3CCQP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccqP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccqP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccqP02
3CC4P 1YJNP 1NJIQ 1YIJP 2OTLP 3G6EP 1YHQP 3CCLP 1K9MQ 3CMAP 1VQMP 1VQLP 2QEXP 1Q82Q 1VQ7P 3CCJP 1KQSO 3CCMP 1QVGO 3G71P 2QA4P 3I56P 1YJWP 1JJ2O 1VQOP 3CPWO 1VQ8P 1YITP 1QVFO 1K8AQ 3CCRP 1VQ4P 1Q86Q 3CCQP 1VQKP 1VQ9P 1M90Q 3CCEP 3OW2O 1Q7YQ 3CCSP 1W2BO 1KD1Q 3CMEP 1VQNP 3I55P 1YJ9P 3CXCO 3CC2P 1YI2P 1K73Q 1KC8Q 1VQ6P 3CD6P 3G4SP 1VQ5P 1Q81Q 1N8RQ 2OTJP 3CCUP 3CC7P 1M1KQ 1S72P 1VQPP 3CCVP
chains in the Genus database with same CATH superfamily
1SQPJ 5B5EH 2JB0A 2OTLP 3HUSC 4C7NB 1SS1A 1VQ7P 1HTLC 1L0NE 2IZ1A 2P9XA 4EOTA 4DJGA 5APSA 2W6AA 2IBZI 2JO0A 1SFCC 3CCQP 1Q2NA 2AFEA 1N7SB 1SQPG 4NPDA 3CMAP 4U0AA 2Z45A 5AW2B 3TK1A 2E74B 4YXDC 3MUDC 1NH4A 3NFQA 1KYOI 2ZYDA 3JSVC 1L4AD 3M9QA 2AXCA 3LW5J 1PEOA 1M7LA 1IO4A 4UB6H 4PWVB 4U0EA 2CQ8A 1QRJA 3L35A 3PJSK 1SQXJ 1IFMA 1X0TA 3L74G 1YTZT 3KXDA 2UWJE 2ZJSE 4IOIH 1FJKA 1NTKG 4XFYA 3S1KA 4QNBA 3AE6C 1SQVG 2N5HA 3M06A 1URQB 2R5BA 3V2PA 4BPHA 1JY3P 2D2CB 1PP9D 3VYIA 2KP8A 4JYBA 1H0TB 1HQBA 3FX0A 4UB8E 4D6TJ 3M0DC 4A7PA 1AVYA 1EQ7A 1L0ND 2XV6A 2M0BA 1QGKB 2CPBA 2YIUC 3L71J 1M8OB 2G8YA 1GTWA 5BU8B 1NTZD 1EDKA 4PJ0H 2L5GB 2WSEJ 4RJTA 3TYYA 3L75G 2Q7CA 1JTHA 1RO2A 4D6TG 2GUVA 2K88A 1G1IA 2A45H 1XTGB 1LT9C 1AVOA 1E79H 1RHZB 4KHXA 1S1CX 1PEUA 1N73B 1MZ8A 3L71G 1LTJB 2E1MA 3GG2A 1NTME 2H88C 3BASA 2KUBA 1X8YA 2YO3A 2FVEA 3VN0A 3JCUH 2QE7H 1QVGO 2QA4P 2Z5IA 3HE5A 2P7JA 2MF4A 2J58A 2B89A 4K35A 4OGQD 4H2WC 3A0BH 1U7JA 3A5TA 2KW2A 2K5XA 5EFWB 1LTGC 3T97A 1AA0A 2W6JH 3R2PA 5AVWB 1VQLP 5EJDA 3O8ZA 2IX7C 1OFCX 1Y9BA 4I6MC 4WB4A 5BU5A 1LTTC 1SQBE 5CJ0A 1A8OA 2Y0DA 1JY2O 2E75B 4ZMDA 1H8AA 2HR3A 4IL6H 1PP9J 2HLOA 3IR9A 3CCLP 3AE8C 1T3UA 3Q5RA 2Q3EA 3E7KA 1K05A 2Y0CA 1GW4A 3GZMA 1XTCC 2GYKA 1Q86Q 2JWDA 1KD1Q 1NU1G 3RL0C 3L70E 1L0NJ 3GW6A 3SWKA 3G6EP 3HE4B 1NTZJ 4ASVA 3TDKA 4YXWH 1EIAA 2A06E 1S5LH 3V6IA 4BWNA 1NTMD 1KQFB 4AUWA 3L37A 3IF4A 1EZVD 3B5NC 1RQVA 2GZJA 4UHPB 1L0NG 5AVXB 1P84I 3DS0A 1RH5B 3QWOC 4PD4I 3CL3D 1NTZG 4QKOA 4M3LA 4WY4D 1QVFO 1DEBA 3Q5SA 3CCSP 1W2BO 3N7NA 2QJPB 4H44C 1VQ6P 1SQXK 1K04A 1KILC 1D7MA 1M1KQ 1LWUA 3KQGA 2K3RA 3HTKB 3K5BA 5KJ7A 4U3FD 5AW0B 3O6QB 2IFNA 2OGUA 2QM8A 5KLVG 4C7NA 3RL0D 2JWAA 4ASWA 2GM4A 2H89C 3DPHA 1NJIQ 4HH2A 5APVA 3MTUE 3PP5A 1BGYG 1DIPA 2NPSC 4BRYA 4GODA 3B5ND 5E79H 1L2PA 1LTAC 1X22A 2LXCB 1NVOA 2E5TA 2A06D 3AEEC 1M74A 3NTNA 2A45G 2Z4EA 1U7MA 3OAKA 2GUSA 3Q1MA 1T8ZA 3FXDA 3WU2E 3GHGC 4H44D 1LT1A 1KV4A 1KILD 2B87B 1J1EC 3A3YB 1NTMJ 2EG5A 3TGUE 2ZYGA 2EHTA 3G9RA 5APTA 2Q6QA 2WPVB 3BRVB 2N1TC 5GTIH 1E0HA 2KSEA 2KS1B 3AE9C 2FADA 5TISH 2J5UA 1DD3A 2E5YA 1H0TA 3CWBE 1JB0J 2RN0A 1DV5A 1URQD 2GZFA 1IK7A 1EZVG 1OW6A 2NPSD 1HH0A 1M1JC 3H1HE 3CCMP 2JR8A 3I56P 1RF1B 4U3FJ 1JY2P 3ABVC 3HD7C 2R44A 2FQ2A 4I2LC 3PRJA 4OWFA 1GXHA 2WQYC 3VMXA 1M6NA 2FVAA 2W8ZA 1PPJE 4U0BA 1W2EA 1HF9A 1S5LX 1LTJA 1RF0C 2IFMA 5KTBA 4WBAA 2NZ2A 4U3FG 3ZDMA 1HWTC 1BCCD 4M0IA 5DJTB 3CCEP 2IPPA 1L0NK 3L72E 5HGOA 5APQA 1T2KC 1YQ4C 1N8RQ 5F2KA 4HB1A 1S3JA 5KKZC 5AW4B 3CCVP 1KB9I 3LW5H 1NTZK 1CI6A 1KLPA 1RE3C 4CA3A 4LLHA 4W7YA 4JBZA 1RY3A 2OTKE 2VLPA 5BVZA 3LRYA 1HVVA 1DX7A 3CC7P 1U57A 1VQPP 2AEJA 2Y9ZA 3A2AA 2EIAA 2FHSC 2QJKB 3HD7D 4AQRD 1OXZA 1BXIA 3H1HD 2Z46A 2XZ1C 5C39A 1E6JP 1AFOA 4HKZH 1MV8A 1QL2A 1Y8AA 1GK6A 4GOEA 1SQQE 3VMYA 1R5LA 5L8RJ 1Q82Q 2OYHC 1AJYA 2PGDA 2K92A 3DS2A 1T2KD 3NY7B 3D6YA 2WSEH 4COCA 2LR2A 3HE4A 3W67A 3KZIE 2M3EA 3H32B 1IFIA 1SQXD 3MGEA 3WMM0 3CXHE 2LMLA 4Y28J 2J59M 3VOPA 3AEFC 2WZ7A 1JM0A 5KAIE 2KG8A 3H1IE 1MUUA 2FYNB 2GDYA 3EJBA 2CNRA 3B4QA 3D6ZA 4R0MA 3MD0A 4PV1C 1JMMA 4N78E 2R32A 5APUA 2YXRB 1RQUA 1YJWP 3TNUA 3TGUJ 3AECC 4WYMA 3HTKA 2L91A 1NGMB 5B66E 3FWLA 1NTMK 3H1LE 1JCCA 2JBGA 1PEQA 2Z5HA 3CX5I 1BCCG 3CC2P 3EFGA 5JPAA 2RKLA 5TJHA 1DD4A 1BSHA 4YTPC 3CC4P 3L73E 2FFDB 2IBZE 2POHA 3H4EA 4H13B 3S9OA 1CW5A 1DEEG 5AVQB 2ZT9C 1AUMA 1RO0A 1SQQD 3A0HE 2N9YB 1BDDA 4XFJA 3NTEA 3H1HJ 4IFFA 1AV1A 2LIUA 4BRYB 2L6EA 3FGAD 1FOSF 1M56D 2BASA 3G26A 1KYOE 1SQBK 5KLIC 2AF8A 2GDXA 3CXHD 4AYCA 5F2OA 2WWWA 4PV1D 2LPKA 1RNIA 1OWAA 4L74A 1VF5C 2YKOA 1YI2P 1S2EA 2KK7A 3H1ID 2JKVA 1ZV8A 3GMAA 2DW3A 4PXHB 2B87A 2PEIA 1MFTA 4C46A 1RE4C 2JJLA 3C1LA 3L72J 3C8VA 2KS1A 2JYLA 5BS2A 1HY8A 1BE3E 2YXQB 1Q81Q 3HUSA 2N9BA 4OGQC 2KIKA 5HGMA 1IMQA 1SQXG 2ZT9D 2FAEA 2XU6A 1SFCA 1UNKA 2NO8A 2K9YA 2K94A 3RK3B 3H1KE 1Z6MA 1J1DB 2K9JB 2WMMA 1RF1A 3BRTB 2P1JA 1S4XA 3Q2YA 4U0FA 1PGJA 3AE4C 2Z44A 4UB8H 3Q5PA 1VF5D 2A45I 3DS5A 4ZKUA 2MD9A 4JYCA 1KYOD 5H2FE 1NO4A 4GR6A 1GL2B 1SQQJ 5AVTB 1L0LE 1ZN5A 3D70A 2LKMA 1KFMA 3KPEA 1YJNP 2BUOA 1ZR2A 3P8CE 3PTZA 1JUNA 1NKZB 3BVHA 2OYIC 4HKGA 5F2NA 1CI6B 7CEIA 1EDIA 3BATA 1FDOA 3H1IJ 1IFPA 4MN4C 1LTBC 1IMPA 3M0DA 2PY8A 1EZVI 4EI2A 3RL0g 1YQ3C 2QIWA 1NOHA 3MP7B 1BDCA 2LXBA 1FOSE 4WY4C 1GMJA 3DS1A 4L73A 3CD6P 2IDBA 1PGPA 1LTIC 4GT1A 1FZCC 2PEJA 2PENA 2ZAEB 1FR2A 3H1KD 1LTSC 3H1LJ 1GDTA 1GK4A 2KGAA 1Z56A 5AVYB 2WT7B 1FBMA 1A02F 1GXGA 3L73J 4Y99B 3AEBC 1ZLLA 3PH0A 1HBWA 3UIAA 4H0LC 5CCGA 2BCCE 3LIEA 1PP9G 1LWUC 5BS1A 1PZQA 3H32A 1L0LD 5KJ7C 3AE7C 2GZEA 2PAJA 5CBNA 2E76B 4ZKPA 3P8CD 1P84E 4PD4E 3RGUA 1MZ9A 2B9BA 5AW6B 2EFJA 2BQ1E 4Z1MH 2VLQA 5KAFE 3V2QA 1N7SC 5CJ4A 1T8KA 3B8EB 2E74C 2JU1A 3TNUB 1BAJA 1YHQP 1EC5A 1K9MQ 3N4XA 4TLFA 4BPFA 1X79B 3SWYA 4DZOA 1SQBD 4NPEA 2FYUE 3BCCE 2OYOA 3WBHA 1VQ8P 1BE3J 2FFDA 4H0LD 2KOOA 2KOPA 1FDIA 4WWIA 1PV3A 1KFNA 2K2QA 1W5CE 3RK2B 2O3JA 2JYGA 2KORA 2IZ0A 1LP1B 4XFXA 5KJ7D 1URQC 2K1AA 1TU3F 2YMYA 2D2CC 3AEDC 3RK3E 3H1KJ 4MRTC 3L70D 3CPWO 4I7ZB 2XDJA 4H13D 3U43A 3L4FA 1K30A 3EQ2A 2CK3H 2IYPA 2RMZA 4R4MA 3CCUP 3H1JE 1L4AB 3G3ZA 4LGDE 2ZFCA 1N7SD 2CPSA 1P84D 3FXEA 3H1KG 1LGHB 4PD4D 4DCKA 1FDMA 1L0LJ 1K8AQ 3B5IA 3MZWB 2E74D 3KHUA 1SQQK 2QJYB 3CXCO 2M8LA 2SPZA 5CZDB 2Q9IA 3H6PA 4I1LA 5APWA 3MGNA 4EDFA 1N73C 3R4YA 1LTJC 3HUSB 2M3BA 3WU2H 2AEFA 1IJDB 5AW8B 2GZIA 2ITAA 2FYUD 2KXPB 1NTMG 1SFCB 1HUCA 2V7QJ 2D2CD 4IPYA 1A43A 4IL6X 1KZUB 1PL5A 2K9JA 2KODA 1L0IA 2R5DA 1SQPE 2YMKA 1SQBJ 1VPCA 3L36A 1VQ4P 1L0HA 1IFNA 1PGOA 1CSBA 1YJ9P 2KB7P 3CE7A 1KC8Q 5AW5B 2H7HA 2AXTE 1OVRA 1PFIA 2W27A 2XZ0D 1GL2A 3IN6A 2W83C 2WSCJ 4DT0A 3GHGA 3L74E 2ZYAA 2HODB 1VQOP 2LTEA 1SQBG 2E75C 5CCHA 4WVZA 3DTJA 2K0YA 1NTKE 3L70J 3SFDC 2BCCJ 4JQ0D 3CMEP 2FQ0A 1SQVE 2N1TA 1KB9E 1T6AA 4COPA 1N2DC 2KZJA 2W6BA 2LF4A 2KGEA 2YNYA 2EHSA 2MR8A 3TGUD 1PEMA 1JEKA 4BPGA 3VRLC 2W90A 3H0DA 3C9IA 2ZVOB 1KORA 5CHXA 4GIFA 4O9BA 1GW3A 3L70G 4RO0A 2B88A 2ZVNB 5APXA 3AE5C 2RH0A 2KGDA 4C7RA 1YTZI 1M1JA 3KDPB 2N6YA 3U1CA 1ZXGA 2A06G 2KG9A 3CWBD 2ONTA 2QG4A 2NRGA 2YIUB 3SFEC 3L75E 4D6TE 1WRGA 1KN7A 3EWKA 5GTHE 2DNWA 2FYUJ 3BCCJ 2FY8A 2WT7A 1LT9B 1ZRTE 2KOSA 3L71E 2E75D 1UJZA 2C9NY 1G2CB 3V4WA 2QJPC 2O1KA 1GU4A 3EJEA 2JO1A 5DCKA 3F5HA 1EXJA 5APYA 1PPJD 1VL2A 3B4SA 3L74D 2ZXEB 1M6EX 1NTKD 3V4QA 2K0XA 2CWOA 2O01N 2WPTA 1SQVD 2JU2A 3L72D 2WPSA 2V4HA 3VP8A 4N6JA 1YITP 4L76A 3H1JJ 1IC2A 2VSQA 4W80A 3KZIH 1N86A 4CPGA 3P8MC 2HG5D 3CXHH 2JP3A 2M8NA 1ZW0A 1L0LK 1CEIA 5CMZA 5KAIH 3CX5E 2WVRA 2FYZA 4TT3H 2LIWA 1PGQA 3M91A 1QL1A 5B5EE 1A02J 4RKUJ 2M5RA 1J2JB 1NU1E 1USDA 2Q5UA 2KGCA 5HGLA 3AE3C 4U0DA 3RL0B 3CWBJ 1LP1A 3TGUG 3E2DA 3G1GA 1FE6A 1NYHA 5B66H 2XT1A 3F89A 3M9HA 2P67A 3RK2D 5AVZB 1IFDA 3B5NB 4N3YB 5AW3B 5KP7B 2K37A 2PEOA 3CWBG 3MIWA 3V2NA 1H88A 2KNCA 1NTZE 2AFDA 2DGYA 4UB6E 1L4AA 1R8EA 1WMKA 3GJNA 3OW2O 3V5BA 2N98A 2KOQA 3A0HH 2ZXXA 1OIPA 2R3CA 3G4SP 3H1HG 1OMIA 1RF1C 2FVFA 2YKQA 1SP4A 1ZOYC 3L74J 4NEOA 4JF7A 2WPRA 4EIJA 1KMIZ 5AW1B 1NTKJ 1D1DA 4H44B 3HZQA 1KYOH 1KILB 2QNWA 2XV5A 5DJUB 1N7LA 1SQVJ 4H2XC 4N78D 2MVVA 1QX8A 3V2RA 5KLVE 1X9VA 1VQ5P 1PPJG 3CX5D 3LMOA 2G3AA 3H1LD 1OR5A 3G0VA 1VHNA 2VLNA 3GKLC 2C0WA 1S9KE 1OW8A 1BGYE 2MY5A 2VLOA 1FU1A 3L72G 1M57D 2QRXA 1F80D 1NU1D 3IAOA 5HGNA 3L73D 2CG5B 2LKIA 2NPSB 2IBZD 2P58A 1IZNB 4PJ0E 3G28A 3L75J 2XXMA 1IFJA 1SFCD 2H43A 3MUDA 5KP6B 2N5IA 5EW5E 1FZAA 4QMAA 1FZBA 2MJZA 1Q7YQ 2MKVA 3SWFA 2FYUK 1ZR4A 2HODA 3A7OA 1JY2N 4L75A 2QJKC 3GHGB 2WSFH 1RE4A 1J1EB 3JCUE 3TF5A 1AQTA 2M5AB 2OQQA 3AEAC 3FWNA 2FQ1A 2N1TB 2XZRA 1QEXA 3SSUA 3VP9A 2O01J 3A0BE 2BHVA 5H2FH 1JNMA 1SQQG 2LL8A 2OTJP 2I8DA 1BSNA 3G1IA 5CCGC 1Q90D 1EZVE 5KLVD 1E5WA 1BE3D 3VMAA 2KSJA 1M1JB 2L9FA 3Q20A 1S9KD 3I55P 4GKGA 1Y47A 4IL6E 4HJGH 1BGYD 1HJ0A 2FYNC 3HD7B 2MR7A 5AVVB 3U1AA 1FZEA 3H1IG 2HPCB 3RBXA 2FXPA 4OVNF 2GZGA 2KLVA 2N50A 3M0AA 3G21A 1KQLA 1EDLA 2L0QA 2V7QH 1LT9A 3RBZA 1G2CA 1NU1J 4U3FE 1AF8A 1FC2C 4RESB 3H47A 2XNDH 4JPZB 1S5LE 1EXIA 3EJDA 3H1LG 3DS4A 5KKZB 2OYIA 2C9LY 5CBOA 5K5GB 2KR5A 1AQ5A 4LC1A 2FFDC 2WSSH 1PIXA 3E1RA 1UIXA 3L73G 2WSCH 5CCGD 1SQPK 1K73Q 4H13C 2IYOA 2IBZG 2P2UA 4IZ6A 1FZGA 1ACPA 3P7KA 2XKMA 3WUVA 2KLUA 4HYTB 3VTPC 4WY4A 3HYBA 3II6A 5AVUB 3WUUA 1GPJA 1FZCA 4H2YC 2O1JA 1QLED 1R5SA 1P84H 1EMVA 4PD4H 1NTKK 1KILE 3AEGC 2ROQA 3CCJP 2K93A 1EDJA 1SQVK 1NKNA 1JJ2O 4ZNCA 1ZNVA 5KLVJ 1OX3A 2GDWA 2PRRA 4EYYQ 5KAFH 5HVCA 2OYHB 1WT6A 1FAVA 3PLNA 2WPQA 1OZHA 1OVUA 4YPCA 2P10A 2QVAA 2JQ4A 5I4TG 2WTYA 1BGYJ 1KQGB 5KP8B 4KT0J 2GA1A 2QEXP 4BXLA 2M8RA 3E1IA 5E79E 3CI9A 1OW7A 2BCCD 1X3OA 1VKUA 1USEA 1BE3G 1YYCA 2WSFJ 3B5NA 1VQKP 2PEKA 2Y9YA 2FXMA 4B86A 1MKMA 2C0XA 2KG6A 2FKWB 3RK3C 2KNCB 4GDOA 1J1DC 1N7SA 4PV1B 1YBKA 3TSIA 1IUQA 4R4LA 2L4BA 1LNQA 4F37A 1KILA 3JC22 1GU5A 4PH0A 5GTIE 1BCCE 3HRNA 3D71A 4U7JA 1VQMP 2I1JA 2Q1KA 1GL2C 4KJMA 5TISE 3KYQA 4DG9A 3CCRP 5CCHC 1L0LG 4PH1A 1VDFA 3BCCD 1MFZA 2ZT9B 1SLQA 1JCDA 1URQA 1JO5A 1NHLA 1JY3N 2NPSA 4XFZA 3OJAB 2R3SA 2JEEA 2KI7B 3ITKA 1HGZA 3M1MA 2BEQD 1NWQA 2QSIA 3W68A 1VQ9P 1AYIA 5KLIB 2FACA 3DS3A 3RK3D 3H25A 5AW9B 2ERHA 5AVRB 2MVUA 5HV8A 1UIIA 1VF5B 5M1BA 2L22A 3RG2A 3MHVA 2E42A 3CLQA 1ZMBA 2PFXA 3H1JD 2M8PA 3S4RA 2HYNA 1NU1K 1NAFA 2XNXA 2M5AA 1FS0E 1JTHB 1S72P 4XA4A 2AXTH 2AVAA 1GL2D 3WUTA 3QH9A 3Q3DA 3NXSA 3USSA 1N73A 3M9BA 5AVSB 3VMZA 1G1JA 1IK9A 4Y99C 5CCHD 2Q3IA 3NMDA 2WITA 1KTMA 1SQXE 3GLMA 2FXOA 4OGQB 2QM7A 3GF7A 1M90Q 2BCCG 3B71A 2N1TD 2OARA 2PP6A 2JAZA 1EOQA 4XROA 1SVFA 4K3AA 4GOFA 3HE5B 1KB9H 1JY3O 2KYVA 2CGQA 2N6ZA 2E76C 3LIDA 4XE5B 1JOCA 4IFDK 3P05A 3HD7A 1DH3A 2H8PD 2KOGA 3I5CA 2HPCA 3GZLA 2K0DX 3T97B 2PEMA 1VQNP 1SQPD 2PNGA 1T3JA 3OA7A 4IFMA 1RF0A 1OVVA 5KLVK 2Y0EA 1FJPA 2YKPA 2PEQA 4OH8B 4DOJA 1LJ2A 1CZQA 5GTHH 2E43A 2OYIB 2FYUG 3BCCG 1RE3A 1ZMEC 2YO2A 1H89A 3G71P 3RK2C 3RG6C 1KB9D 3U59A 3AE2C 1GZLA 4U0CA 3IFMA 2E76D 4I7ZC 1YIJP 2O01H 1NAYA 4WY4B 1GD2E 3CXHI 1KQSO 3AE1C 3GF3A 1ZP0C 1FZCB 2X2BA 1NQ4A 2KWLA 2FBWC 1HGVA 3H1JG 1BCCJ 2VRSA 1L4AC 4W7ZA 2KZIA 4NPFX 2JGPA 3G29A 2JDIH 3L75D 4D6TD 1DNYA 2LOLA 2I1KA 2OYHA 1FZFA 4H0LB 2QJYC 1PP9E 1JMBA 5AW7B 3P32A 2HFED 2AEMA 1HJBA 1LWUB 1ZRTD 3CX5H 2BEZF 3L71D 3O6QA 3PHLA 4GR2A 4XRQA 3EFFK
chains in the Genus database with same CATH topology
1M6EX 2PENA 4XFXA 5HGMA 2OTLP 3G1IA 3G6EP 2CWOA 4XFZA 1VQ7P 1D1DA 3CCJP 1RO2A 2P9XA 3HZQA 1EIAA 1JJ2O 1YJWP 1VQOP 3CPWO 2JO0A 1YITP 3M1MA 4WYMA 3DTJA 3CCQP 2PEQA 1VQ9P 1PEQA 3Q20A 1K30A 3CMEP 1PEUA 3I55P 2EG5A 3CC2P 3DS3A 3LRYA 5JPAA 1VQ5P 3CCUP 3CC7P 4COPA 5I4TG 1VQPP 2E1MA 3DS0A 3CC4P 4U0FA 2LF4A 3G0VA 3CMAP 4U0AA 2Z45A 5BS1A 2QEXP 2M8NA 2EIAA 2Z44A 3H4EA 1QVGO 3G71P 2QA4P 1PEMA 1ZMBA 3VRLC 3G21A 3H0DA 3RG6C 1AUMA 1RO0A 2M8PA 1QVFO 3DS5A 1K8AQ 3B5IA 5HGNA 1VQKP 2Z46A 1PEOA 3CCSP 2PEKA 1W2BO 3NTEA 4GR6A 4U0EA 4U0CA 3CXCO 2M8LA 1E6JP 1VQ6P 1QRJA 1M1KQ 1S72P 2L6EA 3G28A 3H47A 1YJNP 1YIJP 2XXMA 1VQLP 2EFJA 3G26A 2BQ1E 5HGLA 2ONTA 1Q82Q 1KQSO 2BUOA 4U0DA 3CCMP 4XFYA 3DS4A 3I56P 3DS2A 4QNBA 3E2DA 3G1GA 1IUQA 5F2OA 4COCA 1M90Q 1RNIA 5F2NA 1Q7YQ 2XT1A 2OARA 1EOQA 4XROA 1A8OA 1YI2P 1K73Q 3G29A 4PH0A 3MGEA 4IPYA 1A43A 1M6NA 3DPHA 1NJIQ 1BAJA 1YHQP 3CCLP 1K9MQ 2PEIA 1VQMP 2KODA 4U0BA 2PEOA 2PY8A 3P05A 3WBHA 1VQ8P 3CCRP 4M0IA 1Q86Q 1VQ4P 2DGYA 3HYBA 5DCKA 4PH1A 3CCEP 2PEMA 3OW2O 2BHVA 1KD1Q 1VQNP 2JYLA 5BS2A 3DS1A 5HGOA 2XV6A 1YJ9P 4GR2A 4XRQA 3CD6P 1KC8Q 1M74A 2JYGA 3G4SP 1Q81Q 1N8RQ 5F2KA 2OTJP 3CCVP 2PEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 P;  1YJN P;  1NJI Q;  1YIJ P;  2OTL P;  3G6E P;  1YHQ P;  3CCL P;  1K9M Q;  3CMA P;  1VQM P;  1VQL P;  2QEX P;  1Q82 Q;  1VQ7 P;  3CCJ P;  1KQS O;  3CCM P;  1QVG O;  3G71 P;  2QA4 P;  3I56 P;  1YJW P;  1JJ2 O;  1VQO P;  3CPW O;  1VQ8 P;  1YIT P;  1QVF O;  1K8A Q;  3CCR P;  1VQ4 P;  1Q86 Q;  3CCQ P;  1VQK P;  1VQ9 P;  1M90 Q;  3CCE P;  3OW2 O;  1Q7Y Q;  3CCS P;  1W2B O;  1KD1 Q;  3CME P;  1VQN P;  3I55 P;  1YJ9 P;  3CXC O;  3CC2 P;  1YI2 P;  1K73 Q;  1KC8 Q;  1VQ6 P;  3CD6 P;  3G4S P;  1VQ5 P;  1Q81 Q;  1N8R Q;  2OTJ P;  3CCU P;  3CC7 P;  1M1K Q;  1S72 P;  1VQP P;  3CCV P; 
#chains in the Genus database with same CATH topology
 1SQP J;  5B5E H;  2JB0 A;  2OTL P;  3HUS C;  4C7N B;  1SS1 A;  1VQ7 P;  1HTL C;  1L0N E;  2IZ1 A;  2P9X A;  4EOT A;  4DJG A;  5APS A;  2W6A A;  2IBZ I;  2JO0 A;  1SFC C;  3CCQ P;  1Q2N A;  2AFE A;  1N7S B;  1SQP G;  4NPD A;  3CMA P;  4U0A A;  2Z45 A;  5AW2 B;  3TK1 A;  2E74 B;  4YXD C;  3MUD C;  1NH4 A;  3NFQ A;  1KYO I;  2ZYD A;  3JSV C;  1L4A D;  3M9Q A;  2AXC A;  3LW5 J;  1PEO A;  1M7L A;  1IO4 A;  4UB6 H;  4PWV B;  4U0E A;  2CQ8 A;  1QRJ A;  3L35 A;  3PJS K;  1SQX J;  1IFM A;  1X0T A;  3L74 G;  1YTZ T;  3KXD A;  2UWJ E;  2ZJS E;  4IOI H;  1FJK A;  1NTK G;  4XFY A;  3S1K A;  4QNB A;  3AE6 C;  1SQV G;  2N5H A;  3M06 A;  1URQ B;  2R5B A;  3V2P A;  4BPH A;  1JY3 P;  2D2C B;  1PP9 D;  3VYI A;  2KP8 A;  4JYB A;  1H0T B;  1HQB A;  3FX0 A;  4UB8 E;  4D6T J;  3M0D C;  4A7P A;  1AVY A;  1EQ7 A;  1L0N D;  2XV6 A;  2M0B A;  1QGK B;  2CPB A;  2YIU C;  3L71 J;  1M8O B;  2G8Y A;  1GTW A;  5BU8 B;  1NTZ D;  1EDK A;  4PJ0 H;  2L5G B;  2WSE J;  4RJT A;  3TYY A;  3L75 G;  2Q7C A;  1JTH A;  1RO2 A;  4D6T G;  2GUV A;  2K88 A;  1G1I A;  2A45 H;  1XTG B;  1LT9 C;  1AVO A;  1E79 H;  1RHZ B;  4KHX A;  1S1C X;  1PEU A;  1N73 B;  1MZ8 A;  3L71 G;  1LTJ B;  2E1M A;  3GG2 A;  1NTM E;  2H88 C;  3BAS A;  2KUB A;  1X8Y A;  2YO3 A;  2FVE A;  3VN0 A;  3JCU H;  2QE7 H;  1QVG O;  2QA4 P;  2Z5I A;  3HE5 A;  2P7J A;  2MF4 A;  2J58 A;  2B89 A;  4K35 A;  4OGQ D;  4H2W C;  3A0B H;  1U7J A;  3A5T A;  2KW2 A;  2K5X A;  5EFW B;  1LTG C;  3T97 A;  1AA0 A;  2W6J H;  3R2P A;  5AVW B;  1VQL P;  5EJD A;  3O8Z A;  2IX7 C;  1OFC X;  1Y9B A;  4I6M C;  4WB4 A;  5BU5 A;  1LTT C;  1SQB E;  5CJ0 A;  1A8O A;  2Y0D A;  1JY2 O;  2E75 B;  4ZMD A;  1H8A A;  2HR3 A;  4IL6 H;  1PP9 J;  2HLO A;  3IR9 A;  3CCL P;  3AE8 C;  1T3U A;  3Q5R A;  2Q3E A;  3E7K A;  1K05 A;  2Y0C A;  1GW4 A;  3GZM A;  1XTC C;  2GYK A;  1Q86 Q;  2JWD A;  1KD1 Q;  1NU1 G;  3RL0 C;  3L70 E;  1L0N J;  3GW6 A;  3SWK A;  3G6E P;  3HE4 B;  1NTZ J;  4ASV A;  3TDK A;  4YXW H;  1EIA A;  2A06 E;  1S5L H;  3V6I A;  4BWN A;  1NTM D;  1KQF B;  4AUW A;  3L37 A;  3IF4 A;  1EZV D;  3B5N C;  1RQV A;  2GZJ A;  4UHP B;  1L0N G;  5AVX B;  1P84 I;  3DS0 A;  1RH5 B;  3QWO C;  4PD4 I;  3CL3 D;  1NTZ G;  4QKO A;  4M3L A;  4WY4 D;  1QVF O;  1DEB A;  3Q5S A;  3CCS P;  1W2B O;  3N7N A;  2QJP B;  4H44 C;  1VQ6 P;  1SQX K;  1K04 A;  1KIL C;  1D7M A;  1M1K Q;  1LWU A;  3KQG A;  2K3R A;  3HTK B;  3K5B A;  5KJ7 A;  4U3F D;  5AW0 B;  3O6Q B;  2IFN A;  2OGU A;  2QM8 A;  5KLV G;  4C7N A;  3RL0 D;  2JWA A;  4ASW A;  2GM4 A;  2H89 C;  3DPH A;  1NJI Q;  4HH2 A;  5APV A;  3MTU E;  3PP5 A;  1BGY G;  1DIP A;  2NPS C;  4BRY A;  4GOD A;  3B5N D;  5E79 H;  1L2P A;  1LTA C;  1X22 A;  2LXC B;  1NVO A;  2E5T A;  2A06 D;  3AEE C;  1M74 A;  3NTN A;  2A45 G;  2Z4E A;  1U7M A;  3OAK A;  2GUS A;  3Q1M A;  1T8Z A;  3FXD A;  3WU2 E;  3GHG C;  4H44 D;  1LT1 A;  1KV4 A;  1KIL D;  2B87 B;  1J1E C;  3A3Y B;  1NTM J;  2EG5 A;  3TGU E;  2ZYG A;  2EHT A;  3G9R A;  5APT A;  2Q6Q A;  2WPV B;  3BRV B;  2N1T C;  5GTI H;  1E0H A;  2KSE A;  2KS1 B;  3AE9 C;  2FAD A;  5TIS H;  2J5U A;  1DD3 A;  2E5Y A;  1H0T A;  3CWB E;  1JB0 J;  2RN0 A;  1DV5 A;  1URQ D;  2GZF A;  1IK7 A;  1EZV G;  1OW6 A;  2NPS D;  1HH0 A;  1M1J C;  3H1H E;  3CCM P;  2JR8 A;  3I56 P;  1RF1 B;  4U3F J;  1JY2 P;  3ABV C;  3HD7 C;  2R44 A;  2FQ2 A;  4I2L C;  3PRJ A;  4OWF A;  1GXH A;  2WQY C;  3VMX A;  1M6N A;  2FVA A;  2W8Z A;  1PPJ E;  4U0B A;  1W2E A;  1HF9 A;  1S5L X;  1LTJ A;  1RF0 C;  2IFM A;  5KTB A;  4WBA A;  2NZ2 A;  4U3F G;  3ZDM A;  1HWT C;  1BCC D;  4M0I A;  5DJT B;  3CCE P;  2IPP A;  1L0N K;  3L72 E;  5HGO A;  5APQ A;  1T2K C;  1YQ4 C;  1N8R Q;  5F2K A;  4HB1 A;  1S3J A;  5KKZ C;  5AW4 B;  3CCV P;  1KB9 I;  3LW5 H;  1NTZ K;  1CI6 A;  1KLP A;  1RE3 C;  4CA3 A;  4LLH A;  4W7Y A;  4JBZ A;  1RY3 A;  2OTK E;  2VLP A;  5BVZ A;  3LRY A;  1HVV A;  1DX7 A;  3CC7 P;  1U57 A;  1VQP P;  2AEJ A;  2Y9Z A;  3A2A A;  2EIA A;  2FHS C;  2QJK B;  3HD7 D;  4AQR D;  1OXZ A;  1BXI A;  3H1H D;  2Z46 A;  2XZ1 C;  5C39 A;  1E6J P;  1AFO A;  4HKZ H;  1MV8 A;  1QL2 A;  1Y8A A;  1GK6 A;  4GOE A;  1SQQ E;  3VMY A;  1R5L A;  5L8R J;  1Q82 Q;  2OYH C;  1AJY A;  2PGD A;  2K92 A;  3DS2 A;  1T2K D;  3NY7 B;  3D6Y A;  2WSE H;  4COC A;  2LR2 A;  3HE4 A;  3W67 A;  3KZI E;  2M3E A;  3H32 B;  1IFI A;  1SQX D;  3MGE A;  3WMM 0;  3CXH E;  2LML A;  4Y28 J;  2J59 M;  3VOP A;  3AEF C;  2WZ7 A;  1JM0 A;  5KAI E;  2KG8 A;  3H1I E;  1MUU A;  2FYN B;  2GDY A;  3EJB A;  2CNR A;  3B4Q A;  3D6Z A;  4R0M A;  3MD0 A;  4PV1 C;  1JMM A;  4N78 E;  2R32 A;  5APU A;  2YXR B;  1RQU A;  1YJW P;  3TNU A;  3TGU J;  3AEC C;  4WYM A;  3HTK A;  2L91 A;  1NGM B;  5B66 E;  3FWL A;  1NTM K;  3H1L E;  1JCC A;  2JBG A;  1PEQ A;  2Z5H A;  3CX5 I;  1BCC G;  3CC2 P;  3EFG A;  5JPA A;  2RKL A;  5TJH A;  1DD4 A;  1BSH A;  4YTP C;  3CC4 P;  3L73 E;  2FFD B;  2IBZ E;  2POH A;  3H4E A;  4H13 B;  3S9O A;  1CW5 A;  1DEE G;  5AVQ B;  2ZT9 C;  1AUM A;  1RO0 A;  1SQQ D;  3A0H E;  2N9Y B;  1BDD A;  4XFJ A;  3NTE A;  3H1H J;  4IFF A;  1AV1 A;  2LIU A;  4BRY B;  2L6E A;  3FGA D;  1FOS F;  1M56 D;  2BAS A;  3G26 A;  1KYO E;  1SQB K;  5KLI C;  2AF8 A;  2GDX A;  3CXH D;  4AYC A;  5F2O A;  2WWW A;  4PV1 D;  2LPK A;  1RNI A;  1OWA A;  4L74 A;  1VF5 C;  2YKO A;  1YI2 P;  1S2E A;  2KK7 A;  3H1I D;  2JKV A;  1ZV8 A;  3GMA A;  2DW3 A;  4PXH B;  2B87 A;  2PEI A;  1MFT A;  4C46 A;  1RE4 C;  2JJL A;  3C1L A;  3L72 J;  3C8V A;  2KS1 A;  2JYL A;  5BS2 A;  1HY8 A;  1BE3 E;  2YXQ B;  1Q81 Q;  3HUS A;  2N9B A;  4OGQ C;  2KIK A;  5HGM A;  1IMQ A;  1SQX G;  2ZT9 D;  2FAE A;  2XU6 A;  1SFC A;  1UNK A;  2NO8 A;  2K9Y A;  2K94 A;  3RK3 B;  3H1K E;  1Z6M A;  1J1D B;  2K9J B;  2WMM A;  1RF1 A;  3BRT B;  2P1J A;  1S4X A;  3Q2Y A;  4U0F A;  1PGJ A;  3AE4 C;  2Z44 A;  4UB8 H;  3Q5P A;  1VF5 D;  2A45 I;  3DS5 A;  4ZKU A;  2MD9 A;  4JYC A;  1KYO D;  5H2F E;  1NO4 A;  4GR6 A;  1GL2 B;  1SQQ J;  5AVT B;  1L0L E;  1ZN5 A;  3D70 A;  2LKM A;  1KFM A;  3KPE A;  1YJN P;  2BUO A;  1ZR2 A;  3P8C E;  3PTZ A;  1JUN A;  1NKZ B;  3BVH A;  2OYI C;  4HKG A;  5F2N A;  1CI6 B;  7CEI A;  1EDI A;  3BAT A;  1FDO A;  3H1I J;  1IFP A;  4MN4 C;  1LTB C;  1IMP A;  3M0D A;  2PY8 A;  1EZV I;  4EI2 A;  3RL0 g;  1YQ3 C;  2QIW A;  1NOH A;  3MP7 B;  1BDC A;  2LXB A;  1FOS E;  4WY4 C;  1GMJ A;  3DS1 A;  4L73 A;  3CD6 P;  2IDB A;  1PGP A;  1LTI C;  4GT1 A;  1FZC C;  2PEJ A;  2PEN A;  2ZAE B;  1FR2 A;  3H1K D;  1LTS C;  3H1L J;  1GDT A;  1GK4 A;  2KGA A;  1Z56 A;  5AVY B;  2WT7 B;  1FBM A;  1A02 F;  1GXG A;  3L73 J;  4Y99 B;  3AEB C;  1ZLL A;  3PH0 A;  1HBW A;  3UIA A;  4H0L C;  5CCG A;  2BCC E;  3LIE A;  1PP9 G;  1LWU C;  5BS1 A;  1PZQ A;  3H32 A;  1L0L D;  5KJ7 C;  3AE7 C;  2GZE A;  2PAJ A;  5CBN A;  2E76 B;  4ZKP A;  3P8C D;  1P84 E;  4PD4 E;  3RGU A;  1MZ9 A;  2B9B A;  5AW6 B;  2EFJ A;  2BQ1 E;  4Z1M H;  2VLQ A;  5KAF E;  3V2Q A;  1N7S C;  5CJ4 A;  1T8K A;  3B8E B;  2E74 C;  2JU1 A;  3TNU B;  1BAJ A;  1YHQ P;  1EC5 A;  1K9M Q;  3N4X A;  4TLF A;  4BPF A;  1X79 B;  3SWY A;  4DZO A;  1SQB D;  4NPE A;  2FYU E;  3BCC E;  2OYO A;  3WBH A;  1VQ8 P;  1BE3 J;  2FFD A;  4H0L D;  2KOO A;  2KOP A;  1FDI A;  4WWI A;  1PV3 A;  1KFN A;  2K2Q A;  1W5C E;  3RK2 B;  2O3J A;  2JYG A;  2KOR A;  2IZ0 A;  1LP1 B;  4XFX A;  5KJ7 D;  1URQ C;  2K1A A;  1TU3 F;  2YMY A;  2D2C C;  3AED C;  3RK3 E;  3H1K J;  4MRT C;  3L70 D;  3CPW O;  4I7Z B;  2XDJ A;  4H13 D;  3U43 A;  3L4F A;  1K30 A;  3EQ2 A;  2CK3 H;  2IYP A;  2RMZ A;  4R4M A;  3CCU P;  3H1J E;  1L4A B;  3G3Z A;  4LGD E;  2ZFC A;  1N7S D;  2CPS A;  1P84 D;  3FXE A;  3H1K G;  1LGH B;  4PD4 D;  4DCK A;  1FDM A;  1L0L J;  1K8A Q;  3B5I A;  3MZW B;  2E74 D;  3KHU A;  1SQQ K;  2QJY B;  3CXC O;  2M8L A;  2SPZ A;  5CZD B;  2Q9I A;  3H6P A;  4I1L A;  5APW A;  3MGN A;  4EDF A;  1N73 C;  3R4Y A;  1LTJ C;  3HUS B;  2M3B A;  3WU2 H;  2AEF A;  1IJD B;  5AW8 B;  2GZI A;  2ITA A;  2FYU D;  2KXP B;  1NTM G;  1SFC B;  1HUC A;  2V7Q J;  2D2C D;  4IPY A;  1A43 A;  4IL6 X;  1KZU B;  1PL5 A;  2K9J A;  2KOD A;  1L0I A;  2R5D A;  1SQP E;  2YMK A;  1SQB J;  1VPC A;  3L36 A;  1VQ4 P;  1L0H A;  1IFN A;  1PGO A;  1CSB A;  1YJ9 P;  2KB7 P;  3CE7 A;  1KC8 Q;  5AW5 B;  2H7H A;  2AXT E;  1OVR A;  1PFI A;  2W27 A;  2XZ0 D;  1GL2 A;  3IN6 A;  2W83 C;  2WSC J;  4DT0 A;  3GHG A;  3L74 E;  2ZYA A;  2HOD B;  1VQO P;  2LTE A;  1SQB G;  2E75 C;  5CCH A;  4WVZ A;  3DTJ A;  2K0Y A;  1NTK E;  3L70 J;  3SFD C;  2BCC J;  4JQ0 D;  3CME P;  2FQ0 A;  1SQV E;  2N1T A;  1KB9 E;  1T6A A;  4COP A;  1N2D C;  2KZJ A;  2W6B A;  2LF4 A;  2KGE A;  2YNY A;  2EHS A;  2MR8 A;  3TGU D;  1PEM A;  1JEK A;  4BPG A;  3VRL C;  2W90 A;  3H0D A;  3C9I A;  2ZVO B;  1KOR A;  5CHX A;  4GIF A;  4O9B A;  1GW3 A;  3L70 G;  4RO0 A;  2B88 A;  2ZVN B;  5APX A;  3AE5 C;  2RH0 A;  2KGD A;  4C7R A;  1YTZ I;  1M1J A;  3KDP B;  2N6Y A;  3U1C A;  1ZXG A;  2A06 G;  2KG9 A;  3CWB D;  2ONT A;  2QG4 A;  2NRG A;  2YIU B;  3SFE C;  3L75 E;  4D6T E;  1WRG A;  1KN7 A;  3EWK A;  5GTH E;  2DNW A;  2FYU J;  3BCC J;  2FY8 A;  2WT7 A;  1LT9 B;  1ZRT E;  2KOS A;  3L71 E;  2E75 D;  1UJZ A;  2C9N Y;  1G2C B;  3V4W A;  2QJP C;  2O1K A;  1GU4 A;  3EJE A;  2JO1 A;  5DCK A;  3F5H A;  1EXJ A;  5APY A;  1PPJ D;  1VL2 A;  3B4S A;  3L74 D;  2ZXE B;  1M6E X;  1NTK D;  3V4Q A;  2K0X A;  2CWO A;  2O01 N;  2WPT A;  1SQV D;  2JU2 A;  3L72 D;  2WPS A;  2V4H A;  3VP8 A;  4N6J A;  1YIT P;  4L76 A;  3H1J J;  1IC2 A;  2VSQ A;  4W80 A;  3KZI H;  1N86 A;  4CPG A;  3P8M C;  2HG5 D;  3CXH H;  2JP3 A;  2M8N A;  1ZW0 A;  1L0L K;  1CEI A;  5CMZ A;  5KAI H;  3CX5 E;  2WVR A;  2FYZ A;  4TT3 H;  2LIW A;  1PGQ A;  3M91 A;  1QL1 A;  5B5E E;  1A02 J;  4RKU J;  2M5R A;  1J2J B;  1NU1 E;  1USD A;  2Q5U A;  2KGC A;  5HGL A;  3AE3 C;  4U0D A;  3RL0 B;  3CWB J;  1LP1 A;  3TGU G;  3E2D A;  3G1G A;  1FE6 A;  1NYH A;  5B66 H;  2XT1 A;  3F89 A;  3M9H A;  2P67 A;  3RK2 D;  5AVZ B;  1IFD A;  3B5N B;  4N3Y B;  5AW3 B;  5KP7 B;  2K37 A;  2PEO A;  3CWB G;  3MIW A;  3V2N A;  1H88 A;  2KNC A;  1NTZ E;  2AFD A;  2DGY A;  4UB6 E;  1L4A A;  1R8E A;  1WMK A;  3GJN A;  3OW2 O;  3V5B A;  2N98 A;  2KOQ A;  3A0H H;  2ZXX A;  1OIP A;  2R3C A;  3G4S P;  3H1H G;  1OMI A;  1RF1 C;  2FVF A;  2YKQ A;  1SP4 A;  1ZOY C;  3L74 J;  4NEO A;  4JF7 A;  2WPR A;  4EIJ A;  1KMI Z;  5AW1 B;  1NTK J;  1D1D A;  4H44 B;  3HZQ A;  1KYO H;  1KIL B;  2QNW A;  2XV5 A;  5DJU B;  1N7L A;  1SQV J;  4H2X C;  4N78 D;  2MVV A;  1QX8 A;  3V2R A;  5KLV E;  1X9V A;  1VQ5 P;  1PPJ G;  3CX5 D;  3LMO A;  2G3A A;  3H1L D;  1OR5 A;  3G0V A;  1VHN A;  2VLN A;  3GKL C;  2C0W A;  1S9K E;  1OW8 A;  1BGY E;  2MY5 A;  2VLO A;  1FU1 A;  3L72 G;  1M57 D;  2QRX A;  1F80 D;  1NU1 D;  3IAO A;  5HGN A;  3L73 D;  2CG5 B;  2LKI A;  2NPS B;  2IBZ D;  2P58 A;  1IZN B;  4PJ0 E;  3G28 A;  3L75 J;  2XXM A;  1IFJ A;  1SFC D;  2H43 A;  3MUD A;  5KP6 B;  2N5I A;  5EW5 E;  1FZA A;  4QMA A;  1FZB A;  2MJZ A;  1Q7Y Q;  2MKV A;  3SWF A;  2FYU K;  1ZR4 A;  2HOD A;  3A7O A;  1JY2 N;  4L75 A;  2QJK C;  3GHG B;  2WSF H;  1RE4 A;  1J1E B;  3JCU E;  3TF5 A;  1AQT A;  2M5A B;  2OQQ A;  3AEA C;  3FWN A;  2FQ1 A;  2N1T B;  2XZR A;  1QEX A;  3SSU A;  3VP9 A;  2O01 J;  3A0B E;  2BHV A;  5H2F H;  1JNM A;  1SQQ G;  2LL8 A;  2OTJ P;  2I8D A;  1BSN A;  3G1I A;  5CCG C;  1Q90 D;  1EZV E;  5KLV D;  1E5W A;  1BE3 D;  3VMA A;  2KSJ A;  1M1J B;  2L9F A;  3Q20 A;  1S9K D;  3I55 P;  4GKG A;  1Y47 A;  4IL6 E;  4HJG H;  1BGY D;  1HJ0 A;  2FYN C;  3HD7 B;  2MR7 A;  5AVV B;  3U1A A;  1FZE A;  3H1I G;  2HPC B;  3RBX A;  2FXP A;  4OVN F;  2GZG A;  2KLV A;  2N50 A;  3M0A A;  3G21 A;  1KQL A;  1EDL A;  2L0Q A;  2V7Q H;  1LT9 A;  3RBZ A;  1G2C A;  1NU1 J;  4U3F E;  1AF8 A;  1FC2 C;  4RES B;  3H47 A;  2XND H;  4JPZ B;  1S5L E;  1EXI A;  3EJD A;  3H1L G;  3DS4 A;  5KKZ B;  2OYI A;  2C9L Y;  5CBO A;  5K5G B;  2KR5 A;  1AQ5 A;  4LC1 A;  2FFD C;  2WSS H;  1PIX A;  3E1R A;  1UIX A;  3L73 G;  2WSC H;  5CCG D;  1SQP K;  1K73 Q;  4H13 C;  2IYO A;  2IBZ G;  2P2U A;  4IZ6 A;  1FZG A;  1ACP A;  3P7K A;  2XKM A;  3WUV A;  2KLU A;  4HYT B;  3VTP C;  4WY4 A;  3HYB A;  3II6 A;  5AVU B;  3WUU A;  1GPJ A;  1FZC A;  4H2Y C;  2O1J A;  1QLE D;  1R5S A;  1P84 H;  1EMV A;  4PD4 H;  1NTK K;  1KIL E;  3AEG C;  2ROQ A;  3CCJ P;  2K93 A;  1EDJ A;  1SQV K;  1NKN A;  1JJ2 O;  4ZNC A;  1ZNV A;  5KLV J;  1OX3 A;  2GDW A;  2PRR A;  4EYY Q;  5KAF H;  5HVC A;  2OYH B;  1WT6 A;  1FAV A;  3PLN A;  2WPQ A;  1OZH A;  1OVU A;  4YPC A;  2P10 A;  2QVA A;  2JQ4 A;  5I4T G;  2WTY A;  1BGY J;  1KQG B;  5KP8 B;  4KT0 J;  2GA1 A;  2QEX P;  4BXL A;  2M8R A;  3E1I A;  5E79 E;  3CI9 A;  1OW7 A;  2BCC D;  1X3O A;  1VKU A;  1USE A;  1BE3 G;  1YYC A;  2WSF J;  3B5N A;  1VQK P;  2PEK A;  2Y9Y A;  2FXM A;  4B86 A;  1MKM A;  2C0X A;  2KG6 A;  2FKW B;  3RK3 C;  2KNC B;  4GDO A;  1J1D C;  1N7S A;  4PV1 B;  1YBK A;  3TSI A;  1IUQ A;  4R4L A;  2L4B A;  1LNQ A;  4F37 A;  1KIL A;  3JC2 2;  1GU5 A;  4PH0 A;  5GTI E;  1BCC E;  3HRN A;  3D71 A;  4U7J A;  1VQM P;  2I1J A;  2Q1K A;  1GL2 C;  4KJM A;  5TIS E;  3KYQ A;  4DG9 A;  3CCR P;  5CCH C;  1L0L G;  4PH1 A;  1VDF A;  3BCC D;  1MFZ A;  2ZT9 B;  1SLQ A;  1JCD A;  1URQ A;  1JO5 A;  1NHL A;  1JY3 N;  2NPS A;  4XFZ A;  3OJA B;  2R3S A;  2JEE A;  2KI7 B;  3ITK A;  1HGZ A;  3M1M A;  2BEQ D;  1NWQ A;  2QSI A;  3W68 A;  1VQ9 P;  1AYI A;  5KLI B;  2FAC A;  3DS3 A;  3RK3 D;  3H25 A;  5AW9 B;  2ERH A;  5AVR B;  2MVU A;  5HV8 A;  1UII A;  1VF5 B;  5M1B A;  2L22 A;  3RG2 A;  3MHV A;  2E42 A;  3CLQ A;  1ZMB A;  2PFX A;  3H1J D;  2M8P A;  3S4R A;  2HYN A;  1NU1 K;  1NAF A;  2XNX A;  2M5A A;  1FS0 E;  1JTH B;  1S72 P;  4XA4 A;  2AXT H;  2AVA A;  1GL2 D;  3WUT A;  3QH9 A;  3Q3D A;  3NXS A;  3USS A;  1N73 A;  3M9B A;  5AVS B;  3VMZ A;  1G1J A;  1IK9 A;  4Y99 C;  5CCH D;  2Q3I A;  3NMD A;  2WIT A;  1KTM A;  1SQX E;  3GLM A;  2FXO A;  4OGQ B;  2QM7 A;  3GF7 A;  1M90 Q;  2BCC G;  3B71 A;  2N1T D;  2OAR A;  2PP6 A;  2JAZ A;  1EOQ A;  4XRO A;  1SVF A;  4K3A A;  4GOF A;  3HE5 B;  1KB9 H;  1JY3 O;  2KYV A;  2CGQ A;  2N6Z A;  2E76 C;  3LID A;  4XE5 B;  1JOC A;  4IFD K;  3P05 A;  3HD7 A;  1DH3 A;  2H8P D;  2KOG A;  3I5C A;  2HPC A;  3GZL A;  2K0D X;  3T97 B;  2PEM A;  1VQN P;  1SQP D;  2PNG A;  1T3J A;  3OA7 A;  4IFM A;  1RF0 A;  1OVV A;  5KLV K;  2Y0E A;  1FJP A;  2YKP A;  2PEQ A;  4OH8 B;  4DOJ A;  1LJ2 A;  1CZQ A;  5GTH H;  2E43 A;  2OYI B;  2FYU G;  3BCC G;  1RE3 A;  1ZME C;  2YO2 A;  1H89 A;  3G71 P;  3RK2 C;  3RG6 C;  1KB9 D;  3U59 A;  3AE2 C;  1GZL A;  4U0C A;  3IFM A;  2E76 D;  4I7Z C;  1YIJ P;  2O01 H;  1NAY A;  4WY4 B;  1GD2 E;  3CXH I;  1KQS O;  3AE1 C;  3GF3 A;  1ZP0 C;  1FZC B;  2X2B A;  1NQ4 A;  2KWL A;  2FBW C;  1HGV A;  3H1J G;  1BCC J;  2VRS A;  1L4A C;  4W7Z A;  2KZI A;  4NPF X;  2JGP A;  3G29 A;  2JDI H;  3L75 D;  4D6T D;  1DNY A;  2LOL A;  2I1K A;  2OYH A;  1FZF A;  4H0L B;  2QJY C;  1PP9 E;  1JMB A;  5AW7 B;  3P32 A;  2HFE D;  2AEM A;  1HJB A;  1LWU B;  1ZRT D;  3CX5 H;  2BEZ F;  3L71 D;  3O6Q A;  3PHL A;  4GR2 A;  4XRQ A;  3EFF K; 
#chains in the Genus database with same CATH homology
 1M6E X;  2PEN A;  4XFX A;  5HGM A;  2OTL P;  3G1I A;  3G6E P;  2CWO A;  4XFZ A;  1VQ7 P;  1D1D A;  3CCJ P;  1RO2 A;  2P9X A;  3HZQ A;  1EIA A;  1JJ2 O;  1YJW P;  1VQO P;  3CPW O;  2JO0 A;  1YIT P;  3M1M A;  4WYM A;  3DTJ A;  3CCQ P;  2PEQ A;  1VQ9 P;  1PEQ A;  3Q20 A;  1K30 A;  3CME P;  1PEU A;  3I55 P;  2EG5 A;  3CC2 P;  3DS3 A;  3LRY A;  5JPA A;  1VQ5 P;  3CCU P;  3CC7 P;  4COP A;  5I4T G;  1VQP P;  2E1M A;  3DS0 A;  3CC4 P;  4U0F A;  2LF4 A;  3G0V A;  3CMA P;  4U0A A;  2Z45 A;  5BS1 A;  2QEX P;  2M8N A;  2EIA A;  2Z44 A;  3H4E A;  1QVG O;  3G71 P;  2QA4 P;  1PEM A;  1ZMB A;  3VRL C;  3G21 A;  3H0D A;  3RG6 C;  1AUM A;  1RO0 A;  2M8P A;  1QVF O;  3DS5 A;  1K8A Q;  3B5I A;  5HGN A;  1VQK P;  2Z46 A;  1PEO A;  3CCS P;  2PEK A;  1W2B O;  3NTE A;  4GR6 A;  4U0E A;  4U0C A;  3CXC O;  2M8L A;  1E6J P;  1VQ6 P;  1QRJ A;  1M1K Q;  1S72 P;  2L6E A;  3G28 A;  3H47 A;  1YJN P;  1YIJ P;  2XXM A;  1VQL P;  2EFJ A;  3G26 A;  2BQ1 E;  5HGL A;  2ONT A;  1Q82 Q;  1KQS O;  2BUO A;  4U0D A;  3CCM P;  4XFY A;  3DS4 A;  3I56 P;  3DS2 A;  4QNB A;  3E2D A;  3G1G A;  1IUQ A;  5F2O A;  4COC A;  1M90 Q;  1RNI A;  5F2N A;  1Q7Y Q;  2XT1 A;  2OAR A;  1EOQ A;  4XRO A;  1A8O A;  1YI2 P;  1K73 Q;  3G29 A;  4PH0 A;  3MGE A;  4IPY A;  1A43 A;  1M6N A;  3DPH A;  1NJI Q;  1BAJ A;  1YHQ P;  3CCL P;  1K9M Q;  2PEI A;  1VQM P;  2KOD A;  4U0B A;  2PEO A;  2PY8 A;  3P05 A;  3WBH A;  1VQ8 P;  3CCR P;  4M0I A;  1Q86 Q;  1VQ4 P;  2DGY A;  3HYB A;  5DCK A;  4PH1 A;  3CCE P;  2PEM A;  3OW2 O;  2BHV A;  1KD1 Q;  1VQN P;  2JYL A;  5BS2 A;  3DS1 A;  5HGO A;  2XV6 A;  1YJ9 P;  4GR2 A;  4XRQ A;  3CD6 P;  1KC8 Q;  1M74 A;  2JYG A;  3G4S P;  1Q81 Q;  1N8R Q;  5F2K A;  2OTJ P;  3CCV P;  2PEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...