3CCQP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccqP02
1VQ9P 1K73Q 2OTJP 3CD6P 3CC4P 3CXCO 1QVGO 1JJ2O 3I55P 3CCMP 1VQLP 1Q86Q 3CCLP 3I56P 3G71P 3OW2O 1VQ5P 1YJWP 1YITP 1KQSO 1S72P 1VQKP 2OTLP 3CC7P 1VQMP 3CC2P 3CMAP 1VQ4P 3CCSP 1YI2P 2QA4P 3G6EP 3CCRP 1KD1Q 1YIJP 1Q81Q 1VQOP 3CCVP 3CCJP 1YHQP 3CMEP 1KC8Q 1VQ7P 1M90Q 1NJIQ 1VQ8P 3G4SP 1VQPP 1M1KQ 1K9MQ 1W2BO 1N8RQ 1QVFO 1YJ9P 1K8AQ 3CCEP 1Q7YQ 2QEXP 1YJNP 1VQ6P 3CCUP 1Q82Q 1VQNP 3CCQP 3CPWO
chains in the Genus database with same CATH superfamily
3RL0C 1E79H 1L0LG 2VLPA 2QSIA 1BE3J 3HYBA 4PH0A 2FYUD 1FZCB 1IO4A 1L0LE 1NTKE 3W67A 2WSFJ 1UIXA 3HTKB 1X3OA 2AFDA 2L6EA 4IPYA 2PP6A 2LKIA 3R2PA 4HYTB 3L75J 1URQD 2OYHB 2OGUA 1KILE 2LOLA 1VQNP 2XKMA 2WMMA 1LTJB 3CCMP 3CCLP 1J1DB 4U3FG 1NU1K 1VQMP 2KLUA 2FQ2A 4U3FE 1KN7A 5DCKA 2ZT9B 1H0TA 5H2FH 2YXRB 1K30A 3VYIA 3PRJA 1AFOA 1PGQA 4GR2A 1FOSE 3RL0B 2MR7A 3L37A 2KOPA 2RN0A 2KK7A 2Z5IA 4NPEA 3HD7A 1PFIA 4ZKPA 1HBWA 4D6TG 3H1JJ 3AE5C 2GYKA 1M6NA 2OYIA 3LW5J 2IBZD 2YMYA 3B5NA 2Z5HA 3L74J 3RK2C 5K5GB 4GT1A 1KYOD 5KAIE 1FDMA 3T97A 2OTLP 5AVUB 1DX7A 3BVHA 3P7KA 1VQ4P 2A06D 1JTHA 4UB8H 3M1MA 2XV5A 2D2CC 2E75B 2KSEA 2ZYGA 2JEEA 1LNQA 2X2BA 3JC22 3G21A 1USDA 1Y8AA 2O1JA 4WY4C 5GTIE 1NHLA 1YTZT 1JMMA 5KJ7A 1Q2NA 3HD7D 2QJYB 1DH3A 4GOFA 1CI6B 2AVAA 3Q5RA 3BCCG 1G1IA 2DNWA 4R4MA 1KLPA 1SVFA 5AVQB 1ZR4A 2N9YB 3A5TA 3BCCE 1T6AA 3B5ND 2PNGA 1E0HA 5AW0B 3I55P 4BRYB 1NTMD 4ZKUA 2DGYA 2H7HA 4H2YC 3WU2H 3L71G 2LF4A 3L72G 2D2CB 2PEIA 1YQ3C 1AUMA 4IFFA 2EHSA 3SWKA 3V6IA 1BCCG 1VQ9P 1JB0J 4KT0J 5KLIC 2LR2A 3TGUJ 4JYCA 4WY4B 1P84D 1NGMB 1RY3A 2JWDA 1GL2A 1SQQD 1BSHA 2JU2A 5KJ7D 1OIPA 2IPPA 3K5BA 1ZN5A 2QIWA 3IAOA 3CPWO 4PD4E 4C7NB 1IK9A 1HJBA 2GUVA 1SQXG 1SQPD 2E76C 3H25A 1LP1A 2W90A 4UB8E 4WWIA 3CX5H 4MN4C 1X8YA 3L4FA 2E1MA 5KLVK 1H88A 1BDDA 4C7RA 5AVYB 5KLIB 3H1IG 3DS5A 2WVRA 2P10A 1NH4A 3EQ2A 1BE3D 2YIUC 1GL2D 3L35A 2FQ0A 3B8EB 3GF3A 2JQ4A 4U0CA 1NVOA 3WU2E 2E76B 4F37A 3AEEC 2QM7A 2WPTA 5AW6B 1YQ4C 4Z1MH 3H1KG 3LRYA 1LGHB 4COPA 2B87A 1OVVA 4XFYA 4PV1D 5KLVJ 1PPJE 3GKLC 1NKNA 3P32A 3NTEA 2FYNB 2HODA 4GDOA 2YIUB 2XXMA 3SWFA 2M3EA 3L70E 1NOHA 3F5HA 2QJKC 2HR3A 3AE9C 2FXMA 2ZVNB 2SPZA 3GMAA 4W7YA 1JUNA 2EHTA 4R0MA 5BS2A 3DS1A 1LTBC 1IJDB 2KYVA 2IFMA 3PP5A 1J1EC 1FJKA 3H1LD 1E5WA 3G1GA 1MV8A 5B66H 1KD1Q 5CBOA 3W68A 2LIUA 1NU1D 3CX5E 3RK3C 3TSIA 1LTAC 2KG6A 4EDFA 1OX3A 5HGMA 3G28A 1J2JB 1SQVD 4LLHA 3EJEA 1GK6A 2G3AA 2WPVB 1S4XA 1L4AD 3I56P 3E2DA 4H13D 1PP9G 2M5AA 3DS2A 5AW8B 1PP9E 3H1HE 1NTZG 3L73G 2IDBA 2PEQA 2YO3A 1E6JP 1EIAA 2N50A 1CZQA 2IFNA 2ZYAA 3EFFK 1FS0E 4XFJA 1WRGA 1J1EB 1FZGA 3M91A 4W80A 2I1JA 4N78E 3H47A 1AQ5A 2C9LY 3RK3B 1N7LA 1M57D 1Z56A 4K3AA 1OXZA 2Q5UA 1KYOH 4QKOA 3VOPA 1EQ7A 2WITA 1Q86Q 1VPCA 2R32A 3AE1C 2FFDC 1AA0A 2AEFA 3HE4B 2XV6A 3TGUD 5DJTB 1LTIC 1OFCX 3USSA 2ROQA 1JY3N 2P7JA 4WBAA 3AE6C 2JR8A 3BASA 5E79E 2B9BA 1OW8A 2GA1A 3GJNA 2FYUE 1RE3A 3HE5B 4OGQC 1ZRTE 1VF5C 5KP6B 1N73A 5B66E 3VMYA 1L4AB 3HUSC 1OR5A 3B5IA 1Q81Q 3H1ID 3FGAD 1ZLLA 1M90Q 3PH0A 1HUCA 4GKGA 3VMXA 2QEXP 3V2NA 2LIWA 1YTZI 4I2LC 5CJ0A 2NPSA 1FBMA 3TNUB 2FFDB 1PL5A 1BXIA 3U1CA 1FU1A 1JOCA 2L5GB 1AYIA 3GLMA 3MP7B 1VQ8P 2FHSC 5BU8B 1W5CE 4H44D 4ZMDA 2KLVA 2WPRA 2FBWC 1SQBG 2YNYA 3VMAA 1VQ6P 3MHVA 1PGJA 3HTKA 3H1KD 2H88C 1IFNA 4OGQB 1P84H 1VF5B 3SFEC 1JY2N 1JNMA 1L0ND 2N5IA 3CC2P 2KG9A 3HUSB 1FDIA 5CCGC 3FWLA 1LTJA 1SS1A 4BPFA 3P8CE 2ONTA 4GODA 2IBZE 1SFCA 1KYOE 2PEKA 3CCQP 3P8MC 3KZIH 3CLQA 3AEBC 4YXWH 2WWWA 5KLVD 2J59M 1LWUC 1HY8A 2QE7H 2MD9A 1KB9I 3GG2A 1MUUA 3ABVC 2HFED 3GW6A 3U43A 3NTNA 3FXEA 1YJ9P 2FAEA 4O9BA 3VRLC 1QLED 1JJ2O 1NWQA 3CWBJ 2Q7CA 3TDKA 3O6QB 1SQQJ 3RG2A 3GF7A 2ERHA 1EZVG 1MKMA 5AVZB 2WSFH 1EZVE 1K9MQ 2BCCD 2OARA 1NTME 1M74A 5TISE 3H32A 3DS3A 1G1JA 2KZIA 3MGNA 1BDCA 2RKLA 5AVVB 2K94A 2JBGA 4U0AA 5KAIH 1RF0C 1LWUB 5AVRB 2Q3EA 2KGEA 2A45H 4XA4A 2AEMA 3H0DA 2POHA 2QVAA 5AVXB 1TU3F 1P84E 1PIXA 3WMM0 2Z44A 1NTKG 2FXOA 3JCUH 2N6YA 1MFZA 5CCHC 2GM4A 2MF4A 2KSJA 1KORA 1QGKB 5GTIH 1JY2O 1FZEA 1IFJA 1NQ4A 2LL8A 1Y9BA 3KDPB 2KS1B 3PLNA 2JAZA 2ZVOB 5AW5B 3KZIE 1N7SC 1KQFB 2QNWA 2N6ZA 3LW5H 5BU5A 2Q9IA 2PENA 3IFMA 1GD2E 2GZEA 4DG9A 1SQPE 4WYMA 4HH2A 2C0XA 3C1LA 4H2XC 1HGZA 1SQVK 1YBKA 4WY4A 3H6PA 4D6TJ 3N4XA 2E75C 2ZFCA 5APQA 4HB1A 1BGYD 4JBZA 1X79B 5KKZC 1G2CB 1URQC 5F2KA 5APSA 1S1CX 3AEAC 1BE3E 1NYHA 1QEXA 1M1JA 1VQ7P 4DOJA 1VQPP 3RK2D 4C7NA 2JO1A 2QJYC 2LTEA 3L75E 1N7SB 2E43A 1LT9C 3H1LJ 1AJYA 4WVZA 2KODA 2JYGA 3S4RA 1NAYA 2A45G 4PD4H 2QJPC 1NU1J 2PEMA 1RHZB 1FDOA 2YMKA 4XRQA 2R3SA 2Z46A 5CBNA 1ZMEC 1SQVJ 2CK3H 2W6AA 1IMPA 4EOTA 5APWA 3U1AA 4I7ZB 5KKZB 3G0VA 3JCUE 2K92A 2HG5D 2PAJA 1URQB 3RK3E 2KR5A 3CXHI 1RQVA 4YTPC 1SQXK 4RJTA 2CGQA 3V4QA 3H1JG 3L71J 2ITAA 2RH0A 4DJGA 2JWAA 3H1JE 3L74G 3L72J 2V7QJ 1QL1A 2VRSA 1LT9B 1T2KD 3L74E 1BCCJ 3C9IA 4IL6E 1H89A 2QJPB 4ASVA 5KP8B 1KC8Q 1FR2A 1NJIQ 1MFTA 2W83C 5F2OA 4M0IA 1KILA 2AF8A 1ZR2A 3CXHD 3B5NC 1SQXJ 2YXQB 1FAVA 2N1TA 2W6BA 3CWBD 2K0YA 1OVUA 4YXDC 4UB6H 3V2RA 1ZP0C 3KYQA 2KOSA 3A7OA 1Q7YQ 1L0NK 3CXCO 4MRTC 2E74D 2UWJE 5L8RJ 3AE8C 3AEDC 3H1IJ 1YYCA 1L0LD 3CCJP 3G29A 1HTLC 3CCEP 1RO0A 2IZ0A 1Q82Q 2Q3IA 3RL0g 3HD7B 1KILD 1VL2A 5APVA 1S5LE 3TGUE 5GTHE 3L36A 1FJPA 2FYNC 3B5NB 4U3FD 2AFEA 3HZQA 4NEOA 2N1TD 5HGOA 5JPAA 1FZBA 3T97B 1ZOYC 3H1KJ 1NAFA 1UIIA 1L0NJ 1UJZA 1RO2A 3BATA 1JTHB 1GW4A 3EJBA 4JF7A 1M6EX 2KB7P 2O3JA 2GDWA 4R4LA 1NTZK 2JJLA 2WSCH 2O1KA 2KG8A 1OVRA 2JYLA 3M0DA 1K8AQ 2XNXA 5AW7B 1RQUA 5HGNA 1PPJG 4DZOA 1LT1A 4D6TD 1GL2C 3VP8A 2M3BA 2ZJSE 2WZ7A 2QA4P 3L70G 2VLOA 3NY7B 3EJDA 1R5LA 3VMZA 2FY8A 2XNDH 1PGOA 3CI9A 4UB6E 1JO5A 4U0BA 5CMZA 1QVFO 2IZ1A 1Z6MA 2C0WA 2WPSA 5E79H 2N98A 3RG6C 5BS1A 5EFWB 2Y0CA 1GZLA 1GXHA 1RH5B 4PV1C 1FOSF 2GUSA 4Y99C 2L0QA 5EJDA 2MR8A 2BCCJ 1D1DA 1NTZJ 3L73J 4IZ6A 2FFDA 2P67A 3U59A 1LTSC 3KXDA 3V4WA 1HGVA 3KQGA 1K04A 5KLVE 1GL2B 1GW3A 3HRNA 3BCCD 3H1HG 3G6EP 1SP4A 4HJGH 2R3CA 1CEIA 4U0FA 1YHQP 2FXPA 3B4QA 1EDIA 1LTTC 4L76A 2K0DX 2KGDA 3V2PA 5B5EH 2MY5A 2AXTH 3L71D 5M1BA 1LP1B 3CD6P 1ZMBA 1GU4A 3L72D 5AVWB 1YITP 3LIEA 4KHXA 4PV1B 3Q1MA 4NPFX 1BCCD 1L4AC 4Y99B 5DJUB 2K93A 2YKOA 2PGDA 4H13C 1L0HA 4WB4A 2Q6QA 4ASWA 2GZIA 2XZRA 1RE4C 1EDLA 1S9KE 1SQBK 3C8VA 4XROA 2JU1A 1OW6A 2BHVA 4BPHA 2EG5A 1DEBA 5F2NA 2M8RA 1KFMA 1DD3A 2L22A 2KP8A 1XTGB 1SQXD 1BGYJ 4QMAA 2Y0EA 2FYUG 3DTJA 5CJ4A 3NMDA 2H8PD 1EDJA 2V4HA 2CPBA 4W7ZA 1AVOA 2B87B 1K05A 1L2PA 2KNCA 4H13B 1IC2A 4H0LD 2BEZF 2HODB 1SQBJ 2CPSA 3AECC 1VQLP 3OW2O 2KIKA 2QG4A 5TISH 1N86A 2WSEH 1JMBA 4IFMA 3EFGA 3AE4C 2JKVA 4U0DA 1BGYE 2AXCA 3CX5I 5B5EE 1FZCA 2AXTE 2GZJA 2OTKE 4AQRD 1NO4A 3OAKA 3Q5SA 4M3LA 1S3JA 1DNYA 3CC7P 3MUDC 1OMIA 2OYHA 3OA7A 1MZ9A 1S2EA 1RF1C 1DIPA 2IBZG 2JB0A 4L75A 4ZNCA 4XFZA 2M5AB 2KXPB 2AEJA 2GDXA 1YJNP 1FZAA 3TK1A 4LGDE 4H44C 2K9JB 4CPGA 2NPSD 1L0LK 1NTKK 2O01N 2A06E 2YKQA 1LTGC 4CA3A 4JPZB 2P2UA 1CSBA 1R5SA 2KORA 4HKZH 1EXJA 1RE3C 2O01H 4IL6X 2K5XA 2R5BA 1PV3A 2JO0A 3LIDA 1IFPA 3QWOC 5AW1B 3NFQA 4OVNF 3AEGC 2R44A 5HGLA 2E42A 5APYA 2NRGA 1N7SA 3WUTA 2BEQD 1RF1B 1PP9D 1IFDA 5APXA 3KPEA 2W6JH 1NTMG 1AVYA 1NTZD 4QNBA 3TF5A 3L73D 2QRXA 4H44B 1SFCD 1JM0A 5HVCA 1L0LJ 1NTKJ 2MVUA 4RO0A 2ZT9D 1ZXGA 2P58A 2KI7B 3SSUA 3CMEP 1IFMA 1KB9D 4N78D 1URQA 3RL0D 3E7KA 1N73B 1H8AA 4TLFA 1F80D 2NO8A 3CL3D 1WT6A 2P9XA 3AE3C 2OTJP 1USEA 3CXHE 3PJSK 2N5HA 4GR6A 3RBXA 4COCA 1SQQG 1CI6A 3CWBE 4U3FJ 1A02F 1SQQE 1LT9A 3FXDA 4BRYA 2Y9YA 1S5LX 1NKZB 2MVVA 1GPJA 2JDIH 7CEIA 4DT0A 1AV1A 3ITKA 3VP9A 2BASA 1SQPG 4N3YB 1S72P 3BRTB 1ZW0A 4IL6H 1DV5A 1HJ0A 1ZRTD 1U7MA 1HH0A 3S9OA 1IMQA 1IZNB 2E75D 2NZ2A 3Q2YA 2HPCB 2R5DA 2CG5B 2WT7B 2IBZI 4EIJA 1WMKA 4I7ZC 5CZDB 4C46A 2KOQA 2VSQA 1KYOI 1BE3G 4EYYQ 1SFCB 1PGPA 4PWVB 1GU5A 3R4YA 2L91A 1M1KQ 1MZ8A 1RNIA 3L75G 3LMOA 4NPDA 3GHGC 2V7QH 2M5RA 1SQBD 3GZLA 2HLOA 1PEMA 4PJ0H 2XDJA 3CCSP 4B86A 2FVEA 2D2CD 5KP7B 4BPGA 1W2EA 3MIWA 1IUQA 5APUA 3M9HA 4A7PA 3P8CD 1EZVI 4D6TE 3BRVB 3Q5PA 3A0BH 4WY4D 3II6A 4L74A 3BCCJ 3IF4A 3E1RA 5KAFH 3M0AA 3E1IA 2PRRA 1S5LH 2L4BA 2K0XA 5GTHH 3H32B 3TYYA 4I1LA 3G4SP 5AW4B 2PFXA 1VKUA 2WPQA 2IYPA 3H1LG 2K1AA 3GHGB 4OWFA 2B88A 2KWLA 2LXBA 3WUUA 3H1LE 1YJWP 1NU1G 1GXGA 1D7MA 1P84I 3B71A 1NU1E 4OH8B 4UHPB 3G26A 1SQVG 2K37A 1SQVE 3IR9A 1EZVD 1JCCA 1HVVA 1ACPA 1M1JC 3RK2B 3HD7C 4L73A 2EFJA 2VLNA 2IYOA 3DS0A 3SFDC 2KOOA 2K9YA 4PXHB 1T2KC 2OYIC 5APTA 1EXIA 2XU6A 4U7JA 1X0TA 5H2FE 3L71E 2KUBA 5AVTB 2Z45A 3L72E 2E76D 1BCCE 5AVSB 4PJ0E 1H0TB 1OWAA 1YIJP 3CCVP 1PEUA 1NTKD 1X9VA 2YO2A 2JP3A 1KQLA 1QL2A 2CWOA 3A0BE 2E5YA 2YKPA 3CE7A 4AYCA 4TT3H 1M1JB 5KJ7C 3TGUG 5KAFE 2Z4EA 1KV4A 2RMZA 2ZXXA 4Y28J 2OYIB 3CCRP 1GTWA 2E74C 1SQXE 4AUWA 2ZXEB 2A45I 1HWTC 1ZV8A 2FKWB 5TJHA 1PEOA 1JY3P 4K35A 1KQGB 2GZGA 2W8ZA 3FX0A 3F89A 3H1IE 1KILC 1PZQA 1IFIA 1U7JA 3L70J 1T3JA 3NXSA 1W2BO 2LKMA 3D70A 1FE6A 2FACA 5C39A 3HE4A 2ZYDA 3A2AA 2N1TC 3L75D 2PEOA 1LJ2A 5BVZA 2Y0DA 1N2DC 1YI2P 1R8EA 1T8KA 1KB9H 2E74B 1OZHA 1M7LA 1M56D 1Q90D 3HE5A 3RBZA 4DCKA 3JSVC 4PH1A 4H2WC 3QH9A 1L4AA 1L0NG 3H1KE 3MTUE 1A02J 1L0NE 1RE4A 3D71A 3GZMA 2JGPA 1DEEG 1KILB 3RK3D 1PP9J 2IX7C 1M8OB 2KOGA 3G3ZA 3H1HJ 3VN0A 3B4SA 1JY2P 1KTMA 3TNUA 5AW9B 1KMIZ 5HV8A 1HQBA 3H1JD 5KLVG 2FYUK 2N1TB 4GIFA 1EC5A 2J5UA 3IN6A 1L0IA 3L74D 2XZ0D 4PD4I 2FQ1A 4HKGA 1OW7A 2WSCJ 2K88A 2LMLA 1AF8A 2M0BA 3D6ZA 4JQ0D 4RKUJ 2M8NA 5EW5E 3HUSA 2I8DA 2M8LA 3DPHA 3I5CA 1QVGO 3M0DC 2MKVA 1XTCC 3V2QA 2H43A 1GK4A 2XZ1C 2BCCG 2MJZA 1VQOP 2BQ1E 2B89A 2K9JA 2J58A 2BCCE 2QJKB 1NTZE 1HF9A 2N9BA 3L73E 3S1KA 2FYUJ 1JCDA 3M9BA 3UIAA 2KW2A 2M8PA 1VQKP 3AE7C 4PD4D 3CMAP 1KB9E 1T8ZA 2CQ8A 1GMJA 2FVAA 1EDKA 3Q3DA 2GZFA 3PTZA 2K3RA 2W27A 3V5BA 3MUDA 4OGQD 1VF5D 3AE2C 3O6QA 5CCGA 1KZUB 1RF1A 1SLQA 2FYZA 2BUOA 4XFXA 3OJAB 3M06A 1X22A 3SWYA 2C9NY 4I6MC 1LWUA 2L9FA 4LC1A 2PY8A 4YPCA 2EIAA 1VQ5P 1VHNA 3FWNA 5AW2B 2G8YA 2Y9ZA 1BGYG 3M9QA 3G9RA 2OYOA 3MZWB 1AQTA 1NTMK 3WBHA 2QM8A 2E5TA 3A0HH 3Q20A 1DD4A 1FZFA 4H0LC 2DW3A 3CC4P 2I1KA 5CCGD 3G71P 1QRJA 1T3UA 3CXHH 1IK7A 4U0EA 2KS1A 2H89C 3VTPC 1PPJD 3A3YB 1ZNVA 4RESB 3RGUA 1N8RQ 3AEFC 3L70D 1RF0A 4BXLA 1SQBE 2GDYA 1GDTA 2Q1KA 2WSSH 2HPCA 2A06G 2WT7A 5CHXA 2KGCA 1SQQK 2KZJA 3DS4A 2VLQA 2P1JA 4IOIH 3WUVA 4KJMA 2WTYA 5I4TG 1FC2C 1G2CA 3O8ZA 4GOEA 3KHUA 1N73C 3CX5D 5CCHA 4XE5B 1NTMJ 3PHLA 4H0LB 1CW5A 1K73Q 1SQPK 2WSEJ 2LXCB 1KQSO 2PEJA 3MGEA 4BWNA 1QX8A 2NPSC 1EMVA 2WQYC 3H1HD 1EOQA 2ZAEB 1JY3O 3CCUP 1BSNA 3G1IA 3H4EA 2XT1A 1FZCC 2OQQA 3N7NA 5AW3B 2FVFA 3ZDMA 1A8OA 4IFDK 2FADA 1KFNA 2OYHC 2LPKA 2CNRA 3A0HE 2HYNA 1S9KD 2KNCB 5CCHD 1LTJC 5KTBA 1SQPJ 1Y47A 1J1DC 3CWBG 1U57A 4N6JA 1BAJA 2KGAA 3EWKA 3P05A 1SFCC 2O01J 2K2QA 3GHGA 3D6YA 2NPSB 1UNKA 1N7SD 4JYBA 4EI2A 3MD0A 2ZT9C 1PEQA 1VDFA 1A43A 1JEKA
chains in the Genus database with same CATH topology
3RG6C 5BS1A 2PEOA 1M74A 2EFJA 3CXCO 3G21A 3DS3A 3I56P 3E2DA 5HGLA 3HYBA 2M8PA 4PH0A 3DS0A 3DS5A 1VQKP 2KODA 2JYGA 3DS2A 4U0AA 3DS4A 3CMAP 2PEMA 1YI2P 3CCJP 3G29A 4XRQA 1VQ8P 2Z46A 5I4TG 1D1DA 1M1KQ 2PEQA 1RNIA 2L6EA 1E6JP 4IPYA 4PH1A 1EIAA 3H0DA 3CCEP 2Z45A 1RO0A 1VQ6P 4QNBA 1Q82Q 1VQNP 1K73Q 3G0VA 3I55P 3CCMP 1VQLP 2Z44A 3CCLP 3OW2O 1KQSO 2BUOA 4XFXA 4U0CA 1PEMA 1VQMP 3CC2P 2DGYA 2PEJA 3CCSP 3G6EP 3MGEA 1YIJP 3CCVP 1YHQP 4U0FA 3CMEP 1PEUA 4U0DA 1IUQA 3H47A 3HZQA 5DCKA 2ONTA 5HGOA 5JPAA 2LF4A 1EOQA 1K30A 2CWOA 3LRYA 4COPA 2PEIA 4XFYA 1AUMA 3CCUP 2PEKA 3CCQP 2PY8A 2P9XA 4GR2A 1VQ9P 2OTJP 2EIAA 3CD6P 3G1IA 3H4EA 1ZMBA 2XT1A 1RO2A 1Q86Q 4GR6A 2PENA 1VQ5P 1YITP 4WYMA 4COCA 3CC7P 3NTEA 1M6EX 3CCRP 2XV6A 2XXMA 1KC8Q 1NJIQ 3G4SP 4XFZA 1A8OA 2JYLA 2M8NA 5F2OA 1YJ9P 1M6NA 1K8AQ 4M0IA 1YJNP 3WBHA 2M8LA 3Q20A 5BS2A 3VRLC 3DPHA 5HGNA 3CPWO 1PEOA 4XROA 3DS1A 3CC4P 1QVGO 1JJ2O 2BHVA 3G71P 1QRJA 5F2KA 1YJWP 1S72P 4U0EA 2OTLP 1BAJA 2EG5A 3G1GA 5F2NA 3P05A 1VQ4P 2QA4P 1KD1Q 3B5IA 3G26A 1Q81Q 1VQOP 2BQ1E 1VQ7P 1M90Q 1VQPP 1K9MQ 4U0BA 1W2BO 1N8RQ 2JO0A 1PEQA 3M1MA 1QVFO 2OARA 5HGMA 2QEXP 3G28A 1Q7YQ 3DTJA 1A43A 2E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ9 P;  1K73 Q;  2OTJ P;  3CD6 P;  3CC4 P;  3CXC O;  1QVG O;  1JJ2 O;  3I55 P;  3CCM P;  1VQL P;  1Q86 Q;  3CCL P;  3I56 P;  3G71 P;  3OW2 O;  1VQ5 P;  1YJW P;  1YIT P;  1KQS O;  1S72 P;  1VQK P;  2OTL P;  3CC7 P;  1VQM P;  3CC2 P;  3CMA P;  1VQ4 P;  3CCS P;  1YI2 P;  2QA4 P;  3G6E P;  3CCR P;  1KD1 Q;  1YIJ P;  1Q81 Q;  1VQO P;  3CCV P;  3CCJ P;  1YHQ P;  3CME P;  1KC8 Q;  1VQ7 P;  1M90 Q;  1NJI Q;  1VQ8 P;  3G4S P;  1VQP P;  1M1K Q;  1K9M Q;  1W2B O;  1N8R Q;  1QVF O;  1YJ9 P;  1K8A Q;  3CCE P;  1Q7Y Q;  2QEX P;  1YJN P;  1VQ6 P;  3CCU P;  1Q82 Q;  1VQN P;  3CCQ P;  3CPW O; 
#chains in the Genus database with same CATH topology
 3RL0 C;  1E79 H;  1L0L G;  2VLP A;  2QSI A;  1BE3 J;  3HYB A;  4PH0 A;  2FYU D;  1FZC B;  1IO4 A;  1L0L E;  1NTK E;  3W67 A;  2WSF J;  1UIX A;  3HTK B;  1X3O A;  2AFD A;  2L6E A;  4IPY A;  2PP6 A;  2LKI A;  3R2P A;  4HYT B;  3L75 J;  1URQ D;  2OYH B;  2OGU A;  1KIL E;  2LOL A;  1VQN P;  2XKM A;  2WMM A;  1LTJ B;  3CCM P;  3CCL P;  1J1D B;  4U3F G;  1NU1 K;  1VQM P;  2KLU A;  2FQ2 A;  4U3F E;  1KN7 A;  5DCK A;  2ZT9 B;  1H0T A;  5H2F H;  2YXR B;  1K30 A;  3VYI A;  3PRJ A;  1AFO A;  1PGQ A;  4GR2 A;  1FOS E;  3RL0 B;  2MR7 A;  3L37 A;  2KOP A;  2RN0 A;  2KK7 A;  2Z5I A;  4NPE A;  3HD7 A;  1PFI A;  4ZKP A;  1HBW A;  4D6T G;  3H1J J;  3AE5 C;  2GYK A;  1M6N A;  2OYI A;  3LW5 J;  2IBZ D;  2YMY A;  3B5N A;  2Z5H A;  3L74 J;  3RK2 C;  5K5G B;  4GT1 A;  1KYO D;  5KAI E;  1FDM A;  3T97 A;  2OTL P;  5AVU B;  1DX7 A;  3BVH A;  3P7K A;  1VQ4 P;  2A06 D;  1JTH A;  4UB8 H;  3M1M A;  2XV5 A;  2D2C C;  2E75 B;  2KSE A;  2ZYG A;  2JEE A;  1LNQ A;  2X2B A;  3JC2 2;  3G21 A;  1USD A;  1Y8A A;  2O1J A;  4WY4 C;  5GTI E;  1NHL A;  1YTZ T;  1JMM A;  5KJ7 A;  1Q2N A;  3HD7 D;  2QJY B;  1DH3 A;  4GOF A;  1CI6 B;  2AVA A;  3Q5R A;  3BCC G;  1G1I A;  2DNW A;  4R4M A;  1KLP A;  1SVF A;  5AVQ B;  1ZR4 A;  2N9Y B;  3A5T A;  3BCC E;  1T6A A;  3B5N D;  2PNG A;  1E0H A;  5AW0 B;  3I55 P;  4BRY B;  1NTM D;  4ZKU A;  2DGY A;  2H7H A;  4H2Y C;  3WU2 H;  3L71 G;  2LF4 A;  3L72 G;  2D2C B;  2PEI A;  1YQ3 C;  1AUM A;  4IFF A;  2EHS A;  3SWK A;  3V6I A;  1BCC G;  1VQ9 P;  1JB0 J;  4KT0 J;  5KLI C;  2LR2 A;  3TGU J;  4JYC A;  4WY4 B;  1P84 D;  1NGM B;  1RY3 A;  2JWD A;  1GL2 A;  1SQQ D;  1BSH A;  2JU2 A;  5KJ7 D;  1OIP A;  2IPP A;  3K5B A;  1ZN5 A;  2QIW A;  3IAO A;  3CPW O;  4PD4 E;  4C7N B;  1IK9 A;  1HJB A;  2GUV A;  1SQX G;  1SQP D;  2E76 C;  3H25 A;  1LP1 A;  2W90 A;  4UB8 E;  4WWI A;  3CX5 H;  4MN4 C;  1X8Y A;  3L4F A;  2E1M A;  5KLV K;  1H88 A;  1BDD A;  4C7R A;  5AVY B;  5KLI B;  3H1I G;  3DS5 A;  2WVR A;  2P10 A;  1NH4 A;  3EQ2 A;  1BE3 D;  2YIU C;  1GL2 D;  3L35 A;  2FQ0 A;  3B8E B;  3GF3 A;  2JQ4 A;  4U0C A;  1NVO A;  3WU2 E;  2E76 B;  4F37 A;  3AEE C;  2QM7 A;  2WPT A;  5AW6 B;  1YQ4 C;  4Z1M H;  3H1K G;  3LRY A;  1LGH B;  4COP A;  2B87 A;  1OVV A;  4XFY A;  4PV1 D;  5KLV J;  1PPJ E;  3GKL C;  1NKN A;  3P32 A;  3NTE A;  2FYN B;  2HOD A;  4GDO A;  2YIU B;  2XXM A;  3SWF A;  2M3E A;  3L70 E;  1NOH A;  3F5H A;  2QJK C;  2HR3 A;  3AE9 C;  2FXM A;  2ZVN B;  2SPZ A;  3GMA A;  4W7Y A;  1JUN A;  2EHT A;  4R0M A;  5BS2 A;  3DS1 A;  1LTB C;  1IJD B;  2KYV A;  2IFM A;  3PP5 A;  1J1E C;  1FJK A;  3H1L D;  1E5W A;  3G1G A;  1MV8 A;  5B66 H;  1KD1 Q;  5CBO A;  3W68 A;  2LIU A;  1NU1 D;  3CX5 E;  3RK3 C;  3TSI A;  1LTA C;  2KG6 A;  4EDF A;  1OX3 A;  5HGM A;  3G28 A;  1J2J B;  1SQV D;  4LLH A;  3EJE A;  1GK6 A;  2G3A A;  2WPV B;  1S4X A;  1L4A D;  3I56 P;  3E2D A;  4H13 D;  1PP9 G;  2M5A A;  3DS2 A;  5AW8 B;  1PP9 E;  3H1H E;  1NTZ G;  3L73 G;  2IDB A;  2PEQ A;  2YO3 A;  1E6J P;  1EIA A;  2N50 A;  1CZQ A;  2IFN A;  2ZYA A;  3EFF K;  1FS0 E;  4XFJ A;  1WRG A;  1J1E B;  1FZG A;  3M91 A;  4W80 A;  2I1J A;  4N78 E;  3H47 A;  1AQ5 A;  2C9L Y;  3RK3 B;  1N7L A;  1M57 D;  1Z56 A;  4K3A A;  1OXZ A;  2Q5U A;  1KYO H;  4QKO A;  3VOP A;  1EQ7 A;  2WIT A;  1Q86 Q;  1VPC A;  2R32 A;  3AE1 C;  2FFD C;  1AA0 A;  2AEF A;  3HE4 B;  2XV6 A;  3TGU D;  5DJT B;  1LTI C;  1OFC X;  3USS A;  2ROQ A;  1JY3 N;  2P7J A;  4WBA A;  3AE6 C;  2JR8 A;  3BAS A;  5E79 E;  2B9B A;  1OW8 A;  2GA1 A;  3GJN A;  2FYU E;  1RE3 A;  3HE5 B;  4OGQ C;  1ZRT E;  1VF5 C;  5KP6 B;  1N73 A;  5B66 E;  3VMY A;  1L4A B;  3HUS C;  1OR5 A;  3B5I A;  1Q81 Q;  3H1I D;  3FGA D;  1ZLL A;  1M90 Q;  3PH0 A;  1HUC A;  4GKG A;  3VMX A;  2QEX P;  3V2N A;  2LIW A;  1YTZ I;  4I2L C;  5CJ0 A;  2NPS A;  1FBM A;  3TNU B;  2FFD B;  1PL5 A;  1BXI A;  3U1C A;  1FU1 A;  1JOC A;  2L5G B;  1AYI A;  3GLM A;  3MP7 B;  1VQ8 P;  2FHS C;  5BU8 B;  1W5C E;  4H44 D;  4ZMD A;  2KLV A;  2WPR A;  2FBW C;  1SQB G;  2YNY A;  3VMA A;  1VQ6 P;  3MHV A;  1PGJ A;  3HTK A;  3H1K D;  2H88 C;  1IFN A;  4OGQ B;  1P84 H;  1VF5 B;  3SFE C;  1JY2 N;  1JNM A;  1L0N D;  2N5I A;  3CC2 P;  2KG9 A;  3HUS B;  1FDI A;  5CCG C;  3FWL A;  1LTJ A;  1SS1 A;  4BPF A;  3P8C E;  2ONT A;  4GOD A;  2IBZ E;  1SFC A;  1KYO E;  2PEK A;  3CCQ P;  3P8M C;  3KZI H;  3CLQ A;  3AEB C;  4YXW H;  2WWW A;  5KLV D;  2J59 M;  1LWU C;  1HY8 A;  2QE7 H;  2MD9 A;  1KB9 I;  3GG2 A;  1MUU A;  3ABV C;  2HFE D;  3GW6 A;  3U43 A;  3NTN A;  3FXE A;  1YJ9 P;  2FAE A;  4O9B A;  3VRL C;  1QLE D;  1JJ2 O;  1NWQ A;  3CWB J;  2Q7C A;  3TDK A;  3O6Q B;  1SQQ J;  3RG2 A;  3GF7 A;  2ERH A;  1EZV G;  1MKM A;  5AVZ B;  2WSF H;  1EZV E;  1K9M Q;  2BCC D;  2OAR A;  1NTM E;  1M74 A;  5TIS E;  3H32 A;  3DS3 A;  1G1J A;  2KZI A;  3MGN A;  1BDC A;  2RKL A;  5AVV B;  2K94 A;  2JBG A;  4U0A A;  5KAI H;  1RF0 C;  1LWU B;  5AVR B;  2Q3E A;  2KGE A;  2A45 H;  4XA4 A;  2AEM A;  3H0D A;  2POH A;  2QVA A;  5AVX B;  1TU3 F;  1P84 E;  1PIX A;  3WMM 0;  2Z44 A;  1NTK G;  2FXO A;  3JCU H;  2N6Y A;  1MFZ A;  5CCH C;  2GM4 A;  2MF4 A;  2KSJ A;  1KOR A;  1QGK B;  5GTI H;  1JY2 O;  1FZE A;  1IFJ A;  1NQ4 A;  2LL8 A;  1Y9B A;  3KDP B;  2KS1 B;  3PLN A;  2JAZ A;  2ZVO B;  5AW5 B;  3KZI E;  1N7S C;  1KQF B;  2QNW A;  2N6Z A;  3LW5 H;  5BU5 A;  2Q9I A;  2PEN A;  3IFM A;  1GD2 E;  2GZE A;  4DG9 A;  1SQP E;  4WYM A;  4HH2 A;  2C0X A;  3C1L A;  4H2X C;  1HGZ A;  1SQV K;  1YBK A;  4WY4 A;  3H6P A;  4D6T J;  3N4X A;  2E75 C;  2ZFC A;  5APQ A;  4HB1 A;  1BGY D;  4JBZ A;  1X79 B;  5KKZ C;  1G2C B;  1URQ C;  5F2K A;  5APS A;  1S1C X;  3AEA C;  1BE3 E;  1NYH A;  1QEX A;  1M1J A;  1VQ7 P;  4DOJ A;  1VQP P;  3RK2 D;  4C7N A;  2JO1 A;  2QJY C;  2LTE A;  3L75 E;  1N7S B;  2E43 A;  1LT9 C;  3H1L J;  1AJY A;  4WVZ A;  2KOD A;  2JYG A;  3S4R A;  1NAY A;  2A45 G;  4PD4 H;  2QJP C;  1NU1 J;  2PEM A;  1RHZ B;  1FDO A;  2YMK A;  4XRQ A;  2R3S A;  2Z46 A;  5CBN A;  1ZME C;  1SQV J;  2CK3 H;  2W6A A;  1IMP A;  4EOT A;  5APW A;  3U1A A;  4I7Z B;  5KKZ B;  3G0V A;  3JCU E;  2K92 A;  2HG5 D;  2PAJ A;  1URQ B;  3RK3 E;  2KR5 A;  3CXH I;  1RQV A;  4YTP C;  1SQX K;  4RJT A;  2CGQ A;  3V4Q A;  3H1J G;  3L71 J;  2ITA A;  2RH0 A;  4DJG A;  2JWA A;  3H1J E;  3L74 G;  3L72 J;  2V7Q J;  1QL1 A;  2VRS A;  1LT9 B;  1T2K D;  3L74 E;  1BCC J;  3C9I A;  4IL6 E;  1H89 A;  2QJP B;  4ASV A;  5KP8 B;  1KC8 Q;  1FR2 A;  1NJI Q;  1MFT A;  2W83 C;  5F2O A;  4M0I A;  1KIL A;  2AF8 A;  1ZR2 A;  3CXH D;  3B5N C;  1SQX J;  2YXQ B;  1FAV A;  2N1T A;  2W6B A;  3CWB D;  2K0Y A;  1OVU A;  4YXD C;  4UB6 H;  3V2R A;  1ZP0 C;  3KYQ A;  2KOS A;  3A7O A;  1Q7Y Q;  1L0N K;  3CXC O;  4MRT C;  2E74 D;  2UWJ E;  5L8R J;  3AE8 C;  3AED C;  3H1I J;  1YYC A;  1L0L D;  3CCJ P;  3G29 A;  1HTL C;  3CCE P;  1RO0 A;  2IZ0 A;  1Q82 Q;  2Q3I A;  3RL0 g;  3HD7 B;  1KIL D;  1VL2 A;  5APV A;  1S5L E;  3TGU E;  5GTH E;  3L36 A;  1FJP A;  2FYN C;  3B5N B;  4U3F D;  2AFE A;  3HZQ A;  4NEO A;  2N1T D;  5HGO A;  5JPA A;  1FZB A;  3T97 B;  1ZOY C;  3H1K J;  1NAF A;  1UII A;  1L0N J;  1UJZ A;  1RO2 A;  3BAT A;  1JTH B;  1GW4 A;  3EJB A;  4JF7 A;  1M6E X;  2KB7 P;  2O3J A;  2GDW A;  4R4L A;  1NTZ K;  2JJL A;  2WSC H;  2O1K A;  2KG8 A;  1OVR A;  2JYL A;  3M0D A;  1K8A Q;  2XNX A;  5AW7 B;  1RQU A;  5HGN A;  1PPJ G;  4DZO A;  1LT1 A;  4D6T D;  1GL2 C;  3VP8 A;  2M3B A;  2ZJS E;  2WZ7 A;  2QA4 P;  3L70 G;  2VLO A;  3NY7 B;  3EJD A;  1R5L A;  3VMZ A;  2FY8 A;  2XND H;  1PGO A;  3CI9 A;  4UB6 E;  1JO5 A;  4U0B A;  5CMZ A;  1QVF O;  2IZ1 A;  1Z6M A;  2C0W A;  2WPS A;  5E79 H;  2N98 A;  3RG6 C;  5BS1 A;  5EFW B;  2Y0C A;  1GZL A;  1GXH A;  1RH5 B;  4PV1 C;  1FOS F;  2GUS A;  4Y99 C;  2L0Q A;  5EJD A;  2MR8 A;  2BCC J;  1D1D A;  1NTZ J;  3L73 J;  4IZ6 A;  2FFD A;  2P67 A;  3U59 A;  1LTS C;  3KXD A;  3V4W A;  1HGV A;  3KQG A;  1K04 A;  5KLV E;  1GL2 B;  1GW3 A;  3HRN A;  3BCC D;  3H1H G;  3G6E P;  1SP4 A;  4HJG H;  2R3C A;  1CEI A;  4U0F A;  1YHQ P;  2FXP A;  3B4Q A;  1EDI A;  1LTT C;  4L76 A;  2K0D X;  2KGD A;  3V2P A;  5B5E H;  2MY5 A;  2AXT H;  3L71 D;  5M1B A;  1LP1 B;  3CD6 P;  1ZMB A;  1GU4 A;  3L72 D;  5AVW B;  1YIT P;  3LIE A;  4KHX A;  4PV1 B;  3Q1M A;  4NPF X;  1BCC D;  1L4A C;  4Y99 B;  5DJU B;  2K93 A;  2YKO A;  2PGD A;  4H13 C;  1L0H A;  4WB4 A;  2Q6Q A;  4ASW A;  2GZI A;  2XZR A;  1RE4 C;  1EDL A;  1S9K E;  1SQB K;  3C8V A;  4XRO A;  2JU1 A;  1OW6 A;  2BHV A;  4BPH A;  2EG5 A;  1DEB A;  5F2N A;  2M8R A;  1KFM A;  1DD3 A;  2L22 A;  2KP8 A;  1XTG B;  1SQX D;  1BGY J;  4QMA A;  2Y0E A;  2FYU G;  3DTJ A;  5CJ4 A;  3NMD A;  2H8P D;  1EDJ A;  2V4H A;  2CPB A;  4W7Z A;  1AVO A;  2B87 B;  1K05 A;  1L2P A;  2KNC A;  4H13 B;  1IC2 A;  4H0L D;  2BEZ F;  2HOD B;  1SQB J;  2CPS A;  3AEC C;  1VQL P;  3OW2 O;  2KIK A;  2QG4 A;  5TIS H;  1N86 A;  2WSE H;  1JMB A;  4IFM A;  3EFG A;  3AE4 C;  2JKV A;  4U0D A;  1BGY E;  2AXC A;  3CX5 I;  5B5E E;  1FZC A;  2AXT E;  2GZJ A;  2OTK E;  4AQR D;  1NO4 A;  3OAK A;  3Q5S A;  4M3L A;  1S3J A;  1DNY A;  3CC7 P;  3MUD C;  1OMI A;  2OYH A;  3OA7 A;  1MZ9 A;  1S2E A;  1RF1 C;  1DIP A;  2IBZ G;  2JB0 A;  4L75 A;  4ZNC A;  4XFZ A;  2M5A B;  2KXP B;  2AEJ A;  2GDX A;  1YJN P;  1FZA A;  3TK1 A;  4LGD E;  4H44 C;  2K9J B;  4CPG A;  2NPS D;  1L0L K;  1NTK K;  2O01 N;  2A06 E;  2YKQ A;  1LTG C;  4CA3 A;  4JPZ B;  2P2U A;  1CSB A;  1R5S A;  2KOR A;  4HKZ H;  1EXJ A;  1RE3 C;  2O01 H;  4IL6 X;  2K5X A;  2R5B A;  1PV3 A;  2JO0 A;  3LID A;  1IFP A;  3QWO C;  5AW1 B;  3NFQ A;  4OVN F;  3AEG C;  2R44 A;  5HGL A;  2E42 A;  5APY A;  2NRG A;  1N7S A;  3WUT A;  2BEQ D;  1RF1 B;  1PP9 D;  1IFD A;  5APX A;  3KPE A;  2W6J H;  1NTM G;  1AVY A;  1NTZ D;  4QNB A;  3TF5 A;  3L73 D;  2QRX A;  4H44 B;  1SFC D;  1JM0 A;  5HVC A;  1L0L J;  1NTK J;  2MVU A;  4RO0 A;  2ZT9 D;  1ZXG A;  2P58 A;  2KI7 B;  3SSU A;  3CME P;  1IFM A;  1KB9 D;  4N78 D;  1URQ A;  3RL0 D;  3E7K A;  1N73 B;  1H8A A;  4TLF A;  1F80 D;  2NO8 A;  3CL3 D;  1WT6 A;  2P9X A;  3AE3 C;  2OTJ P;  1USE A;  3CXH E;  3PJS K;  2N5H A;  4GR6 A;  3RBX A;  4COC A;  1SQQ G;  1CI6 A;  3CWB E;  4U3F J;  1A02 F;  1SQQ E;  1LT9 A;  3FXD A;  4BRY A;  2Y9Y A;  1S5L X;  1NKZ B;  2MVV A;  1GPJ A;  2JDI H;  7CEI A;  4DT0 A;  1AV1 A;  3ITK A;  3VP9 A;  2BAS A;  1SQP G;  4N3Y B;  1S72 P;  3BRT B;  1ZW0 A;  4IL6 H;  1DV5 A;  1HJ0 A;  1ZRT D;  1U7M A;  1HH0 A;  3S9O A;  1IMQ A;  1IZN B;  2E75 D;  2NZ2 A;  3Q2Y A;  2HPC B;  2R5D A;  2CG5 B;  2WT7 B;  2IBZ I;  4EIJ A;  1WMK A;  4I7Z C;  5CZD B;  4C46 A;  2KOQ A;  2VSQ A;  1KYO I;  1BE3 G;  4EYY Q;  1SFC B;  1PGP A;  4PWV B;  1GU5 A;  3R4Y A;  2L91 A;  1M1K Q;  1MZ8 A;  1RNI A;  3L75 G;  3LMO A;  4NPD A;  3GHG C;  2V7Q H;  2M5R A;  1SQB D;  3GZL A;  2HLO A;  1PEM A;  4PJ0 H;  2XDJ A;  3CCS P;  4B86 A;  2FVE A;  2D2C D;  5KP7 B;  4BPG A;  1W2E A;  3MIW A;  1IUQ A;  5APU A;  3M9H A;  4A7P A;  3P8C D;  1EZV I;  4D6T E;  3BRV B;  3Q5P A;  3A0B H;  4WY4 D;  3II6 A;  4L74 A;  3BCC J;  3IF4 A;  3E1R A;  5KAF H;  3M0A A;  3E1I A;  2PRR A;  1S5L H;  2L4B A;  2K0X A;  5GTH H;  3H32 B;  3TYY A;  4I1L A;  3G4S P;  5AW4 B;  2PFX A;  1VKU A;  2WPQ A;  2IYP A;  3H1L G;  2K1A A;  3GHG B;  4OWF A;  2B88 A;  2KWL A;  2LXB A;  3WUU A;  3H1L E;  1YJW P;  1NU1 G;  1GXG A;  1D7M A;  1P84 I;  3B71 A;  1NU1 E;  4OH8 B;  4UHP B;  3G26 A;  1SQV G;  2K37 A;  1SQV E;  3IR9 A;  1EZV D;  1JCC A;  1HVV A;  1ACP A;  1M1J C;  3RK2 B;  3HD7 C;  4L73 A;  2EFJ A;  2VLN A;  2IYO A;  3DS0 A;  3SFD C;  2KOO A;  2K9Y A;  4PXH B;  1T2K C;  2OYI C;  5APT A;  1EXI A;  2XU6 A;  4U7J A;  1X0T A;  5H2F E;  3L71 E;  2KUB A;  5AVT B;  2Z45 A;  3L72 E;  2E76 D;  1BCC E;  5AVS B;  4PJ0 E;  1H0T B;  1OWA A;  1YIJ P;  3CCV P;  1PEU A;  1NTK D;  1X9V A;  2YO2 A;  2JP3 A;  1KQL A;  1QL2 A;  2CWO A;  3A0B E;  2E5Y A;  2YKP A;  3CE7 A;  4AYC A;  4TT3 H;  1M1J B;  5KJ7 C;  3TGU G;  5KAF E;  2Z4E A;  1KV4 A;  2RMZ A;  2ZXX A;  4Y28 J;  2OYI B;  3CCR P;  1GTW A;  2E74 C;  1SQX E;  4AUW A;  2ZXE B;  2A45 I;  1HWT C;  1ZV8 A;  2FKW B;  5TJH A;  1PEO A;  1JY3 P;  4K35 A;  1KQG B;  2GZG A;  2W8Z A;  3FX0 A;  3F89 A;  3H1I E;  1KIL C;  1PZQ A;  1IFI A;  1U7J A;  3L70 J;  1T3J A;  3NXS A;  1W2B O;  2LKM A;  3D70 A;  1FE6 A;  2FAC A;  5C39 A;  3HE4 A;  2ZYD A;  3A2A A;  2N1T C;  3L75 D;  2PEO A;  1LJ2 A;  5BVZ A;  2Y0D A;  1N2D C;  1YI2 P;  1R8E A;  1T8K A;  1KB9 H;  2E74 B;  1OZH A;  1M7L A;  1M56 D;  1Q90 D;  3HE5 A;  3RBZ A;  4DCK A;  3JSV C;  4PH1 A;  4H2W C;  3QH9 A;  1L4A A;  1L0N G;  3H1K E;  3MTU E;  1A02 J;  1L0N E;  1RE4 A;  3D71 A;  3GZM A;  2JGP A;  1DEE G;  1KIL B;  3RK3 D;  1PP9 J;  2IX7 C;  1M8O B;  2KOG A;  3G3Z A;  3H1H J;  3VN0 A;  3B4S A;  1JY2 P;  1KTM A;  3TNU A;  5AW9 B;  1KMI Z;  5HV8 A;  1HQB A;  3H1J D;  5KLV G;  2FYU K;  2N1T B;  4GIF A;  1EC5 A;  2J5U A;  3IN6 A;  1L0I A;  3L74 D;  2XZ0 D;  4PD4 I;  2FQ1 A;  4HKG A;  1OW7 A;  2WSC J;  2K88 A;  2LML A;  1AF8 A;  2M0B A;  3D6Z A;  4JQ0 D;  4RKU J;  2M8N A;  5EW5 E;  3HUS A;  2I8D A;  2M8L A;  3DPH A;  3I5C A;  1QVG O;  3M0D C;  2MKV A;  1XTC C;  3V2Q A;  2H43 A;  1GK4 A;  2XZ1 C;  2BCC G;  2MJZ A;  1VQO P;  2BQ1 E;  2B89 A;  2K9J A;  2J58 A;  2BCC E;  2QJK B;  1NTZ E;  1HF9 A;  2N9B A;  3L73 E;  3S1K A;  2FYU J;  1JCD A;  3M9B A;  3UIA A;  2KW2 A;  2M8P A;  1VQK P;  3AE7 C;  4PD4 D;  3CMA P;  1KB9 E;  1T8Z A;  2CQ8 A;  1GMJ A;  2FVA A;  1EDK A;  3Q3D A;  2GZF A;  3PTZ A;  2K3R A;  2W27 A;  3V5B A;  3MUD A;  4OGQ D;  1VF5 D;  3AE2 C;  3O6Q A;  5CCG A;  1KZU B;  1RF1 A;  1SLQ A;  2FYZ A;  2BUO A;  4XFX A;  3OJA B;  3M06 A;  1X22 A;  3SWY A;  2C9N Y;  4I6M C;  1LWU A;  2L9F A;  4LC1 A;  2PY8 A;  4YPC A;  2EIA A;  1VQ5 P;  1VHN A;  3FWN A;  5AW2 B;  2G8Y A;  2Y9Z A;  1BGY G;  3M9Q A;  3G9R A;  2OYO A;  3MZW B;  1AQT A;  1NTM K;  3WBH A;  2QM8 A;  2E5T A;  3A0H H;  3Q20 A;  1DD4 A;  1FZF A;  4H0L C;  2DW3 A;  3CC4 P;  2I1K A;  5CCG D;  3G71 P;  1QRJ A;  1T3U A;  3CXH H;  1IK7 A;  4U0E A;  2KS1 A;  2H89 C;  3VTP C;  1PPJ D;  3A3Y B;  1ZNV A;  4RES B;  3RGU A;  1N8R Q;  3AEF C;  3L70 D;  1RF0 A;  4BXL A;  1SQB E;  2GDY A;  1GDT A;  2Q1K A;  2WSS H;  2HPC A;  2A06 G;  2WT7 A;  5CHX A;  2KGC A;  1SQQ K;  2KZJ A;  3DS4 A;  2VLQ A;  2P1J A;  4IOI H;  3WUV A;  4KJM A;  2WTY A;  5I4T G;  1FC2 C;  1G2C A;  3O8Z A;  4GOE A;  3KHU A;  1N73 C;  3CX5 D;  5CCH A;  4XE5 B;  1NTM J;  3PHL A;  4H0L B;  1CW5 A;  1K73 Q;  1SQP K;  2WSE J;  2LXC B;  1KQS O;  2PEJ A;  3MGE A;  4BWN A;  1QX8 A;  2NPS C;  1EMV A;  2WQY C;  3H1H D;  1EOQ A;  2ZAE B;  1JY3 O;  3CCU P;  1BSN A;  3G1I A;  3H4E A;  2XT1 A;  1FZC C;  2OQQ A;  3N7N A;  5AW3 B;  2FVF A;  3ZDM A;  1A8O A;  4IFD K;  2FAD A;  1KFN A;  2OYH C;  2LPK A;  2CNR A;  3A0H E;  2HYN A;  1S9K D;  2KNC B;  5CCH D;  1LTJ C;  5KTB A;  1SQP J;  1Y47 A;  1J1D C;  3CWB G;  1U57 A;  4N6J A;  1BAJ A;  2KGA A;  3EWK A;  3P05 A;  1SFC C;  2O01 J;  2K2Q A;  3GHG A;  3D6Y A;  2NPS B;  1UNK A;  1N7S D;  4JYB A;  4EI2 A;  3MD0 A;  2ZT9 C;  1PEQ A;  1VDF A;  1A43 A;  1JEK A; 
#chains in the Genus database with same CATH homology
 3RG6 C;  5BS1 A;  2PEO A;  1M74 A;  2EFJ A;  3CXC O;  3G21 A;  3DS3 A;  3I56 P;  3E2D A;  5HGL A;  3HYB A;  2M8P A;  4PH0 A;  3DS0 A;  3DS5 A;  1VQK P;  2KOD A;  2JYG A;  3DS2 A;  4U0A A;  3DS4 A;  3CMA P;  2PEM A;  1YI2 P;  3CCJ P;  3G29 A;  4XRQ A;  1VQ8 P;  2Z46 A;  5I4T G;  1D1D A;  1M1K Q;  2PEQ A;  1RNI A;  2L6E A;  1E6J P;  4IPY A;  4PH1 A;  1EIA A;  3H0D A;  3CCE P;  2Z45 A;  1RO0 A;  1VQ6 P;  4QNB A;  1Q82 Q;  1VQN P;  1K73 Q;  3G0V A;  3I55 P;  3CCM P;  1VQL P;  2Z44 A;  3CCL P;  3OW2 O;  1KQS O;  2BUO A;  4XFX A;  4U0C A;  1PEM A;  1VQM P;  3CC2 P;  2DGY A;  2PEJ A;  3CCS P;  3G6E P;  3MGE A;  1YIJ P;  3CCV P;  1YHQ P;  4U0F A;  3CME P;  1PEU A;  4U0D A;  1IUQ A;  3H47 A;  3HZQ A;  5DCK A;  2ONT A;  5HGO A;  5JPA A;  2LF4 A;  1EOQ A;  1K30 A;  2CWO A;  3LRY A;  4COP A;  2PEI A;  4XFY A;  1AUM A;  3CCU P;  2PEK A;  3CCQ P;  2PY8 A;  2P9X A;  4GR2 A;  1VQ9 P;  2OTJ P;  2EIA A;  3CD6 P;  3G1I A;  3H4E A;  1ZMB A;  2XT1 A;  1RO2 A;  1Q86 Q;  4GR6 A;  2PEN A;  1VQ5 P;  1YIT P;  4WYM A;  4COC A;  3CC7 P;  3NTE A;  1M6E X;  3CCR P;  2XV6 A;  2XXM A;  1KC8 Q;  1NJI Q;  3G4S P;  4XFZ A;  1A8O A;  2JYL A;  2M8N A;  5F2O A;  1YJ9 P;  1M6N A;  1K8A Q;  4M0I A;  1YJN P;  3WBH A;  2M8L A;  3Q20 A;  5BS2 A;  3VRL C;  3DPH A;  5HGN A;  3CPW O;  1PEO A;  4XRO A;  3DS1 A;  3CC4 P;  1QVG O;  1JJ2 O;  2BHV A;  3G71 P;  1QRJ A;  5F2K A;  1YJW P;  1S72 P;  4U0E A;  2OTL P;  1BAJ A;  2EG5 A;  3G1G A;  5F2N A;  3P05 A;  1VQ4 P;  2QA4 P;  1KD1 Q;  3B5I A;  3G26 A;  1Q81 Q;  1VQO P;  2BQ1 E;  1VQ7 P;  1M90 Q;  1VQP P;  1K9M Q;  4U0B A;  1W2B O;  1N8R Q;  2JO0 A;  1PEQ A;  3M1M A;  1QVF O;  2OAR A;  5HGM A;  2QEX P;  3G28 A;  1Q7Y Q;  3DTJ A;  1A43 A;  2E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...