5KP7B 2MVVA 4PH0A 5HVCA 2EHSA 3I56P 3G71P 3EJBA 2KOOA 5JPAA 4F37A 1OR5A 3CXCO 3CE7A 1KC8Q 1JJ2O 3DS5A 2FADA 4U0BA 3CPWO 4PXHB 1BAJA 5KP8B 4BPGA 5F2NA 2N5HA 4PWVB 1D1DA 2FVAA 2GYKA 1VQKP 2EHTA 4U0FA 3G1GA 2P9XA 3LMOA 3LRYA 3CCRP 2E1MA 3E2DA 4UHPB 2AF8A 4U0EA 1UJZA 2GZGA 1N8RQ 2FACA 3DS2A 1EIAA 2LMLA 2JYGA 2KW2A 1VHNA 4XROA 3GJNA 5EJDA 2N6YA 2JO0A 3GZLA 2VLNA 2L4BA 2OTLP 2PEIA 4H2WC 2JU1A 3CCEP 2K93A 3G29A 4GR6A 1CEIA 5EW5E 2XZ1C 1W2BO 1RO0A 2KG8A 4U0AA 5HGNA 2GZJA 2L0QA 1YITP 3CC7P 1EMVA 3HZQA 2PEKA 3MGEA 1L0HA 1K30A 1GXHA 4MRTC 1VQ8P 1ZNVA 1HQBA 1X3OA 5HV8A 1Q81Q 2M8PA 1VQOP 1EOQA 2KGAA 5I4TG 2PY8A 5DCKA 3DS1A 3CC2P 2K0YA 3B4QA 2GDXA 3VRLC 1QVFO 2LKIA 1MZ8A 2GZFA 2LL8A 2LTEA 3RG2A 1QRJA 2JAZA 2PNGA 3CMAP 1VQMP 1VQLP 1VQ6P 2Z44A 1M74A 1UNKA 3CCMP 3CMEP 1VQPP 3CCSP 4HKGA 3DS3A 1VQ7P 1Q82Q 7CEIA 4XFXA 3Q20A 2VLQA 4BPFA 1AUMA 3G6EP 4NEOA 1DV5A 4WYMA 2BUOA 4R0MA 5KP6B 4H2XC 4U0DA 2FQ1A 2VSQA 2NO8A 1VQNP 2CNRA 3G21A 2DNWA 2EG5A 2VLPA 4U0CA 4GR2A 4COCA 2PEOA 2N98A 1E6JP 1QVGO 2KG9A 2M8NA 1K9MQ 4DG9A 3DS0A 2KORA 2KG6A 2CWOA 3M1MA 4H2YC 5HGMA 2CGQA 2GZIA 2BHVA 3CD6P 2N5IA 2EFJA 4IPYA 2LPKA 2XT1A 2MR7A 4QNBA 1L0IA 2AVAA 2JYLA 5F2OA 1M1KQ 3HYBA 4XRQA 2MF4A 2DGYA 1KD1Q 3EJDA 1KLPA 3DS4A 1YJWP 2KGCA 2EIAA 5BS1A 3G1IA 1YJ9P 2N50A 2KOSA 2L22A 4M0IA 2PENA 1ZMBA 2QNWA 2KGDA 3CCLP 1Z6MA 1RO2A 1FR2A 4BPHA 2JGPA 2PEMA 1DNYA 2AFEA 2QA4P 1ACPA 2MVUA 3EJEA 2WPTA
chains in the Genus database with same CATH topology
4NEOA 1DV5A 2GDYA 2L4BA 2ROQA 2KOQA 2FAEA 4H2WC 2JU1A 2L9FA 2LOLA 2K2QA 2M5RA 2XZ0D 4R0MA 5KP6B 4H2XC 2LIWA 2FQ1A 2K93A 2VSQA 2K92A 2XZ1C 1AF8A 2CNRA 1T8KA 2MD9A 2DNWA 2KG8A 2K94A 2AFDA 2L0QA 1NQ4A 2N98A 2K0XA 2KG9A 2GDWA 2CG5B 1L0HA 2CQ8A 2JU2A 5CZDB 4DG9A 2KORA 2KG6A 2FVFA 2FHSC 4H2YC 1HY8A 4MRTC 2FQ2A 2CGQA 2KR5A 1VKUA 1HQBA 1X3OA 1F80D 2LIUA 2N5IA 2X2BA 5HV8A 2MVVA 5KP7B 5HVCA 2EHSA 3EJBA 2KOOA 2LPKA 2KGAA 2MR7A 3GZMA 4CA3A 1L0IA 1OR5A 2K0YA 3CE7A 2AVAA 2FADA 2GDXA 2KGEA 2MF4A 4PXHB 2LKIA 2LL8A 2LTEA 5KP8B 3EJDA 1KLPA 3RG2A 2KGCA 4BPGA 2FQ0A 2MY5A 2N5HA 2KWLA 4PWVB 2N6ZA 2FVAA 2PNGA 2N50A 2EHTA 2KOSA 2L22A 3LMOA 2MR8A 2AF8A 2QNWA 2KGDA 3NY7B 4HKGA 4BPHA 2JGPA 2FACA 2KOPA 2FVEA 1DNYA 2LMLA 2AFEA 2KW2A 1ACPA 2MVUA 2JQ4A 3EJEA 5EJDA 4BPFA 4IZ6A 2N6YA 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEO A;  1DV5 A;  2GDY A;  2L4B A;  2ROQ A;  2KOQ A;  2FAE A;  4H2W C;  2JU1 A;  2L9F A;  2LOL A;  2K2Q A;  2M5R A;  2XZ0 D;  4R0M A;  5KP6 B;  4H2X C;  2LIW A;  2FQ1 A;  2K93 A;  2VSQ A;  2K92 A;  2XZ1 C;  1AF8 A;  2CNR A;  1T8K A;  2MD9 A;  2DNW A;  2KG8 A;  2K94 A;  2AFD A;  2L0Q A;  1NQ4 A;  2N98 A;  2K0X A;  2KG9 A;  2GDW A;  2CG5 B;  1L0H A;  2CQ8 A;  2JU2 A;  5CZD B;  4DG9 A;  2KOR A;  2KG6 A;  2FVF A;  2FHS C;  4H2Y C;  1HY8 A;  4MRT C;  2FQ2 A;  2CGQ A;  2KR5 A;  1VKU A;  1HQB A;  1X3O A;  1F80 D;  2LIU A;  2N5I A;  2X2B A;  5HV8 A;  2MVV A;  5KP7 B;  5HVC A;  2EHS A;  3EJB A;  2KOO A;  2LPK A;  2KGA A;  2MR7 A;  3GZM A;  4CA3 A;  1L0I A;  1OR5 A;  2K0Y A;  3CE7 A;  2AVA A;  2FAD A;  2GDX A;  2KGE A;  2MF4 A;  4PXH B;  2LKI A;  2LL8 A;  2LTE A;  5KP8 B;  3EJD A;  1KLP A;  3RG2 A;  2KGC A;  4BPG A;  2FQ0 A;  2MY5 A;  2N5H A;  2KWL A;  4PWV B;  2N6Z A;  2FVA A;  2PNG A;  2N50 A;  2EHT A;  2KOS A;  2L22 A;  3LMO A;  2MR8 A;  2AF8 A;  2QNW A;  2KGD A;  3NY7 B;  4HKG A;  4BPH A;  2JGP A;  2FAC A;  2KOP A;  2FVE A;  1DNY A;  2LML A;  2AFE A;  2KW2 A;  1ACP A;  2MVU A;  2JQ4 A;  3EJE A;  5EJD A;  4BPF A;  4IZ6 A;  2N6Y A;  3GZL A; 
#chains in the Genus database with same CATH topology
 1GXG A;  2QEX P;  2JB0 A;  2FAE A;  2LOL A;  2M5R A;  2XZ0 D;  4PH1 A;  2Z46 A;  2LIW A;  1YI2 P;  1M90 Q;  3RG6 C;  2XXM A;  1T8K A;  1Q86 Q;  1YIJ P;  2MD9 A;  1YJN P;  2K94 A;  3CCQ P;  1IMP A;  2K0X A;  3G4S P;  1IUQ A;  1GPJ A;  2CG5 B;  2ERH A;  3NTE A;  5CZD B;  3GKL C;  2FHS C;  3OW2 O;  1M6E X;  2FQ2 A;  1VKU A;  2LIU A;  1VQ4 P;  1Q7Y Q;  3GZM A;  3U43 A;  4CA3 A;  1YHQ P;  4QKO A;  1A43 A;  1BXI A;  5BS2 A;  1S72 P;  2L6E A;  2KGE A;  1VQ5 P;  1AYI A;  1M6N A;  2K0D X;  3WBH A;  2FQ0 A;  2MY5 A;  2KWL A;  4XFZ A;  2N6Z A;  2ONT A;  2PEJ A;  2Z45 A;  2GZE A;  1E0H A;  3P05 A;  1KQS O;  5HGL A;  4XFY A;  1A8O A;  3DTJ A;  2MR8 A;  3NY7 B;  2OAR A;  3H47 A;  1K73 Q;  2KOP A;  2FVE A;  3CC4 P;  3DPH A;  5F2K A;  2KOD A;  2VLO A;  2JQ4 A;  4IZ6 A;  2K5X A;  3H4E A;  2GDY A;  2ROQ A;  1NJI Q;  2KOQ A;  2L9F A;  3G26 A;  2K2Q A;  1VQ9 P;  2K92 A;  1AF8 A;  2JBG A;  3G28 A;  3CCJ P;  3G0V A;  2OTJ P;  2AFD A;  1NQ4 A;  2LF4 A;  2GDW A;  1K8A Q;  3CCV P;  2CQ8 A;  2JU2 A;  3H0D A;  5HGO A;  2FVF A;  3CCU P;  1HY8 A;  2KR5 A;  1IMQ A;  4COP A;  3I55 P;  1F80 D;  2XV6 A;  3B5I A;  2PEQ A;  2M8L A;  2X2B A;  1RNI A;  5KP7 B;  2MVV A;  4PH0 A;  5HVC A;  2EHS A;  3I56 P;  3G71 P;  3EJB A;  2KOO A;  5JPA A;  4F37 A;  1OR5 A;  3CXC O;  3CE7 A;  1KC8 Q;  1JJ2 O;  3DS5 A;  2FAD A;  4U0B A;  3CPW O;  4PXH B;  1BAJ A;  5KP8 B;  4BPG A;  5F2N A;  2N5H A;  4PWV B;  1D1D A;  2FVA A;  2GYK A;  1VQK P;  2EHT A;  4U0F A;  3G1G A;  2P9X A;  3LMO A;  3LRY A;  3CCR P;  2E1M A;  3E2D A;  4UHP B;  2AF8 A;  4U0E A;  1UJZ A;  2GZG A;  1N8R Q;  2FAC A;  3DS2 A;  1EIA A;  2LML A;  2JYG A;  2KW2 A;  1VHN A;  4XRO A;  3GJN A;  5EJD A;  2N6Y A;  2JO0 A;  3GZL A;  2VLN A;  2L4B A;  2OTL P;  2PEI A;  4H2W C;  2JU1 A;  3CCE P;  2K93 A;  3G29 A;  4GR6 A;  1CEI A;  5EW5 E;  2XZ1 C;  1W2B O;  1RO0 A;  2KG8 A;  4U0A A;  5HGN A;  2GZJ A;  2L0Q A;  1YIT P;  3CC7 P;  1EMV A;  3HZQ A;  2PEK A;  3MGE A;  1L0H A;  1K30 A;  1GXH A;  4MRT C;  1VQ8 P;  1ZNV A;  1HQB A;  1X3O A;  5HV8 A;  1Q81 Q;  2M8P A;  1VQO P;  1EOQ A;  2KGA A;  5I4T G;  2PY8 A;  5DCK A;  3DS1 A;  3CC2 P;  2K0Y A;  3B4Q A;  2GDX A;  3VRL C;  1QVF O;  2LKI A;  1MZ8 A;  2GZF A;  2LL8 A;  2LTE A;  3RG2 A;  1QRJ A;  2JAZ A;  2PNG A;  3CMA P;  1VQM P;  1VQL P;  1VQ6 P;  2Z44 A;  1M74 A;  1UNK A;  3CCM P;  3CME P;  1VQP P;  3CCS P;  4HKG A;  3DS3 A;  1VQ7 P;  1Q82 Q;  7CEI A;  4XFX A;  3Q20 A;  2VLQ A;  4BPF A;  1AUM A;  3G6E P;  4NEO A;  1DV5 A;  4WYM A;  2BUO A;  4R0M A;  5KP6 B;  4H2X C;  4U0D A;  2FQ1 A;  2VSQ A;  2NO8 A;  1VQN P;  2CNR A;  3G21 A;  2DNW A;  2EG5 A;  2VLP A;  4U0C A;  4GR2 A;  4COC A;  2PEO A;  2N98 A;  1E6J P;  1QVG O;  2KG9 A;  2M8N A;  1K9M Q;  4DG9 A;  3DS0 A;  2KOR A;  2KG6 A;  2CWO A;  3M1M A;  4H2Y C;  5HGM A;  2CGQ A;  2GZI A;  2BHV A;  3CD6 P;  2N5I A;  2EFJ A;  4IPY A;  2LPK A;  2XT1 A;  2MR7 A;  4QNB A;  1L0I A;  2AVA A;  2JYL A;  5F2O A;  1M1K Q;  3HYB A;  4XRQ A;  2MF4 A;  2DGY A;  1KD1 Q;  3EJD A;  1KLP A;  3DS4 A;  1YJW P;  2KGC A;  2EIA A;  5BS1 A;  3G1I A;  1YJ9 P;  2N50 A;  2KOS A;  2L22 A;  4M0I A;  2PEN A;  1ZMB A;  2QNW A;  2KGD A;  3CCL P;  1Z6M A;  1RO2 A;  1FR2 A;  4BPH A;  2JGP A;  2PEM A;  1DNY A;  2AFE A;  2QA4 P;  1ACP A;  2MVU A;  3EJE A;  2WPT A; 
#chains in the Genus database with same CATH homology
 4NEO A;  1DV5 A;  2GDY A;  2L4B A;  2ROQ A;  2KOQ A;  2FAE A;  4H2W C;  2JU1 A;  2L9F A;  2LOL A;  2K2Q A;  2M5R A;  2XZ0 D;  4R0M A;  5KP6 B;  4H2X C;  2LIW A;  2FQ1 A;  2K93 A;  2VSQ A;  2K92 A;  2XZ1 C;  1AF8 A;  2CNR A;  1T8K A;  2MD9 A;  2DNW A;  2KG8 A;  2K94 A;  2AFD A;  2L0Q A;  1NQ4 A;  2N98 A;  2K0X A;  2KG9 A;  2GDW A;  2CG5 B;  1L0H A;  2CQ8 A;  2JU2 A;  5CZD B;  4DG9 A;  2KOR A;  2KG6 A;  2FVF A;  2FHS C;  4H2Y C;  1HY8 A;  4MRT C;  2FQ2 A;  2CGQ A;  2KR5 A;  1VKU A;  1HQB A;  1X3O A;  1F80 D;  2LIU A;  2N5I A;  2X2B A;  5HV8 A;  2MVV A;  5KP7 B;  5HVC A;  2EHS A;  3EJB A;  2KOO A;  2LPK A;  2KGA A;  2MR7 A;  3GZM A;  4CA3 A;  1L0I A;  1OR5 A;  2K0Y A;  3CE7 A;  2AVA A;  2FAD A;  2GDX A;  2KGE A;  2MF4 A;  4PXH B;  2LKI A;  2LL8 A;  2LTE A;  5KP8 B;  3EJD A;  1KLP A;  3RG2 A;  2KGC A;  4BPG A;  2FQ0 A;  2MY5 A;  2N5H A;  2KWL A;  4PWV B;  2N6Z A;  2FVA A;  2PNG A;  2N50 A;  2EHT A;  2KOS A;  2L22 A;  3LMO A;  2MR8 A;  2AF8 A;  2QNW A;  2KGD A;  3NY7 B;  4HKG A;  4BPH A;  2JGP A;  2FAC A;  2KOP A;  2FVE A;  1DNY A;  2LML A;  2AFE A;  2KW2 A;  1ACP A;  2MVU A;  2JQ4 A;  3EJE A;  5EJD A;  4BPF A;  4IZ6 A;  2N6Y A;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...