1HQBA

Tertiary structure of apo-d-alanyl carrier protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APO-D-ALANYL CARRIER PROTEIN
publication title Biosynthesis of D-alanyl-lipoteichoic acid: the tertiary structure of apo-D-alanyl carrier protein.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transport protein
total genus 15
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2000-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1hqbA00
2K93A 5KP7B 2KGDA 2JU1A 2LOLA 2MR8A 1L0HA 2KOOA 4NEOA 2K2QA 2FVAA 2FVEA 1NQ4A 2AFDA 2N50A 1DNYA 2AFEA 2N98A 2MVVA 4BPHA 2N6ZA 2XZ1C 4H2YC 2KGAA 2LL8A 4H2XC 2FAEA 2CNRA 2X2BA 2KOSA 2KOQA 2AF8A 2FVFA 3CE7A 2CGQA 5CZDB 2FADA 2FQ0A 2KR5A 5EJDA 2FQ2A 2KG6A 1HQBA 5KP8B 5HV8A 1T8KA 2KG8A 2K0YA 2AVAA 2FACA 2L9FA 4PWVB 2K92A 2MY5A 5KP6B 2LTEA 2CQ8A 2LKIA 2ROQA 4CA3A 2JQ4A 4IZ6A 2N6YA 2LIUA 2KGCA 2L0QA 2MR7A 2EHSA 2CG5B 4HKGA 1OR5A 2LMLA 3EJEA 2GDXA 3RG2A 1AF8A 3EJDA 1DV5A 2K0XA 1ACPA 2KOPA 3GZMA 2N5IA 1L0IA 2PNGA 3GZLA 2JGPA 2QNWA 3EJBA 1HY8A 2GDWA 4BPFA 2KWLA 2LPKA 2KORA 2KG9A 2MD9A 2K94A 2L4BA 2XZ0D 2L22A 4MRTC 2FQ1A 2LIWA 5HVCA 2MVUA 1X3OA 2EHTA 2KW2A 2DNWA 2N5HA 4PXHB 4H2WC 2MF4A 4DG9A 4R0MA 2KGEA 3LMOA 2VSQA 2FHSC 1KLPA 4BPGA 2JU2A 1VKUA 2M5RA 3NY7B 1F80D 2GDYA
chains in the Genus database with same CATH superfamily
2KOOA 2EG5A 2GZFA 3CCMP 1NQ4A 3G1GA 3CCJP 3B4QA 1VQ6P 2KGAA 3WBHA 1RO0A 4U0BA 2AF8A 2KOSA 5CZDB 2FADA 2E1MA 2FQ0A 2KR5A 5EJDA 1RO2A 1HQBA 1IUQA 2XV6A 1T8KA 1VQ7P 2M8NA 2AVAA 4PWVB 2MY5A 1VQ5P 1YJNP 2LTEA 2CQ8A 1JJ2O 1VQNP 1Q82Q 2DGYA 2KGCA 3CCSP 2EHSA 2CG5B 4HKGA 1OR5A 2LMLA 2PENA 2GZGA 1AF8A 1YHQP 1ACPA 4COPA 1L0IA 1GPJA 3I56P 4QNBA 3GZLA 3CMEP 3EJBA 2NO8A 1QVFO 4BPFA 4IPYA 4U0EA 4M0IA 2KWLA 2LPKA 3H0DA 1M6EX 2KORA 7CEIA 2BHVA 1W2BO 1AYIA 2L4BA 2XZ0D 2QEXP 3G26A 4MRTC 3E2DA 3U43A 2EHTA 2N5HA 2DNWA 4PXHB 4H2WC 1VQ4P 1Z6MA 2ERHA 3LMOA 3DPHA 1CEIA 2GZJA 4PH0A 1EMVA 3HYBA 1VKUA 2K0DX 1YJ9P 3NY7B 1E6JP 1KC8Q 1ZNVA 2K93A 2JU1A 3DS3A 2QA4P 2AFDA 1DNYA 4U0CA 1EOQA 2MVVA 2N6ZA 2XZ1C 1UNKA 1VQKP 1M6NA 2X2BA 3DS4A 2KOQA 5DCKA 4U0FA 3H4EA 2FQ2A 3VRLC 1E0HA 2K0YA 1GXHA 2GZEA 3G4SP 2VLOA 2K92A 1K73Q 2JB0A 3P05A 2JQ4A 4IZ6A 3B5IA 2BUOA 1KD1Q 3G28A 1K8AQ 1VQLP 2MR7A 1D1DA 3EJEA 2GDXA 4QKOA 2K0XA 2PNGA 3DTJA 1ZMBA 3DS1A 2VLNA 1IMPA 2JBGA 2LIWA 1M74A 2K5XA 1BAJA 4DG9A 2GYKA 2ONTA 1QRJA 3H47A 3CCLP 2PEJA 3DS5A 2Z44A 4BPGA 2JU2A 3CPWO 2KGDA 2LOLA 2Z45A 2MR8A 4XFYA 4NEOA 2K2QA 2N50A 2N98A 4UHPB 2CWOA 3LRYA 3CCVP 1N8RQ 4H2YC 4F37A 3CXCO 3G6EP 2CNRA 4WYMA 2EIAA 1NJIQ 3CE7A 3G0VA 3NTEA 5JPAA 2KG6A 1YJWP 2LF4A 3G71P 5KP8B 2P9XA 5HV8A 1EIAA 1KQSO 2PEOA 2OTLP 1FR2A 1VHNA 4XROA 5BS2A 3CCEP 3G21A 2FACA 5F2OA 4XFZA 5HGNA 2LKIA 2PEQA 4CA3A 5HGOA 3OW2O 2OARA 4PH1A 1A43A 2Z46A 2M8PA 1YI2P 3G1IA 3CCQP 2L0QA 2GZIA 3GJNA 3RG2A 1Q86Q 4U0AA 2OTJP 3Q20A 1BXIA 3CCUP 2QNWA 1HY8A 2PEMA 1S72P 3CCRP 2KG9A 1Q7YQ 2K94A 2VLPA 3DS2A 2L22A 2JAZA 2FQ1A 2MVUA 2M8LA 2KODA 2JYGA 2FHSC 3G29A 1F80D 3CD6P 1YITP 5KP7B 1L0HA 2XT1A 1K9MQ 2FVAA 2FVEA 2AFEA 4BPHA 3CC7P 1IMQA 1VQPP 1VQMP 2WPTA 2LL8A 4H2XC 2FAEA 1VQOP 1MZ8A 1VQ8P 2FVFA 2CGQA 2JO0A 1YIJP 4GR6A 4COCA 3CC2P 3CMAP 2L6EA 2KG8A 3DS0A 5I4TG 2PEIA 5F2KA 2L9FA 5KP6B 2ROQA 3CC4P 4XRQA 2N6YA 2VLQA 1VQ9P 2LIUA 1K30A 1RNIA 5EW5E 2EFJA 3M1MA 5HGLA 2PY8A 3EJDA 3RG6C 1DV5A 2KOPA 3GZMA 4GR2A 1AUMA 2N5IA 3GKLC 1M90Q 2JGPA 2GDWA 5HGMA 2MD9A 2XXMA 3MGEA 2JYLA 5HVCA 1Q81Q 1X3OA 1UJZA 2KW2A 3I55P 2MF4A 2PEKA 5BS1A 4R0MA 2KGEA 5F2NA 2VSQA 1A8OA 1KLPA 1QVGO 3HZQA 4U0DA 2M5RA 1M1KQ 4XFXA 1GXGA 2GDYA
chains in the Genus database with same CATH topology
2K93A 5KP7B 2KGDA 2JU1A 2LOLA 2MR8A 1L0HA 2KOOA 4NEOA 2K2QA 2FVAA 2FVEA 1NQ4A 2AFDA 2N50A 1DNYA 2AFEA 2N98A 2MVVA 4BPHA 2N6ZA 2XZ1C 4H2YC 2KGAA 2LL8A 4H2XC 2FAEA 2CNRA 2X2BA 2KOSA 2KOQA 2AF8A 2FVFA 3CE7A 2CGQA 5CZDB 2FADA 2FQ0A 2KR5A 5EJDA 2FQ2A 2KG6A 1HQBA 5KP8B 5HV8A 1T8KA 2KG8A 2K0YA 2AVAA 2FACA 2L9FA 4PWVB 2K92A 2MY5A 5KP6B 2LTEA 2CQ8A 2LKIA 2ROQA 4CA3A 2JQ4A 4IZ6A 2N6YA 2LIUA 2KGCA 2L0QA 2MR7A 2EHSA 2CG5B 4HKGA 1OR5A 2LMLA 3EJEA 2GDXA 3RG2A 1AF8A 3EJDA 1DV5A 2K0XA 1ACPA 2KOPA 3GZMA 2N5IA 1L0IA 2PNGA 3GZLA 2JGPA 2QNWA 3EJBA 1HY8A 2GDWA 4BPFA 2KWLA 2LPKA 2KORA 2KG9A 2MD9A 2K94A 2L4BA 2XZ0D 2L22A 4MRTC 2FQ1A 2LIWA 5HVCA 2MVUA 1X3OA 2EHTA 2KW2A 2DNWA 2N5HA 4PXHB 4H2WC 2MF4A 4DG9A 4R0MA 2KGEA 3LMOA 2VSQA 2FHSC 1KLPA 4BPGA 2JU2A 1VKUA 2M5RA 3NY7B 1F80D 2GDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K93 A;  5KP7 B;  2KGD A;  2JU1 A;  2LOL A;  2MR8 A;  1L0H A;  2KOO A;  4NEO A;  2K2Q A;  2FVA A;  2FVE A;  1NQ4 A;  2AFD A;  2N50 A;  1DNY A;  2AFE A;  2N98 A;  2MVV A;  4BPH A;  2N6Z A;  2XZ1 C;  4H2Y C;  2KGA A;  2LL8 A;  4H2X C;  2FAE A;  2CNR A;  2X2B A;  2KOS A;  2KOQ A;  2AF8 A;  2FVF A;  3CE7 A;  2CGQ A;  5CZD B;  2FAD A;  2FQ0 A;  2KR5 A;  5EJD A;  2FQ2 A;  2KG6 A;  1HQB A;  5KP8 B;  5HV8 A;  1T8K A;  2KG8 A;  2K0Y A;  2AVA A;  2FAC A;  2L9F A;  4PWV B;  2K92 A;  2MY5 A;  5KP6 B;  2LTE A;  2CQ8 A;  2LKI A;  2ROQ A;  4CA3 A;  2JQ4 A;  4IZ6 A;  2N6Y A;  2LIU A;  2KGC A;  2L0Q A;  2MR7 A;  2EHS A;  2CG5 B;  4HKG A;  1OR5 A;  2LML A;  3EJE A;  2GDX A;  3RG2 A;  1AF8 A;  3EJD A;  1DV5 A;  2K0X A;  1ACP A;  2KOP A;  3GZM A;  2N5I A;  1L0I A;  2PNG A;  3GZL A;  2JGP A;  2QNW A;  3EJB A;  1HY8 A;  2GDW A;  4BPF A;  2KWL A;  2LPK A;  2KOR A;  2KG9 A;  2MD9 A;  2K94 A;  2L4B A;  2XZ0 D;  2L22 A;  4MRT C;  2FQ1 A;  2LIW A;  5HVC A;  2MVU A;  1X3O A;  2EHT A;  2KW2 A;  2DNW A;  2N5H A;  4PXH B;  4H2W C;  2MF4 A;  4DG9 A;  4R0M A;  2KGE A;  3LMO A;  2VSQ A;  2FHS C;  1KLP A;  4BPG A;  2JU2 A;  1VKU A;  2M5R A;  3NY7 B;  1F80 D;  2GDY A; 
#chains in the Genus database with same CATH topology
 2KOO A;  2EG5 A;  2GZF A;  3CCM P;  1NQ4 A;  3G1G A;  3CCJ P;  3B4Q A;  1VQ6 P;  2KGA A;  3WBH A;  1RO0 A;  4U0B A;  2AF8 A;  2KOS A;  5CZD B;  2FAD A;  2E1M A;  2FQ0 A;  2KR5 A;  5EJD A;  1RO2 A;  1HQB A;  1IUQ A;  2XV6 A;  1T8K A;  1VQ7 P;  2M8N A;  2AVA A;  4PWV B;  2MY5 A;  1VQ5 P;  1YJN P;  2LTE A;  2CQ8 A;  1JJ2 O;  1VQN P;  1Q82 Q;  2DGY A;  2KGC A;  3CCS P;  2EHS A;  2CG5 B;  4HKG A;  1OR5 A;  2LML A;  2PEN A;  2GZG A;  1AF8 A;  1YHQ P;  1ACP A;  4COP A;  1L0I A;  1GPJ A;  3I56 P;  4QNB A;  3GZL A;  3CME P;  3EJB A;  2NO8 A;  1QVF O;  4BPF A;  4IPY A;  4U0E A;  4M0I A;  2KWL A;  2LPK A;  3H0D A;  1M6E X;  2KOR A;  7CEI A;  2BHV A;  1W2B O;  1AYI A;  2L4B A;  2XZ0 D;  2QEX P;  3G26 A;  4MRT C;  3E2D A;  3U43 A;  2EHT A;  2N5H A;  2DNW A;  4PXH B;  4H2W C;  1VQ4 P;  1Z6M A;  2ERH A;  3LMO A;  3DPH A;  1CEI A;  2GZJ A;  4PH0 A;  1EMV A;  3HYB A;  1VKU A;  2K0D X;  1YJ9 P;  3NY7 B;  1E6J P;  1KC8 Q;  1ZNV A;  2K93 A;  2JU1 A;  3DS3 A;  2QA4 P;  2AFD A;  1DNY A;  4U0C A;  1EOQ A;  2MVV A;  2N6Z A;  2XZ1 C;  1UNK A;  1VQK P;  1M6N A;  2X2B A;  3DS4 A;  2KOQ A;  5DCK A;  4U0F A;  3H4E A;  2FQ2 A;  3VRL C;  1E0H A;  2K0Y A;  1GXH A;  2GZE A;  3G4S P;  2VLO A;  2K92 A;  1K73 Q;  2JB0 A;  3P05 A;  2JQ4 A;  4IZ6 A;  3B5I A;  2BUO A;  1KD1 Q;  3G28 A;  1K8A Q;  1VQL P;  2MR7 A;  1D1D A;  3EJE A;  2GDX A;  4QKO A;  2K0X A;  2PNG A;  3DTJ A;  1ZMB A;  3DS1 A;  2VLN A;  1IMP A;  2JBG A;  2LIW A;  1M74 A;  2K5X A;  1BAJ A;  4DG9 A;  2GYK A;  2ONT A;  1QRJ A;  3H47 A;  3CCL P;  2PEJ A;  3DS5 A;  2Z44 A;  4BPG A;  2JU2 A;  3CPW O;  2KGD A;  2LOL A;  2Z45 A;  2MR8 A;  4XFY A;  4NEO A;  2K2Q A;  2N50 A;  2N98 A;  4UHP B;  2CWO A;  3LRY A;  3CCV P;  1N8R Q;  4H2Y C;  4F37 A;  3CXC O;  3G6E P;  2CNR A;  4WYM A;  2EIA A;  1NJI Q;  3CE7 A;  3G0V A;  3NTE A;  5JPA A;  2KG6 A;  1YJW P;  2LF4 A;  3G71 P;  5KP8 B;  2P9X A;  5HV8 A;  1EIA A;  1KQS O;  2PEO A;  2OTL P;  1FR2 A;  1VHN A;  4XRO A;  5BS2 A;  3CCE P;  3G21 A;  2FAC A;  5F2O A;  4XFZ A;  5HGN A;  2LKI A;  2PEQ A;  4CA3 A;  5HGO A;  3OW2 O;  2OAR A;  4PH1 A;  1A43 A;  2Z46 A;  2M8P A;  1YI2 P;  3G1I A;  3CCQ P;  2L0Q A;  2GZI A;  3GJN A;  3RG2 A;  1Q86 Q;  4U0A A;  2OTJ P;  3Q20 A;  1BXI A;  3CCU P;  2QNW A;  1HY8 A;  2PEM A;  1S72 P;  3CCR P;  2KG9 A;  1Q7Y Q;  2K94 A;  2VLP A;  3DS2 A;  2L22 A;  2JAZ A;  2FQ1 A;  2MVU A;  2M8L A;  2KOD A;  2JYG A;  2FHS C;  3G29 A;  1F80 D;  3CD6 P;  1YIT P;  5KP7 B;  1L0H A;  2XT1 A;  1K9M Q;  2FVA A;  2FVE A;  2AFE A;  4BPH A;  3CC7 P;  1IMQ A;  1VQP P;  1VQM P;  2WPT A;  2LL8 A;  4H2X C;  2FAE A;  1VQO P;  1MZ8 A;  1VQ8 P;  2FVF A;  2CGQ A;  2JO0 A;  1YIJ P;  4GR6 A;  4COC A;  3CC2 P;  3CMA P;  2L6E A;  2KG8 A;  3DS0 A;  5I4T G;  2PEI A;  5F2K A;  2L9F A;  5KP6 B;  2ROQ A;  3CC4 P;  4XRQ A;  2N6Y A;  2VLQ A;  1VQ9 P;  2LIU A;  1K30 A;  1RNI A;  5EW5 E;  2EFJ A;  3M1M A;  5HGL A;  2PY8 A;  3EJD A;  3RG6 C;  1DV5 A;  2KOP A;  3GZM A;  4GR2 A;  1AUM A;  2N5I A;  3GKL C;  1M90 Q;  2JGP A;  2GDW A;  5HGM A;  2MD9 A;  2XXM A;  3MGE A;  2JYL A;  5HVC A;  1Q81 Q;  1X3O A;  1UJZ A;  2KW2 A;  3I55 P;  2MF4 A;  2PEK A;  5BS1 A;  4R0M A;  2KGE A;  5F2N A;  2VSQ A;  1A8O A;  1KLP A;  1QVG O;  3HZQ A;  4U0D A;  2M5R A;  1M1K Q;  4XFX A;  1GXG A;  2GDY A; 
#chains in the Genus database with same CATH homology
 2K93 A;  5KP7 B;  2KGD A;  2JU1 A;  2LOL A;  2MR8 A;  1L0H A;  2KOO A;  4NEO A;  2K2Q A;  2FVA A;  2FVE A;  1NQ4 A;  2AFD A;  2N50 A;  1DNY A;  2AFE A;  2N98 A;  2MVV A;  4BPH A;  2N6Z A;  2XZ1 C;  4H2Y C;  2KGA A;  2LL8 A;  4H2X C;  2FAE A;  2CNR A;  2X2B A;  2KOS A;  2KOQ A;  2AF8 A;  2FVF A;  3CE7 A;  2CGQ A;  5CZD B;  2FAD A;  2FQ0 A;  2KR5 A;  5EJD A;  2FQ2 A;  2KG6 A;  1HQB A;  5KP8 B;  5HV8 A;  1T8K A;  2KG8 A;  2K0Y A;  2AVA A;  2FAC A;  2L9F A;  4PWV B;  2K92 A;  2MY5 A;  5KP6 B;  2LTE A;  2CQ8 A;  2LKI A;  2ROQ A;  4CA3 A;  2JQ4 A;  4IZ6 A;  2N6Y A;  2LIU A;  2KGC A;  2L0Q A;  2MR7 A;  2EHS A;  2CG5 B;  4HKG A;  1OR5 A;  2LML A;  3EJE A;  2GDX A;  3RG2 A;  1AF8 A;  3EJD A;  1DV5 A;  2K0X A;  1ACP A;  2KOP A;  3GZM A;  2N5I A;  1L0I A;  2PNG A;  3GZL A;  2JGP A;  2QNW A;  3EJB A;  1HY8 A;  2GDW A;  4BPF A;  2KWL A;  2LPK A;  2KOR A;  2KG9 A;  2MD9 A;  2K94 A;  2L4B A;  2XZ0 D;  2L22 A;  4MRT C;  2FQ1 A;  2LIW A;  5HVC A;  2MVU A;  1X3O A;  2EHT A;  2KW2 A;  2DNW A;  2N5H A;  4PXH B;  4H2W C;  2MF4 A;  4DG9 A;  4R0M A;  2KGE A;  3LMO A;  2VSQ A;  2FHS C;  1KLP A;  4BPG A;  2JU2 A;  1VKU A;  2M5R A;  3NY7 B;  1F80 D;  2GDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...