2FADA

Crystal structure of e. coli heptanoyl-acp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fadA00
2L22A 2VSQA 4DG9A 2X2BA 2LPKA 2N6ZA 2GDWA 1DV5A 2K92A 2MD9A 2JGPA 4PXHB 3GZMA 2KW2A 2M5RA 2KR5A 2K2QA 2FAEA 2AF8A 2XZ1C 2KWLA 5EJDA 2MR8A 4H2XC 3RG2A 4MRTC 2AFDA 2JU2A 2MVUA 4BPHA 3LMOA 2PNGA 2K94A 2AFEA 2GDXA 2JQ4A 4HKGA 1AF8A 2EHTA 2LIWA 2JU1A 2FQ0A 1DNYA 1T8KA 2XZ0D 2N5HA 2KG6A 4BPGA 2KGCA 1KLPA 2KORA 5KP7B 2L4BA 1VKUA 1F80D 2FHSC 2N6YA 3EJEA 2CGQA 4CA3A 2FADA 3NY7B 5HV8A 2MF4A 2KOSA 1HQBA 4PWVB 2DNWA 5KP6B 2LL8A 2FQ1A 1L0IA 2MY5A 5CZDB 2LIUA 2EHSA 2N50A 2L0QA 4H2WC 3EJBA 2KGEA 4R0MA 2K0XA 2FQ2A 2KOOA 2LOLA 1ACPA 2LTEA 5HVCA 2N5IA 2FVFA 3GZLA 2CQ8A 2KG9A 2KOPA 2MR7A 2K0YA 2GDYA 4BPFA 2KOQA 2CNRA 1NQ4A 2K93A 2KG8A 2QNWA 3EJDA 2CG5B 4NEOA 2MVVA 2AVAA 4IZ6A 2LKIA 2FVAA 2FVEA 2LMLA 2KGAA 2ROQA 4H2YC 1L0HA 1OR5A 3CE7A 1X3OA 1HY8A 5KP8B 2L9FA 2KGDA 2N98A 2FACA
chains in the Genus database with same CATH superfamily
2JAZA 2N6ZA 1VQ9P 2K92A 2VLNA 2GYKA 2KWLA 2MR8A 3RG2A 5I4TG 2GDXA 4UHPB 2WPTA 1AF8A 1YJWP 2JU1A 2VLOA 2VLQA 1VQNP 2XZ0D 1VQLP 1VHNA 1YIJP 1F80D 2NO8A 5HGOA 2N6YA 3H0DA 2FADA 3H47A 2K5XA 3M1MA 2KOSA 3H4EA 4PWVB 7CEIA 3VRLC 2EIAA 4PH0A 3DS3A 4XFZA 4XFYA 1VQ6P 2L0QA 2QEXP 1EMVA 4R0MA 2GZFA 1W2BO 3HZQA 1QVFO 1UJZA 1GPJA 2MR7A 1YHQP 2PEOA 1A43A 2Z46A 2GDYA 1QVGO 1M6NA 2KOQA 3CD6P 3DS2A 2CNRA 2ONTA 2KODA 5F2NA 2AVAA 1RNIA 2GZJA 2KGAA 4H2YC 5KP8B 2VSQA 5DCKA 4DG9A 1VQ8P 2XV6A 1DV5A 2MD9A 2JGPA 3CCVP 1CEIA 3GZMA 2DGYA 4U0AA 1IUQA 1M1KQ 2M5RA 2KR5A 3GJNA 2XZ1C 4MRTC 2AFDA 2JU2A 2MVUA 2PEMA 3LMOA 2PNGA 1A8OA 2JQ4A 2QA4P 4COPA 2EHTA 2LIWA 3P05A 1T8KA 1NJIQ 1AYIA 2PEJA 2LF4A 3CCJP 1VQPP 2KORA 1RO2A 2GZGA 2FHSC 3EJEA 1Q86Q 3NY7B 3G1GA 3CCSP 3G1IA 2MF4A 1HQBA 1VQ5P 2JBGA 1M90Q 1L0IA 2MY5A 4U0FA 5CZDB 2LIUA 2N50A 3CCUP 1VQ7P 4H2WC 1IMQA 2KGEA 3I56P 2K0XA 3CC2P 2LOLA 5HVCA 1VQ4P 2FVFA 2CQ8A 1YITP 1D1DA 3G26A 3CXCO 3G6EP 3EJDA 4NEOA 3CCRP 2M8PA 4U0BA 4IZ6A 2LKIA 2FVEA 2JB0A 4F37A 4U0DA 2PEKA 3CCLP 2EFJA 2XXMA 1K9MQ 1ZMBA 3CE7A 5BS2A 4WYMA 5HGNA 3CMEP 2JO0A 2LPKA 2GDWA 3G0VA 2L6EA 3E2DA 1M6EX 1JJ2O 3GKLC 2K2QA 3I55P 2FAEA 1ZNVA 5EJDA 1Z6MA 3DS0A 4BPHA 2E1MA 2K94A 1IMPA 4PH1A 2GZIA 4HKGA 2FQ0A 4U0EA 2EG5A 1DNYA 1BXIA 2KG6A 4BPGA 1KLPA 5KP7B 4CA3A 2CGQA 2PENA 4XROA 5HV8A 3DS4A 5F2OA 3CCMP 1AUMA 3WBHA 3DS5A 1Q81Q 5KP6B 2LL8A 3G21A 1YJ9P 1Q82Q 2EHSA 5BS1A 3B5IA 3Q20A 2OARA 1BAJA 1KC8Q 2FQ2A 4COCA 1ACPA 2ERHA 4QNBA 2LTEA 2N5IA 3GZLA 4M0IA 2KG9A 2JYLA 1MZ8A 3MGEA 2PEQA 1QRJA 2K93A 2KG8A 3U43A 1EOQA 1E6JP 3LRYA 2VLPA 4XFXA 2P9XA 3OW2O 2FVAA 1N8RQ 1GXHA 3HYBA 2ROQA 2OTJP 3G71P 2Z45A 1OR5A 1X3OA 1HY8A 2L9FA 2N98A 1K73Q 2L22A 4XRQA 3G28A 2X2BA 1K30A 4PXHB 2M8LA 2KW2A 1GXGA 1EIAA 1VQMP 2AF8A 1Q7YQ 4H2XC 3G4SP 1YI2P 2OTLP 3DTJA 1FR2A 2AFEA 5JPAA 5HGLA 5F2KA 2CWOA 2N5HA 2BHVA 2KGCA 2PY8A 3CC4P 2L4BA 1VKUA 2GZEA 2K0DX 3DS1A 2DNWA 3CPWO 2FQ1A 4GR2A 1K8AQ 4GR6A 3EJBA 2JYGA 1RO0A 1KD1Q 3B4QA 3DPHA 1S72P 2KOOA 3CCEP 1YJNP 5HGMA 2KOPA 3NTEA 2K0YA 4BPFA 3CC7P 1UNKA 1NQ4A 4U0CA 1VQOP 1KQSO 2QNWA 2Z44A 2CG5B 2MVVA 5EW5E 3CMAP 2PEIA 1VQKP 1M74A 2LMLA 2BUOA 4QKOA 2M8NA 3G29A 1L0HA 2XT1A 4IPYA 3CCQP 1E0HA 2KGDA 3RG6C 2FACA
chains in the Genus database with same CATH topology
2L22A 2VSQA 4DG9A 2X2BA 2LPKA 2N6ZA 2GDWA 1DV5A 2K92A 2MD9A 2JGPA 4PXHB 3GZMA 2KW2A 2M5RA 2KR5A 2K2QA 2FAEA 2AF8A 2XZ1C 2KWLA 5EJDA 2MR8A 4H2XC 3RG2A 4MRTC 2AFDA 2JU2A 2MVUA 4BPHA 3LMOA 2PNGA 2K94A 2AFEA 2GDXA 2JQ4A 4HKGA 1AF8A 2EHTA 2LIWA 2JU1A 2FQ0A 1DNYA 1T8KA 2XZ0D 2N5HA 2KG6A 4BPGA 2KGCA 1KLPA 2KORA 5KP7B 2L4BA 1VKUA 1F80D 2FHSC 2N6YA 3EJEA 2CGQA 4CA3A 2FADA 3NY7B 5HV8A 2MF4A 2KOSA 1HQBA 4PWVB 2DNWA 5KP6B 2LL8A 2FQ1A 1L0IA 2MY5A 5CZDB 2LIUA 2EHSA 2N50A 2L0QA 4H2WC 3EJBA 2KGEA 4R0MA 2K0XA 2FQ2A 2KOOA 2LOLA 1ACPA 2LTEA 5HVCA 2N5IA 2FVFA 3GZLA 2CQ8A 2KG9A 2KOPA 2MR7A 2K0YA 2GDYA 4BPFA 2KOQA 2CNRA 1NQ4A 2K93A 2KG8A 2QNWA 3EJDA 2CG5B 4NEOA 2MVVA 2AVAA 4IZ6A 2LKIA 2FVAA 2FVEA 2LMLA 2KGAA 2ROQA 4H2YC 1L0HA 1OR5A 3CE7A 1X3OA 1HY8A 5KP8B 2L9FA 2KGDA 2N98A 2FACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L22 A;  2VSQ A;  4DG9 A;  2X2B A;  2LPK A;  2N6Z A;  2GDW A;  1DV5 A;  2K92 A;  2MD9 A;  2JGP A;  4PXH B;  3GZM A;  2KW2 A;  2M5R A;  2KR5 A;  2K2Q A;  2FAE A;  2AF8 A;  2XZ1 C;  2KWL A;  5EJD A;  2MR8 A;  4H2X C;  3RG2 A;  4MRT C;  2AFD A;  2JU2 A;  2MVU A;  4BPH A;  3LMO A;  2PNG A;  2K94 A;  2AFE A;  2GDX A;  2JQ4 A;  4HKG A;  1AF8 A;  2EHT A;  2LIW A;  2JU1 A;  2FQ0 A;  1DNY A;  1T8K A;  2XZ0 D;  2N5H A;  2KG6 A;  4BPG A;  2KGC A;  1KLP A;  2KOR A;  5KP7 B;  2L4B A;  1VKU A;  1F80 D;  2FHS C;  2N6Y A;  3EJE A;  2CGQ A;  4CA3 A;  2FAD A;  3NY7 B;  5HV8 A;  2MF4 A;  2KOS A;  1HQB A;  4PWV B;  2DNW A;  5KP6 B;  2LL8 A;  2FQ1 A;  1L0I A;  2MY5 A;  5CZD B;  2LIU A;  2EHS A;  2N50 A;  2L0Q A;  4H2W C;  3EJB A;  2KGE A;  4R0M A;  2K0X A;  2FQ2 A;  2KOO A;  2LOL A;  1ACP A;  2LTE A;  5HVC A;  2N5I A;  2FVF A;  3GZL A;  2CQ8 A;  2KG9 A;  2KOP A;  2MR7 A;  2K0Y A;  2GDY A;  4BPF A;  2KOQ A;  2CNR A;  1NQ4 A;  2K93 A;  2KG8 A;  2QNW A;  3EJD A;  2CG5 B;  4NEO A;  2MVV A;  2AVA A;  4IZ6 A;  2LKI A;  2FVA A;  2FVE A;  2LML A;  2KGA A;  2ROQ A;  4H2Y C;  1L0H A;  1OR5 A;  3CE7 A;  1X3O A;  1HY8 A;  5KP8 B;  2L9F A;  2KGD A;  2N98 A;  2FAC A; 
#chains in the Genus database with same CATH topology
 2JAZ A;  2N6Z A;  1VQ9 P;  2K92 A;  2VLN A;  2GYK A;  2KWL A;  2MR8 A;  3RG2 A;  5I4T G;  2GDX A;  4UHP B;  2WPT A;  1AF8 A;  1YJW P;  2JU1 A;  2VLO A;  2VLQ A;  1VQN P;  2XZ0 D;  1VQL P;  1VHN A;  1YIJ P;  1F80 D;  2NO8 A;  5HGO A;  2N6Y A;  3H0D A;  2FAD A;  3H47 A;  2K5X A;  3M1M A;  2KOS A;  3H4E A;  4PWV B;  7CEI A;  3VRL C;  2EIA A;  4PH0 A;  3DS3 A;  4XFZ A;  4XFY A;  1VQ6 P;  2L0Q A;  2QEX P;  1EMV A;  4R0M A;  2GZF A;  1W2B O;  3HZQ A;  1QVF O;  1UJZ A;  1GPJ A;  2MR7 A;  1YHQ P;  2PEO A;  1A43 A;  2Z46 A;  2GDY A;  1QVG O;  1M6N A;  2KOQ A;  3CD6 P;  3DS2 A;  2CNR A;  2ONT A;  2KOD A;  5F2N A;  2AVA A;  1RNI A;  2GZJ A;  2KGA A;  4H2Y C;  5KP8 B;  2VSQ A;  5DCK A;  4DG9 A;  1VQ8 P;  2XV6 A;  1DV5 A;  2MD9 A;  2JGP A;  3CCV P;  1CEI A;  3GZM A;  2DGY A;  4U0A A;  1IUQ A;  1M1K Q;  2M5R A;  2KR5 A;  3GJN A;  2XZ1 C;  4MRT C;  2AFD A;  2JU2 A;  2MVU A;  2PEM A;  3LMO A;  2PNG A;  1A8O A;  2JQ4 A;  2QA4 P;  4COP A;  2EHT A;  2LIW A;  3P05 A;  1T8K A;  1NJI Q;  1AYI A;  2PEJ A;  2LF4 A;  3CCJ P;  1VQP P;  2KOR A;  1RO2 A;  2GZG A;  2FHS C;  3EJE A;  1Q86 Q;  3NY7 B;  3G1G A;  3CCS P;  3G1I A;  2MF4 A;  1HQB A;  1VQ5 P;  2JBG A;  1M90 Q;  1L0I A;  2MY5 A;  4U0F A;  5CZD B;  2LIU A;  2N50 A;  3CCU P;  1VQ7 P;  4H2W C;  1IMQ A;  2KGE A;  3I56 P;  2K0X A;  3CC2 P;  2LOL A;  5HVC A;  1VQ4 P;  2FVF A;  2CQ8 A;  1YIT P;  1D1D A;  3G26 A;  3CXC O;  3G6E P;  3EJD A;  4NEO A;  3CCR P;  2M8P A;  4U0B A;  4IZ6 A;  2LKI A;  2FVE A;  2JB0 A;  4F37 A;  4U0D A;  2PEK A;  3CCL P;  2EFJ A;  2XXM A;  1K9M Q;  1ZMB A;  3CE7 A;  5BS2 A;  4WYM A;  5HGN A;  3CME P;  2JO0 A;  2LPK A;  2GDW A;  3G0V A;  2L6E A;  3E2D A;  1M6E X;  1JJ2 O;  3GKL C;  2K2Q A;  3I55 P;  2FAE A;  1ZNV A;  5EJD A;  1Z6M A;  3DS0 A;  4BPH A;  2E1M A;  2K94 A;  1IMP A;  4PH1 A;  2GZI A;  4HKG A;  2FQ0 A;  4U0E A;  2EG5 A;  1DNY A;  1BXI A;  2KG6 A;  4BPG A;  1KLP A;  5KP7 B;  4CA3 A;  2CGQ A;  2PEN A;  4XRO A;  5HV8 A;  3DS4 A;  5F2O A;  3CCM P;  1AUM A;  3WBH A;  3DS5 A;  1Q81 Q;  5KP6 B;  2LL8 A;  3G21 A;  1YJ9 P;  1Q82 Q;  2EHS A;  5BS1 A;  3B5I A;  3Q20 A;  2OAR A;  1BAJ A;  1KC8 Q;  2FQ2 A;  4COC A;  1ACP A;  2ERH A;  4QNB A;  2LTE A;  2N5I A;  3GZL A;  4M0I A;  2KG9 A;  2JYL A;  1MZ8 A;  3MGE A;  2PEQ A;  1QRJ A;  2K93 A;  2KG8 A;  3U43 A;  1EOQ A;  1E6J P;  3LRY A;  2VLP A;  4XFX A;  2P9X A;  3OW2 O;  2FVA A;  1N8R Q;  1GXH A;  3HYB A;  2ROQ A;  2OTJ P;  3G71 P;  2Z45 A;  1OR5 A;  1X3O A;  1HY8 A;  2L9F A;  2N98 A;  1K73 Q;  2L22 A;  4XRQ A;  3G28 A;  2X2B A;  1K30 A;  4PXH B;  2M8L A;  2KW2 A;  1GXG A;  1EIA A;  1VQM P;  2AF8 A;  1Q7Y Q;  4H2X C;  3G4S P;  1YI2 P;  2OTL P;  3DTJ A;  1FR2 A;  2AFE A;  5JPA A;  5HGL A;  5F2K A;  2CWO A;  2N5H A;  2BHV A;  2KGC A;  2PY8 A;  3CC4 P;  2L4B A;  1VKU A;  2GZE A;  2K0D X;  3DS1 A;  2DNW A;  3CPW O;  2FQ1 A;  4GR2 A;  1K8A Q;  4GR6 A;  3EJB A;  2JYG A;  1RO0 A;  1KD1 Q;  3B4Q A;  3DPH A;  1S72 P;  2KOO A;  3CCE P;  1YJN P;  5HGM A;  2KOP A;  3NTE A;  2K0Y A;  4BPF A;  3CC7 P;  1UNK A;  1NQ4 A;  4U0C A;  1VQO P;  1KQS O;  2QNW A;  2Z44 A;  2CG5 B;  2MVV A;  5EW5 E;  3CMA P;  2PEI A;  1VQK P;  1M74 A;  2LML A;  2BUO A;  4QKO A;  2M8N A;  3G29 A;  1L0H A;  2XT1 A;  4IPY A;  3CCQ P;  1E0H A;  2KGD A;  3RG6 C;  2FAC A; 
#chains in the Genus database with same CATH homology
 2L22 A;  2VSQ A;  4DG9 A;  2X2B A;  2LPK A;  2N6Z A;  2GDW A;  1DV5 A;  2K92 A;  2MD9 A;  2JGP A;  4PXH B;  3GZM A;  2KW2 A;  2M5R A;  2KR5 A;  2K2Q A;  2FAE A;  2AF8 A;  2XZ1 C;  2KWL A;  5EJD A;  2MR8 A;  4H2X C;  3RG2 A;  4MRT C;  2AFD A;  2JU2 A;  2MVU A;  4BPH A;  3LMO A;  2PNG A;  2K94 A;  2AFE A;  2GDX A;  2JQ4 A;  4HKG A;  1AF8 A;  2EHT A;  2LIW A;  2JU1 A;  2FQ0 A;  1DNY A;  1T8K A;  2XZ0 D;  2N5H A;  2KG6 A;  4BPG A;  2KGC A;  1KLP A;  2KOR A;  5KP7 B;  2L4B A;  1VKU A;  1F80 D;  2FHS C;  2N6Y A;  3EJE A;  2CGQ A;  4CA3 A;  2FAD A;  3NY7 B;  5HV8 A;  2MF4 A;  2KOS A;  1HQB A;  4PWV B;  2DNW A;  5KP6 B;  2LL8 A;  2FQ1 A;  1L0I A;  2MY5 A;  5CZD B;  2LIU A;  2EHS A;  2N50 A;  2L0Q A;  4H2W C;  3EJB A;  2KGE A;  4R0M A;  2K0X A;  2FQ2 A;  2KOO A;  2LOL A;  1ACP A;  2LTE A;  5HVC A;  2N5I A;  2FVF A;  3GZL A;  2CQ8 A;  2KG9 A;  2KOP A;  2MR7 A;  2K0Y A;  2GDY A;  4BPF A;  2KOQ A;  2CNR A;  1NQ4 A;  2K93 A;  2KG8 A;  2QNW A;  3EJD A;  2CG5 B;  4NEO A;  2MVV A;  2AVA A;  4IZ6 A;  2LKI A;  2FVA A;  2FVE A;  2LML A;  2KGA A;  2ROQ A;  4H2Y C;  1L0H A;  1OR5 A;  3CE7 A;  1X3O A;  1HY8 A;  5KP8 B;  2L9F A;  2KGD A;  2N98 A;  2FAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...