1HQBA

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords APO-D-ALANYL CARRIER PROTEIN
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hqbA00
2FAEA 2LIWA 1F80D 2KORA 2L4BA 2N5IA 2FVFA 2DNWA 2MVVA 1DV5A 2K94A 5CZDB 2MD9A 4CA3A 2N98A 2CG5B 2VSQA 1L0IA 1X3OA 2QNWA 2CNRA 2M5RA 2KOSA 1NQ4A 2JQ4A 2KR5A 2XZ0D 1HY8A 2KGEA 2AF8A 2AFEA 2FVAA 2L22A 1HQBA 1AF8A 2AVAA 2GDYA 2MR8A 2GDXA 2K92A 2ROQA 1DNYA 2K0YA 2LOLA 2KGDA 2MR7A 2KGAA 4HKGA 2N50A 2FADA 3EJDA 2KG9A 4NEOA 4BPGA 2EHTA 4BPHA 2KG6A 3NY7B 2K0XA 2PNGA 4IZ6A 5HVCA 3EJEA 2K2QA 2N6ZA 1VKUA 5KP6B 2KW2A 2JU1A 2KOQA 4MRTC 1KLPA 2XZ1C 2LTEA 4H2XC 2LMLA 5KP8B 2LL8A 2FVEA 2EHSA 2KOOA 2L0QA 2MVUA 3GZMA 2KWLA 1ACPA 4PWVB 3EJBA 4R0MA 3GZLA 2L9FA 2MY5A 2KGCA 5HV8A 3CE7A 4PXHB 2FQ0A 2KG8A 4DG9A 2FQ2A 1T8KA 2FACA 2X2BA 2GDWA 2CGQA 2MF4A 2LKIA 2LIUA 1L0HA 2FQ1A 2CQ8A 2FHSC 1OR5A 2N6YA 4BPFA 2LPKA 2N5HA 2KOPA 5KP7B 3LMOA 4H2YC 4H2WC 5EJDA 3RG2A 2JGPA 2JU2A 2AFDA 2K93A
chains in the Genus database with same CATH superfamily
3DS1A 1MZ8A 1QRJA 2JYLA 2KORA 1GXHA 2L6EA 3E2DA 2VLQA 1VQ6P 1Q82Q 1NJIQ 1X3OA 1GPJA 5F2KA 1NQ4A 2KR5A 2KGEA 1Q86Q 2FVAA 2L22A 4U0DA 7CEIA 3H0DA 1AF8A 2GDYA 2GDXA 2K92A 2K0DX 2ROQA 1DNYA 1VQNP 1VQ5P 1N8RQ 4BPGA 2VLOA 2PNGA 3MGEA 3CCMP 1VKUA 4XFYA 1KLPA 2M8NA 1RNIA 2DGYA 3GZMA 5BS2A 4XRQA 2JBGA 1ZNVA 3CCJP 3EJBA 4DG9A 1IUQA 1BXIA 1GXGA 2MF4A 3U43A 1L0HA 3DPHA 1VQKP 1K8AQ 3G6EP 1YHQP 2N5HA 2KOPA 4H2YC 1YJ9P 3DS3A 5DCKA 2JU2A 1M1KQ 2JYGA 2FAEA 4IPYA 2VLPA 2L4BA 1DV5A 1W2BO 3I55P 2Z45A 4PH0A 3DS2A 4CA3A 2N98A 3G0VA 2VSQA 2QNWA 2LF4A 2M5RA 3Q20A 3DS5A 3P05A 2BUOA 1RO2A 2AF8A 2JO0A 1YIJP 2PEMA 3NTEA 2MR8A 4WYMA 2K0YA 1RO0A 2KGDA 2MR7A 4HKGA 2P9XA 2M8LA 2FADA 4PH1A 2KG9A 1KQSO 2QEXP 2KG6A 1CEIA 2K0XA 1FR2A 2N6ZA 2JU1A 2PEOA 2XZ1C 4H2XC 2LMLA 2KWLA 3G26A 4PWVB 2BHVA 3DS0A 1Q81Q 4F37A 5F2OA 3CE7A 2KG8A 2GZEA 2E1MA 3CC4P 2GDWA 2OARA 3H4EA 1Q7YQ 3CXCO 1AYIA 1OR5A 1BAJA 3HZQA 3OW2O 2N6YA 4BPFA 2LPKA 5KP7B 2ERHA 1VHNA 4U0FA 1VQPP 4H2WC 5F2NA 2AFDA 3CCSP 3CCUP 3CCVP 4UHPB 4U0EA 2N5IA 2FVFA 3G1GA 1VQLP 3LRYA 4XROA 3CCEP 2EIAA 1YJNP 5CZDB 4U0CA 2QA4P 2PEJA 1YI2P 2KODA 1L0IA 3M1MA 2OTLP 2CWOA 1KC8Q 2KOSA 3CCLP 1VQOP 2XZ0D 4U0BA 4GR2A 2AFEA 1HQBA 2VLNA 3G28A 1VQ8P 3DTJA 2LOLA 2N50A 3EJDA 4NEOA 4QNBA 1VQ7P 3B4QA 5I4TG 3NY7B 1D1DA 1A8OA 4COCA 2K2QA 1VQMP 5HGOA 2GYKA 2KOQA 1VQ9P 2GZIA 3DS4A 1IMQA 1YITP 2LL8A 2FVEA 2KOOA 2L0QA 2MVUA 2ONTA 1QVFO 2EG5A 3CC2P 2L9FA 1K73Q 2K5XA 5HV8A 3H47A 1S72P 1T8KA 2CGQA 2XXMA 1JJ2O 2LKIA 1M6EX 2FHSC 5BS1A 5JPAA 1EOQA 2PEQA 1IMPA 4XFZA 1QVGO 3RG2A 3CMEP 2K93A 2NO8A 3CMAP 2WPTA 3CCQP 2LIWA 1F80D 2DNWA 2MVVA 2PENA 2PY8A 1YJWP 3B5IA 1M6NA 2K94A 2MD9A 2CG5B 3G21A 3G29A 3G1IA 2CNRA 3G71P 2JQ4A 1M74A 1HY8A 5EW5E 3RG6C 4M0IA 5HGLA 3GJNA 4U0AA 1Z6MA 2AVAA 3I56P 1K9MQ 5HGMA 2KGAA 3CCRP 2EHTA 4BPHA 1VQ4P 1E6JP 4XFXA 4IZ6A 5HVCA 3EJEA 2EFJA 1KD1Q 5HGNA 1EIAA 3WBHA 2GZGA 5KP6B 2KW2A 4MRTC 3HYBA 1E0HA 2LTEA 3GKLC 5KP8B 2EHSA 2GZFA 2GZJA 2PEKA 2M8PA 2PEIA 3CD6P 1ACPA 4R0MA 2Z44A 3GZLA 2JAZA 2MY5A 2KGCA 1K30A 4PXHB 2FQ0A 1AUMA 4COPA 2FQ2A 2FACA 2X2BA 2OTJP 2Z46A 3VRLC 2LIUA 2XV6A 1A43A 1UNKA 1UJZA 2FQ1A 2CQ8A 4QKOA 4GR6A 3CPWO 1ZMBA 3CC7P 3LMOA 2XT1A 3G4SP 5EJDA 2JB0A 2JGPA 1M90Q 1EMVA
chains in the Genus database with same CATH topology
2FAEA 2LIWA 1F80D 2KORA 2L4BA 2N5IA 2FVFA 2DNWA 2MVVA 1DV5A 2K94A 5CZDB 2MD9A 4CA3A 2N98A 2CG5B 2VSQA 1L0IA 1X3OA 2QNWA 2CNRA 2M5RA 2KOSA 1NQ4A 2JQ4A 2KR5A 2XZ0D 1HY8A 2KGEA 2AF8A 2AFEA 2FVAA 2L22A 1HQBA 1AF8A 2AVAA 2GDYA 2MR8A 2GDXA 2K92A 2ROQA 1DNYA 2K0YA 2LOLA 2KGDA 2MR7A 2KGAA 4HKGA 2N50A 2FADA 3EJDA 2KG9A 4NEOA 4BPGA 2EHTA 4BPHA 2KG6A 3NY7B 2K0XA 2PNGA 4IZ6A 5HVCA 3EJEA 2K2QA 2N6ZA 1VKUA 5KP6B 2KW2A 2JU1A 2KOQA 4MRTC 1KLPA 2XZ1C 2LTEA 4H2XC 2LMLA 5KP8B 2LL8A 2FVEA 2EHSA 2KOOA 2L0QA 2MVUA 3GZMA 2KWLA 1ACPA 4PWVB 3EJBA 4R0MA 3GZLA 2L9FA 2MY5A 2KGCA 5HV8A 3CE7A 4PXHB 2FQ0A 2KG8A 4DG9A 2FQ2A 1T8KA 2FACA 2X2BA 2GDWA 2CGQA 2MF4A 2LKIA 2LIUA 1L0HA 2FQ1A 2CQ8A 2FHSC 1OR5A 2N6YA 4BPFA 2LPKA 2N5HA 2KOPA 5KP7B 3LMOA 4H2YC 4H2WC 5EJDA 3RG2A 2JGPA 2JU2A 2AFDA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  2LIW A;  1F80 D;  2KOR A;  2L4B A;  2N5I A;  2FVF A;  2DNW A;  2MVV A;  1DV5 A;  2K94 A;  5CZD B;  2MD9 A;  4CA3 A;  2N98 A;  2CG5 B;  2VSQ A;  1L0I A;  1X3O A;  2QNW A;  2CNR A;  2M5R A;  2KOS A;  1NQ4 A;  2JQ4 A;  2KR5 A;  2XZ0 D;  1HY8 A;  2KGE A;  2AF8 A;  2AFE A;  2FVA A;  2L22 A;  1HQB A;  1AF8 A;  2AVA A;  2GDY A;  2MR8 A;  2GDX A;  2K92 A;  2ROQ A;  1DNY A;  2K0Y A;  2LOL A;  2KGD A;  2MR7 A;  2KGA A;  4HKG A;  2N50 A;  2FAD A;  3EJD A;  2KG9 A;  4NEO A;  4BPG A;  2EHT A;  4BPH A;  2KG6 A;  3NY7 B;  2K0X A;  2PNG A;  4IZ6 A;  5HVC A;  3EJE A;  2K2Q A;  2N6Z A;  1VKU A;  5KP6 B;  2KW2 A;  2JU1 A;  2KOQ A;  4MRT C;  1KLP A;  2XZ1 C;  2LTE A;  4H2X C;  2LML A;  5KP8 B;  2LL8 A;  2FVE A;  2EHS A;  2KOO A;  2L0Q A;  2MVU A;  3GZM A;  2KWL A;  1ACP A;  4PWV B;  3EJB A;  4R0M A;  3GZL A;  2L9F A;  2MY5 A;  2KGC A;  5HV8 A;  3CE7 A;  4PXH B;  2FQ0 A;  2KG8 A;  4DG9 A;  2FQ2 A;  1T8K A;  2FAC A;  2X2B A;  2GDW A;  2CGQ A;  2MF4 A;  2LKI A;  2LIU A;  1L0H A;  2FQ1 A;  2CQ8 A;  2FHS C;  1OR5 A;  2N6Y A;  4BPF A;  2LPK A;  2N5H A;  2KOP A;  5KP7 B;  3LMO A;  4H2Y C;  4H2W C;  5EJD A;  3RG2 A;  2JGP A;  2JU2 A;  2AFD A;  2K93 A; 
#chains in the Genus database with same CATH topology
 3DS1 A;  1MZ8 A;  1QRJ A;  2JYL A;  2KOR A;  1GXH A;  2L6E A;  3E2D A;  2VLQ A;  1VQ6 P;  1Q82 Q;  1NJI Q;  1X3O A;  1GPJ A;  5F2K A;  1NQ4 A;  2KR5 A;  2KGE A;  1Q86 Q;  2FVA A;  2L22 A;  4U0D A;  7CEI A;  3H0D A;  1AF8 A;  2GDY A;  2GDX A;  2K92 A;  2K0D X;  2ROQ A;  1DNY A;  1VQN P;  1VQ5 P;  1N8R Q;  4BPG A;  2VLO A;  2PNG A;  3MGE A;  3CCM P;  1VKU A;  4XFY A;  1KLP A;  2M8N A;  1RNI A;  2DGY A;  3GZM A;  5BS2 A;  4XRQ A;  2JBG A;  1ZNV A;  3CCJ P;  3EJB A;  4DG9 A;  1IUQ A;  1BXI A;  1GXG A;  2MF4 A;  3U43 A;  1L0H A;  3DPH A;  1VQK P;  1K8A Q;  3G6E P;  1YHQ P;  2N5H A;  2KOP A;  4H2Y C;  1YJ9 P;  3DS3 A;  5DCK A;  2JU2 A;  1M1K Q;  2JYG A;  2FAE A;  4IPY A;  2VLP A;  2L4B A;  1DV5 A;  1W2B O;  3I55 P;  2Z45 A;  4PH0 A;  3DS2 A;  4CA3 A;  2N98 A;  3G0V A;  2VSQ A;  2QNW A;  2LF4 A;  2M5R A;  3Q20 A;  3DS5 A;  3P05 A;  2BUO A;  1RO2 A;  2AF8 A;  2JO0 A;  1YIJ P;  2PEM A;  3NTE A;  2MR8 A;  4WYM A;  2K0Y A;  1RO0 A;  2KGD A;  2MR7 A;  4HKG A;  2P9X A;  2M8L A;  2FAD A;  4PH1 A;  2KG9 A;  1KQS O;  2QEX P;  2KG6 A;  1CEI A;  2K0X A;  1FR2 A;  2N6Z A;  2JU1 A;  2PEO A;  2XZ1 C;  4H2X C;  2LML A;  2KWL A;  3G26 A;  4PWV B;  2BHV A;  3DS0 A;  1Q81 Q;  4F37 A;  5F2O A;  3CE7 A;  2KG8 A;  2GZE A;  2E1M A;  3CC4 P;  2GDW A;  2OAR A;  3H4E A;  1Q7Y Q;  3CXC O;  1AYI A;  1OR5 A;  1BAJ A;  3HZQ A;  3OW2 O;  2N6Y A;  4BPF A;  2LPK A;  5KP7 B;  2ERH A;  1VHN A;  4U0F A;  1VQP P;  4H2W C;  5F2N A;  2AFD A;  3CCS P;  3CCU P;  3CCV P;  4UHP B;  4U0E A;  2N5I A;  2FVF A;  3G1G A;  1VQL P;  3LRY A;  4XRO A;  3CCE P;  2EIA A;  1YJN P;  5CZD B;  4U0C A;  2QA4 P;  2PEJ A;  1YI2 P;  2KOD A;  1L0I A;  3M1M A;  2OTL P;  2CWO A;  1KC8 Q;  2KOS A;  3CCL P;  1VQO P;  2XZ0 D;  4U0B A;  4GR2 A;  2AFE A;  1HQB A;  2VLN A;  3G28 A;  1VQ8 P;  3DTJ A;  2LOL A;  2N50 A;  3EJD A;  4NEO A;  4QNB A;  1VQ7 P;  3B4Q A;  5I4T G;  3NY7 B;  1D1D A;  1A8O A;  4COC A;  2K2Q A;  1VQM P;  5HGO A;  2GYK A;  2KOQ A;  1VQ9 P;  2GZI A;  3DS4 A;  1IMQ A;  1YIT P;  2LL8 A;  2FVE A;  2KOO A;  2L0Q A;  2MVU A;  2ONT A;  1QVF O;  2EG5 A;  3CC2 P;  2L9F A;  1K73 Q;  2K5X A;  5HV8 A;  3H47 A;  1S72 P;  1T8K A;  2CGQ A;  2XXM A;  1JJ2 O;  2LKI A;  1M6E X;  2FHS C;  5BS1 A;  5JPA A;  1EOQ A;  2PEQ A;  1IMP A;  4XFZ A;  1QVG O;  3RG2 A;  3CME P;  2K93 A;  2NO8 A;  3CMA P;  2WPT A;  3CCQ P;  2LIW A;  1F80 D;  2DNW A;  2MVV A;  2PEN A;  2PY8 A;  1YJW P;  3B5I A;  1M6N A;  2K94 A;  2MD9 A;  2CG5 B;  3G21 A;  3G29 A;  3G1I A;  2CNR A;  3G71 P;  2JQ4 A;  1M74 A;  1HY8 A;  5EW5 E;  3RG6 C;  4M0I A;  5HGL A;  3GJN A;  4U0A A;  1Z6M A;  2AVA A;  3I56 P;  1K9M Q;  5HGM A;  2KGA A;  3CCR P;  2EHT A;  4BPH A;  1VQ4 P;  1E6J P;  4XFX A;  4IZ6 A;  5HVC A;  3EJE A;  2EFJ A;  1KD1 Q;  5HGN A;  1EIA A;  3WBH A;  2GZG A;  5KP6 B;  2KW2 A;  4MRT C;  3HYB A;  1E0H A;  2LTE A;  3GKL C;  5KP8 B;  2EHS A;  2GZF A;  2GZJ A;  2PEK A;  2M8P A;  2PEI A;  3CD6 P;  1ACP A;  4R0M A;  2Z44 A;  3GZL A;  2JAZ A;  2MY5 A;  2KGC A;  1K30 A;  4PXH B;  2FQ0 A;  1AUM A;  4COP A;  2FQ2 A;  2FAC A;  2X2B A;  2OTJ P;  2Z46 A;  3VRL C;  2LIU A;  2XV6 A;  1A43 A;  1UNK A;  1UJZ A;  2FQ1 A;  2CQ8 A;  4QKO A;  4GR6 A;  3CPW O;  1ZMB A;  3CC7 P;  3LMO A;  2XT1 A;  3G4S P;  5EJD A;  2JB0 A;  2JGP A;  1M90 Q;  1EMV A; 
#chains in the Genus database with same CATH homology
 2FAE A;  2LIW A;  1F80 D;  2KOR A;  2L4B A;  2N5I A;  2FVF A;  2DNW A;  2MVV A;  1DV5 A;  2K94 A;  5CZD B;  2MD9 A;  4CA3 A;  2N98 A;  2CG5 B;  2VSQ A;  1L0I A;  1X3O A;  2QNW A;  2CNR A;  2M5R A;  2KOS A;  1NQ4 A;  2JQ4 A;  2KR5 A;  2XZ0 D;  1HY8 A;  2KGE A;  2AF8 A;  2AFE A;  2FVA A;  2L22 A;  1HQB A;  1AF8 A;  2AVA A;  2GDY A;  2MR8 A;  2GDX A;  2K92 A;  2ROQ A;  1DNY A;  2K0Y A;  2LOL A;  2KGD A;  2MR7 A;  2KGA A;  4HKG A;  2N50 A;  2FAD A;  3EJD A;  2KG9 A;  4NEO A;  4BPG A;  2EHT A;  4BPH A;  2KG6 A;  3NY7 B;  2K0X A;  2PNG A;  4IZ6 A;  5HVC A;  3EJE A;  2K2Q A;  2N6Z A;  1VKU A;  5KP6 B;  2KW2 A;  2JU1 A;  2KOQ A;  4MRT C;  1KLP A;  2XZ1 C;  2LTE A;  4H2X C;  2LML A;  5KP8 B;  2LL8 A;  2FVE A;  2EHS A;  2KOO A;  2L0Q A;  2MVU A;  3GZM A;  2KWL A;  1ACP A;  4PWV B;  3EJB A;  4R0M A;  3GZL A;  2L9F A;  2MY5 A;  2KGC A;  5HV8 A;  3CE7 A;  4PXH B;  2FQ0 A;  2KG8 A;  4DG9 A;  2FQ2 A;  1T8K A;  2FAC A;  2X2B A;  2GDW A;  2CGQ A;  2MF4 A;  2LKI A;  2LIU A;  1L0H A;  2FQ1 A;  2CQ8 A;  2FHS C;  1OR5 A;  2N6Y A;  4BPF A;  2LPK A;  2N5H A;  2KOP A;  5KP7 B;  3LMO A;  4H2Y C;  4H2W C;  5EJD A;  3RG2 A;  2JGP A;  2JU2 A;  2AFD A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...