2FADA

Crystal structure of e. coli heptanoyl-acp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
publication title Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fadA00
2LL8A 2N98A 2LKIA 2L4BA 2MVUA 2MF4A 2LIWA 2KORA 4IZ6A 2KGAA 2GDWA 2K0YA 2MD9A 2FQ1A 2XZ1C 2FVFA 5EJDA 2PNGA 2AFDA 2KOSA 2MY5A 4CA3A 5KP8B 2AF8A 2ROQA 2FADA 2GDYA 2N5IA 2JU2A 2K92A 1HQBA 2AFEA 2K0XA 2N6YA 4BPHA 2KGCA 2LOLA 2CQ8A 2KGDA 1L0HA 3EJBA 2KWLA 2MR8A 2QNWA 1KLPA 2FQ0A 2JU1A 2KG9A 4NEOA 4H2YC 4H2WC 3EJEA 1VKUA 2K2QA 2FVEA 2EHSA 5KP6B 2KOQA 1OR5A 2LMLA 2XZ0D 3GZLA 5KP7B 1HY8A 2L0QA 5HVCA 2LPKA 1AF8A 2KGEA 1NQ4A 2FQ2A 1DNYA 2MVVA 2EHTA 2M5RA 4BPGA 2KG8A 2VSQA 5CZDB 4HKGA 4PWVB 2GDXA 4PXHB 2FACA 2DNWA 3RG2A 2LTEA 2LIUA 3NY7B 1DV5A 2AVAA 4DG9A 2FAEA 3GZMA 3LMOA 1X3OA 2CGQA 2KOOA 2KW2A 2KG6A 2L9FA 3EJDA 4BPFA 2X2BA 2K93A 2L22A 2N6ZA 4R0MA 2MR7A 1L0IA 4H2XC 2N5HA 1F80D 2JQ4A 5HV8A 3CE7A 2FVAA 2FHSC 2CNRA 2K94A 4MRTC 1ACPA 2KOPA 2CG5B 1T8KA 2KR5A 2JGPA 2N50A
chains in the Genus database with same CATH superfamily
2LL8A 2N98A 1VQNP 5EW5E 2LIWA 4IZ6A 1EIAA 1M6EX 2FVFA 2OARA 3G28A 2PNGA 2KOSA 1Q7YQ 1N8RQ 2Z45A 1VQ6P 2QEXP 2JU2A 2CWOA 2N6YA 2VLNA 4GR2A 2ERHA 2KGDA 2Z46A 1YJ9P 1YHQP 2JU1A 4H2YC 4H2WC 3EJEA 4IPYA 1VHNA 1QRJA 5KP6B 3G1IA 1E6JP 1GPJA 1KC8Q 1CEIA 2JO0A 2L0QA 1BAJA 1EMVA 2KGEA 3CC2P 2OTLP 1K8AQ 1VQ5P 2LF4A 2MVVA 2EHTA 4XRQA 3I56P 3E2DA 3HZQA 3H47A 4PWVB 5F2KA 1RO0A 2DNWA 3G29A 2KODA 3NY7B 1RO2A 3GZMA 3LMOA 2CGQA 3GKLC 3CXCO 4BPFA 2X2BA 3WBHA 1UNKA 1L0IA 2N5HA 3G6EP 4U0BA 1F80D 2JQ4A 1E0HA 5HV8A 1VQ8P 1AYIA 2PEIA 2CNRA 2K94A 2E1MA 1A8OA 1Q82Q 3CMEP 1YJWP 2KR5A 1KQSO 2XXMA 2MVUA 5I4TG 2NO8A 2GDWA 1W2BO 3CCJP 5F2OA 2XZ1C 4U0CA 2ROQA 2Z44A 3CPWO 4U0FA 2K92A 1VQKP 2GZFA 2K0XA 1K73Q 2CQ8A 3EJBA 2KWLA 3VRLC 1KLPA 2PEOA 5BS1A 2KG9A 1K30A 7CEIA 1KD1Q 2PEKA 3P05A 2QA4P 1UJZA 2KOQA 2LMLA 2XZ0D 2VLQA 5KP7B 4PH1A 2VLOA 4PH0A 2VLPA 2L6EA 2KG8A 5CZDB 2P9XA 3B5IA 2GDXA 2GYKA 4PXHB 2FACA 1Q81Q 2EIAA 4QNBA 3CCLP 2K0DX 2M8LA 1YI2P 1VQ7P 1K9MQ 2PEMA 4M0IA 1IMQA 2PENA 1A43A 3NTEA 2K93A 4R0MA 4H2XC 3CCUP 3RG6C 3LRYA 2PEQA 2OTJP 3Q20A 4U0DA 3CC7P 2GZEA 3CCEP 2CG5B 4GR6A 3G0VA 4XFXA 2LKIA 2L4BA 2KORA 1NJIQ 2EFJA 3CMAP 5EJDA 4COCA 2ONTA 3CC4P 5KP8B 2AF8A 5HGMA 1RNIA 2GDYA 3MGEA 2N5IA 2JAZA 3DPHA 2AFEA 2XT1A 3G4SP 4BPHA 2LOLA 3I55P 1GXGA 1L0HA 1S72P 5DCKA 1VQ9P 3G1GA 2FQ0A 4NEOA 1VKUA 2K2QA 1M74A 2M8PA 2FVEA 2JYLA 2GZJA 1VQOP 2JBGA 5HVCA 2LPKA 5HGLA 1NQ4A 5HGNA 2FQ2A 3H4EA 1DNYA 1MZ8A 2WPTA 1ZNVA 3G21A 4BPGA 3HYBA 4HKGA 3M1MA 4F37A 2LTEA 2LIUA 4XFZA 4U0AA 3CCRP 1X3OA 2KOOA 2KG6A 2L9FA 3EJDA 1M6NA 3DS1A 1M1KQ 2BHVA 1BXIA 2PY8A 2MR7A 3DTJA 2M8NA 3DS0A 2K5XA 1JJ2O 3G71P 2GZGA 2FHSC 3DS2A 1ACPA 1YIJP 1EOQA 1T8KA 4COPA 2DGYA 2JGPA 2MF4A 2BUOA 1YJNP 2KGAA 4XROA 2K0YA 2MD9A 2FQ1A 2JYGA 4UHPB 2AFDA 2MY5A 1M90Q 4CA3A 1FR2A 2FADA 1HQBA 3B4QA 2KGCA 3OW2O 1QVGO 2MR8A 4XFYA 4WYMA 3CCMP 1IUQA 2QNWA 5JPAA 3DS5A 3G26A 2EHSA 5BS2A 1OR5A 5HGOA 3GZLA 1IMPA 1HY8A 2XV6A 1AF8A 1VQLP 2EG5A 2JB0A 2M5RA 3U43A 1VQMP 3CCSP 1VQPP 3DS4A 2VSQA 2GZIA 3RG2A 3GJNA 1DV5A 2AVAA 4QKOA 4DG9A 2FAEA 1D1DA 2KW2A 1AUMA 3DS3A 4U0EA 2L22A 2N6ZA 3CCQP 2PEJA 1VQ4P 1YITP 3CE7A 2FVAA 3CCVP 4MRTC 3H0DA 1Z6MA 2KOPA 3CD6P 5F2NA 1ZMBA 1Q86Q 1GXHA 2N50A 1QVFO
chains in the Genus database with same CATH topology
2LL8A 2N98A 2LKIA 2L4BA 2MVUA 2MF4A 2LIWA 2KORA 4IZ6A 2KGAA 2GDWA 2K0YA 2MD9A 2FQ1A 2XZ1C 2FVFA 5EJDA 2PNGA 2AFDA 2KOSA 2MY5A 4CA3A 5KP8B 2AF8A 2ROQA 2FADA 2GDYA 2N5IA 2JU2A 2K92A 1HQBA 2AFEA 2K0XA 2N6YA 4BPHA 2KGCA 2LOLA 2CQ8A 2KGDA 1L0HA 3EJBA 2KWLA 2MR8A 2QNWA 1KLPA 2FQ0A 2JU1A 2KG9A 4NEOA 4H2YC 4H2WC 3EJEA 1VKUA 2K2QA 2FVEA 2EHSA 5KP6B 2KOQA 1OR5A 2LMLA 2XZ0D 3GZLA 5KP7B 1HY8A 2L0QA 5HVCA 2LPKA 1AF8A 2KGEA 1NQ4A 2FQ2A 1DNYA 2MVVA 2EHTA 2M5RA 4BPGA 2KG8A 2VSQA 5CZDB 4HKGA 4PWVB 2GDXA 4PXHB 2FACA 2DNWA 3RG2A 2LTEA 2LIUA 3NY7B 1DV5A 2AVAA 4DG9A 2FAEA 3GZMA 3LMOA 1X3OA 2CGQA 2KOOA 2KW2A 2KG6A 2L9FA 3EJDA 4BPFA 2X2BA 2K93A 2L22A 2N6ZA 4R0MA 2MR7A 1L0IA 4H2XC 2N5HA 1F80D 2JQ4A 5HV8A 3CE7A 2FVAA 2FHSC 2CNRA 2K94A 4MRTC 1ACPA 2KOPA 2CG5B 1T8KA 2KR5A 2JGPA 2N50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL8 A;  2N98 A;  2LKI A;  2L4B A;  2MVU A;  2MF4 A;  2LIW A;  2KOR A;  4IZ6 A;  2KGA A;  2GDW A;  2K0Y A;  2MD9 A;  2FQ1 A;  2XZ1 C;  2FVF A;  5EJD A;  2PNG A;  2AFD A;  2KOS A;  2MY5 A;  4CA3 A;  5KP8 B;  2AF8 A;  2ROQ A;  2FAD A;  2GDY A;  2N5I A;  2JU2 A;  2K92 A;  1HQB A;  2AFE A;  2K0X A;  2N6Y A;  4BPH A;  2KGC A;  2LOL A;  2CQ8 A;  2KGD A;  1L0H A;  3EJB A;  2KWL A;  2MR8 A;  2QNW A;  1KLP A;  2FQ0 A;  2JU1 A;  2KG9 A;  4NEO A;  4H2Y C;  4H2W C;  3EJE A;  1VKU A;  2K2Q A;  2FVE A;  2EHS A;  5KP6 B;  2KOQ A;  1OR5 A;  2LML A;  2XZ0 D;  3GZL A;  5KP7 B;  1HY8 A;  2L0Q A;  5HVC A;  2LPK A;  1AF8 A;  2KGE A;  1NQ4 A;  2FQ2 A;  1DNY A;  2MVV A;  2EHT A;  2M5R A;  4BPG A;  2KG8 A;  2VSQ A;  5CZD B;  4HKG A;  4PWV B;  2GDX A;  4PXH B;  2FAC A;  2DNW A;  3RG2 A;  2LTE A;  2LIU A;  3NY7 B;  1DV5 A;  2AVA A;  4DG9 A;  2FAE A;  3GZM A;  3LMO A;  1X3O A;  2CGQ A;  2KOO A;  2KW2 A;  2KG6 A;  2L9F A;  3EJD A;  4BPF A;  2X2B A;  2K93 A;  2L22 A;  2N6Z A;  4R0M A;  2MR7 A;  1L0I A;  4H2X C;  2N5H A;  1F80 D;  2JQ4 A;  5HV8 A;  3CE7 A;  2FVA A;  2FHS C;  2CNR A;  2K94 A;  4MRT C;  1ACP A;  2KOP A;  2CG5 B;  1T8K A;  2KR5 A;  2JGP A;  2N50 A; 
#chains in the Genus database with same CATH topology
 2LL8 A;  2N98 A;  1VQN P;  5EW5 E;  2LIW A;  4IZ6 A;  1EIA A;  1M6E X;  2FVF A;  2OAR A;  3G28 A;  2PNG A;  2KOS A;  1Q7Y Q;  1N8R Q;  2Z45 A;  1VQ6 P;  2QEX P;  2JU2 A;  2CWO A;  2N6Y A;  2VLN A;  4GR2 A;  2ERH A;  2KGD A;  2Z46 A;  1YJ9 P;  1YHQ P;  2JU1 A;  4H2Y C;  4H2W C;  3EJE A;  4IPY A;  1VHN A;  1QRJ A;  5KP6 B;  3G1I A;  1E6J P;  1GPJ A;  1KC8 Q;  1CEI A;  2JO0 A;  2L0Q A;  1BAJ A;  1EMV A;  2KGE A;  3CC2 P;  2OTL P;  1K8A Q;  1VQ5 P;  2LF4 A;  2MVV A;  2EHT A;  4XRQ A;  3I56 P;  3E2D A;  3HZQ A;  3H47 A;  4PWV B;  5F2K A;  1RO0 A;  2DNW A;  3G29 A;  2KOD A;  3NY7 B;  1RO2 A;  3GZM A;  3LMO A;  2CGQ A;  3GKL C;  3CXC O;  4BPF A;  2X2B A;  3WBH A;  1UNK A;  1L0I A;  2N5H A;  3G6E P;  4U0B A;  1F80 D;  2JQ4 A;  1E0H A;  5HV8 A;  1VQ8 P;  1AYI A;  2PEI A;  2CNR A;  2K94 A;  2E1M A;  1A8O A;  1Q82 Q;  3CME P;  1YJW P;  2KR5 A;  1KQS O;  2XXM A;  2MVU A;  5I4T G;  2NO8 A;  2GDW A;  1W2B O;  3CCJ P;  5F2O A;  2XZ1 C;  4U0C A;  2ROQ A;  2Z44 A;  3CPW O;  4U0F A;  2K92 A;  1VQK P;  2GZF A;  2K0X A;  1K73 Q;  2CQ8 A;  3EJB A;  2KWL A;  3VRL C;  1KLP A;  2PEO A;  5BS1 A;  2KG9 A;  1K30 A;  7CEI A;  1KD1 Q;  2PEK A;  3P05 A;  2QA4 P;  1UJZ A;  2KOQ A;  2LML A;  2XZ0 D;  2VLQ A;  5KP7 B;  4PH1 A;  2VLO A;  4PH0 A;  2VLP A;  2L6E A;  2KG8 A;  5CZD B;  2P9X A;  3B5I A;  2GDX A;  2GYK A;  4PXH B;  2FAC A;  1Q81 Q;  2EIA A;  4QNB A;  3CCL P;  2K0D X;  2M8L A;  1YI2 P;  1VQ7 P;  1K9M Q;  2PEM A;  4M0I A;  1IMQ A;  2PEN A;  1A43 A;  3NTE A;  2K93 A;  4R0M A;  4H2X C;  3CCU P;  3RG6 C;  3LRY A;  2PEQ A;  2OTJ P;  3Q20 A;  4U0D A;  3CC7 P;  2GZE A;  3CCE P;  2CG5 B;  4GR6 A;  3G0V A;  4XFX A;  2LKI A;  2L4B A;  2KOR A;  1NJI Q;  2EFJ A;  3CMA P;  5EJD A;  4COC A;  2ONT A;  3CC4 P;  5KP8 B;  2AF8 A;  5HGM A;  1RNI A;  2GDY A;  3MGE A;  2N5I A;  2JAZ A;  3DPH A;  2AFE A;  2XT1 A;  3G4S P;  4BPH A;  2LOL A;  3I55 P;  1GXG A;  1L0H A;  1S72 P;  5DCK A;  1VQ9 P;  3G1G A;  2FQ0 A;  4NEO A;  1VKU A;  2K2Q A;  1M74 A;  2M8P A;  2FVE A;  2JYL A;  2GZJ A;  1VQO P;  2JBG A;  5HVC A;  2LPK A;  5HGL A;  1NQ4 A;  5HGN A;  2FQ2 A;  3H4E A;  1DNY A;  1MZ8 A;  2WPT A;  1ZNV A;  3G21 A;  4BPG A;  3HYB A;  4HKG A;  3M1M A;  4F37 A;  2LTE A;  2LIU A;  4XFZ A;  4U0A A;  3CCR P;  1X3O A;  2KOO A;  2KG6 A;  2L9F A;  3EJD A;  1M6N A;  3DS1 A;  1M1K Q;  2BHV A;  1BXI A;  2PY8 A;  2MR7 A;  3DTJ A;  2M8N A;  3DS0 A;  2K5X A;  1JJ2 O;  3G71 P;  2GZG A;  2FHS C;  3DS2 A;  1ACP A;  1YIJ P;  1EOQ A;  1T8K A;  4COP A;  2DGY A;  2JGP A;  2MF4 A;  2BUO A;  1YJN P;  2KGA A;  4XRO A;  2K0Y A;  2MD9 A;  2FQ1 A;  2JYG A;  4UHP B;  2AFD A;  2MY5 A;  1M90 Q;  4CA3 A;  1FR2 A;  2FAD A;  1HQB A;  3B4Q A;  2KGC A;  3OW2 O;  1QVG O;  2MR8 A;  4XFY A;  4WYM A;  3CCM P;  1IUQ A;  2QNW A;  5JPA A;  3DS5 A;  3G26 A;  2EHS A;  5BS2 A;  1OR5 A;  5HGO A;  3GZL A;  1IMP A;  1HY8 A;  2XV6 A;  1AF8 A;  1VQL P;  2EG5 A;  2JB0 A;  2M5R A;  3U43 A;  1VQM P;  3CCS P;  1VQP P;  3DS4 A;  2VSQ A;  2GZI A;  3RG2 A;  3GJN A;  1DV5 A;  2AVA A;  4QKO A;  4DG9 A;  2FAE A;  1D1D A;  2KW2 A;  1AUM A;  3DS3 A;  4U0E A;  2L22 A;  2N6Z A;  3CCQ P;  2PEJ A;  1VQ4 P;  1YIT P;  3CE7 A;  2FVA A;  3CCV P;  4MRT C;  3H0D A;  1Z6M A;  2KOP A;  3CD6 P;  5F2N A;  1ZMB A;  1Q86 Q;  1GXH A;  2N50 A;  1QVF O; 
#chains in the Genus database with same CATH homology
 2LL8 A;  2N98 A;  2LKI A;  2L4B A;  2MVU A;  2MF4 A;  2LIW A;  2KOR A;  4IZ6 A;  2KGA A;  2GDW A;  2K0Y A;  2MD9 A;  2FQ1 A;  2XZ1 C;  2FVF A;  5EJD A;  2PNG A;  2AFD A;  2KOS A;  2MY5 A;  4CA3 A;  5KP8 B;  2AF8 A;  2ROQ A;  2FAD A;  2GDY A;  2N5I A;  2JU2 A;  2K92 A;  1HQB A;  2AFE A;  2K0X A;  2N6Y A;  4BPH A;  2KGC A;  2LOL A;  2CQ8 A;  2KGD A;  1L0H A;  3EJB A;  2KWL A;  2MR8 A;  2QNW A;  1KLP A;  2FQ0 A;  2JU1 A;  2KG9 A;  4NEO A;  4H2Y C;  4H2W C;  3EJE A;  1VKU A;  2K2Q A;  2FVE A;  2EHS A;  5KP6 B;  2KOQ A;  1OR5 A;  2LML A;  2XZ0 D;  3GZL A;  5KP7 B;  1HY8 A;  2L0Q A;  5HVC A;  2LPK A;  1AF8 A;  2KGE A;  1NQ4 A;  2FQ2 A;  1DNY A;  2MVV A;  2EHT A;  2M5R A;  4BPG A;  2KG8 A;  2VSQ A;  5CZD B;  4HKG A;  4PWV B;  2GDX A;  4PXH B;  2FAC A;  2DNW A;  3RG2 A;  2LTE A;  2LIU A;  3NY7 B;  1DV5 A;  2AVA A;  4DG9 A;  2FAE A;  3GZM A;  3LMO A;  1X3O A;  2CGQ A;  2KOO A;  2KW2 A;  2KG6 A;  2L9F A;  3EJD A;  4BPF A;  2X2B A;  2K93 A;  2L22 A;  2N6Z A;  4R0M A;  2MR7 A;  1L0I A;  4H2X C;  2N5H A;  1F80 D;  2JQ4 A;  5HV8 A;  3CE7 A;  2FVA A;  2FHS C;  2CNR A;  2K94 A;  4MRT C;  1ACP A;  2KOP A;  2CG5 B;  1T8K A;  2KR5 A;  2JGP A;  2N50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...