2K94A

Structural modification of acyl carrier protein by butyryl group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k94A00
2FAEA 1L0HA 2LL8A 1T8KA 2MR7A 2MVUA 2VSQA 3CE7A 3EJDA 4NEOA 3GZLA 2LPKA 3RG2A 1NQ4A 2K0XA 1AF8A 2AFDA 1VKUA 2K0YA 5KP7B 2DNWA 2JQ4A 2L4BA 4MRTC 2KGCA 2ROQA 2CG5B 2QNWA 2MF4A 2KOSA 2K94A 2GDWA 5HV8A 1X3OA 2PNGA 2L0QA 4BPHA 2CGQA 1HQBA 2JU2A 4R0MA 2KR5A 5KP6B 2KOOA 2FADA 4BPFA 2CNRA 4IZ6A 2XZ1C 4HKGA 1ACPA 2FHSC 1F80D 2AVAA 2X2BA 3GZMA 1OR5A 2JGPA 3LMOA 2AF8A 2KG6A 2CQ8A 2FQ1A 2KG8A 2M5RA 2EHSA 4H2WC 2N50A 2FQ2A 1DV5A 2FVAA 2FVEA 2JU1A 1HY8A 2N6YA 4BPGA 2N5HA 4CA3A 2K92A 2N6ZA 5EJDA 5CZDB 2LKIA 2GDXA 2N98A 2FVFA 2KG9A 2KWLA 4DG9A 2FACA 4PWVB 4PXHB 2L9FA 2MD9A 2KGEA 1DNYA 2KGAA 2MR8A 4H2YC 2N5IA 2KORA 2K93A 5HVCA 2LMLA 3EJEA 2FQ0A 2AFEA 2KOPA 3NY7B 2KGDA 2XZ0D 1L0IA 2LTEA 2LOLA 2LIUA 2EHTA 2L22A 3EJBA 2LIWA 4H2XC 2KW2A 2GDYA 5KP8B 2MY5A 2K2QA 2MVVA 1KLPA 2KOQA
chains in the Genus database with same CATH superfamily
5F2KA 3G21A 2PEJA 1VQKP 2GZJA 3RG2A 3DPHA 2K0XA 4U0DA 1VKUA 2QEXP 3CCEP 2KGCA 2MF4A 4XFZA 2ERHA 1AYIA 1VQNP 3G29A 1HQBA 2KR5A 2EG5A 4U0EA 5KP6B 2FADA 3NTEA 2CNRA 3HZQA 2PENA 1BAJA 3RG6C 1F80D 2AVAA 2X2BA 1VQ5P 1OR5A 2JGPA 3G6EP 2JYLA 3CCVP 5I4TG 2PEOA 4WYMA 1VQLP 1VHNA 1HY8A 1MZ8A 3HYBA 4BPGA 4PH0A 2LKIA 3CD6P 2KG9A 2XV6A 1M6NA 4H2YC 2N5IA 2GZFA 2FQ0A 2EIAA 2AFEA 3NY7B 2BHVA 4U0CA 5HGNA 2LTEA 1KQSO 2LOLA 1YJNP 3WBHA 2L22A 3VRLC 1M90Q 3B5IA 5F2OA 4H2XC 3G0VA 1IMQA 2K2QA 2OTJP 1L0HA 2LL8A 2LF4A 2VSQA 2GZEA 1NJIQ 3E2DA 7CEIA 1IUQA 2K0YA 5KP7B 1E6JP 2M8PA 4QNBA 2L4BA 4MRTC 3CMAP 1YJWP 2JAZA 2KOSA 2K94A 1K73Q 2JO0A 5HV8A 4F37A 1JJ2O 1X3OA 2PNGA 2L0QA 5HGOA 3DS3A 3H47A 4R0MA 4M0IA 3CPWO 5EW5E 2GZGA 4PH1A 4IZ6A 1VQ9P 1ACPA 2FHSC 5HGLA 1S72P 3GZMA 2CWOA 1VQOP 4COPA 1N8RQ 2CQ8A 2FQ1A 4XFXA 5BS2A 3CCJP 2EHSA 1DV5A 4XROA 1RNIA 2FVEA 2GYKA 2K92A 5CZDB 1QVGO 2GDXA 4U0AA 2KWLA 1Q82Q 1EOQA 2MD9A 3LRYA 2KGEA 1DNYA 2KGAA 1Q86Q 1W2BO 2MR8A 2K93A 1Z6MA 3CCQP 2KOPA 2JYGA 2Z45A 3GJNA 1L0IA 1EIAA 3DS5A 4GR2A 3B4QA 1ZMBA 2XXMA 2EHTA 2NO8A 1M74A 3H4EA 2GDYA 1IMPA 3CC2P 1GXGA 2MVVA 4BPHA 2FAEA 3G26A 2MR7A 2MVUA 3CE7A 3CXCO 1BXIA 2LPKA 5F2NA 1UNKA 3CCUP 1KC8Q 1AF8A 4GR6A 3I56P 2VLPA 1A43A 1K9MQ 2GDWA 1YI2P 3DS0A 2CGQA 2JU2A 2PY8A 2KOOA 2VLNA 4BPFA 1M6EX 3CMEP 1A8OA 3GKLC 4HKGA 1E0HA 2JBGA 1EMVA 1UJZA 2AF8A 2KG6A 2ONTA 1ZNVA 1FR2A 5HGMA 3G71P 2JB0A 1Q81Q 2M5RA 3H0DA 4H2WC 2N50A 3M1MA 2FQ2A 2FVAA 2PEQA 3DS4A 4XFYA 2JU1A 2N6YA 4U0FA 2PEMA 1QVFO 4CA3A 2N98A 2FVFA 4DG9A 2FACA 4PXHB 3OW2O 3DS1A 5JPAA 2LMLA 4QKOA 2M8NA 3G28A 2XZ0D 1K8AQ 3G1GA 1CEIA 3EJBA 3CCLP 1GXHA 2LIWA 3G1IA 2OARA 2VLOA 2KODA 5KP8B 1KLPA 2P9XA 2KOQA 1VQMP 4IPYA 1T8KA 3MGEA 2PEKA 3EJDA 4NEOA 3GZLA 2EFJA 3G4SP 4U0BA 1VQ8P 1NQ4A 2AFDA 1D1DA 2DNWA 3DS2A 2JQ4A 2ROQA 2CG5B 2QNWA 2WPTA 2BUOA 1GPJA 1RO2A 3CC7P 5DCKA 4UHPB 1K30A 1VQ7P 2XT1A 3CCMP 1YITP 2K0DX 2XZ1C 4COCA 1YHQP 3DTJA 2GZIA 3LMOA 2M8LA 1VQ4P 2KG8A 3Q20A 1VQPP 1VQ6P 2Z44A 1AUMA 3CCSP 1YIJP 2N5HA 2N6ZA 5EJDA 3I55P 1RO0A 2K5XA 1QRJA 1KD1Q 2OTLP 4PWVB 2VLQA 1YJ9P 2PEIA 2L9FA 2KORA 3CC4P 1M1KQ 5BS1A 5HVCA 3EJEA 3P05A 2L6EA 2KGDA 3CCRP 2Z46A 2QA4P 2LIUA 4XRQA 2DGYA 1Q7YQ 2KW2A 3U43A 2MY5A 2E1MA
chains in the Genus database with same CATH topology
2FAEA 1L0HA 2LL8A 1T8KA 2MR7A 2MVUA 2VSQA 3CE7A 3EJDA 4NEOA 3GZLA 2LPKA 3RG2A 1NQ4A 2K0XA 1AF8A 2AFDA 1VKUA 2K0YA 5KP7B 2DNWA 2JQ4A 2L4BA 4MRTC 2KGCA 2ROQA 2CG5B 2QNWA 2MF4A 2KOSA 2K94A 2GDWA 5HV8A 1X3OA 2PNGA 2L0QA 4BPHA 2CGQA 1HQBA 2JU2A 4R0MA 2KR5A 5KP6B 2KOOA 2FADA 4BPFA 2CNRA 4IZ6A 2XZ1C 4HKGA 1ACPA 2FHSC 1F80D 2AVAA 2X2BA 3GZMA 1OR5A 2JGPA 3LMOA 2AF8A 2KG6A 2CQ8A 2FQ1A 2KG8A 2M5RA 2EHSA 4H2WC 2N50A 2FQ2A 1DV5A 2FVAA 2FVEA 2JU1A 1HY8A 2N6YA 4BPGA 2N5HA 4CA3A 2K92A 2N6ZA 5EJDA 5CZDB 2LKIA 2GDXA 2N98A 2FVFA 2KG9A 2KWLA 4DG9A 2FACA 4PWVB 4PXHB 2L9FA 2MD9A 2KGEA 1DNYA 2KGAA 2MR8A 4H2YC 2N5IA 2KORA 2K93A 5HVCA 2LMLA 3EJEA 2FQ0A 2AFEA 2KOPA 3NY7B 2KGDA 2XZ0D 1L0IA 2LTEA 2LOLA 2LIUA 2EHTA 2L22A 3EJBA 2LIWA 4H2XC 2KW2A 2GDYA 5KP8B 2MY5A 2K2QA 2MVVA 1KLPA 2KOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  1L0H A;  2LL8 A;  1T8K A;  2MR7 A;  2MVU A;  2VSQ A;  3CE7 A;  3EJD A;  4NEO A;  3GZL A;  2LPK A;  3RG2 A;  1NQ4 A;  2K0X A;  1AF8 A;  2AFD A;  1VKU A;  2K0Y A;  5KP7 B;  2DNW A;  2JQ4 A;  2L4B A;  4MRT C;  2KGC A;  2ROQ A;  2CG5 B;  2QNW A;  2MF4 A;  2KOS A;  2K94 A;  2GDW A;  5HV8 A;  1X3O A;  2PNG A;  2L0Q A;  4BPH A;  2CGQ A;  1HQB A;  2JU2 A;  4R0M A;  2KR5 A;  5KP6 B;  2KOO A;  2FAD A;  4BPF A;  2CNR A;  4IZ6 A;  2XZ1 C;  4HKG A;  1ACP A;  2FHS C;  1F80 D;  2AVA A;  2X2B A;  3GZM A;  1OR5 A;  2JGP A;  3LMO A;  2AF8 A;  2KG6 A;  2CQ8 A;  2FQ1 A;  2KG8 A;  2M5R A;  2EHS A;  4H2W C;  2N50 A;  2FQ2 A;  1DV5 A;  2FVA A;  2FVE A;  2JU1 A;  1HY8 A;  2N6Y A;  4BPG A;  2N5H A;  4CA3 A;  2K92 A;  2N6Z A;  5EJD A;  5CZD B;  2LKI A;  2GDX A;  2N98 A;  2FVF A;  2KG9 A;  2KWL A;  4DG9 A;  2FAC A;  4PWV B;  4PXH B;  2L9F A;  2MD9 A;  2KGE A;  1DNY A;  2KGA A;  2MR8 A;  4H2Y C;  2N5I A;  2KOR A;  2K93 A;  5HVC A;  2LML A;  3EJE A;  2FQ0 A;  2AFE A;  2KOP A;  3NY7 B;  2KGD A;  2XZ0 D;  1L0I A;  2LTE A;  2LOL A;  2LIU A;  2EHT A;  2L22 A;  3EJB A;  2LIW A;  4H2X C;  2KW2 A;  2GDY A;  5KP8 B;  2MY5 A;  2K2Q A;  2MVV A;  1KLP A;  2KOQ A; 
#chains in the Genus database with same CATH topology
 5F2K A;  3G21 A;  2PEJ A;  1VQK P;  2GZJ A;  3RG2 A;  3DPH A;  2K0X A;  4U0D A;  1VKU A;  2QEX P;  3CCE P;  2KGC A;  2MF4 A;  4XFZ A;  2ERH A;  1AYI A;  1VQN P;  3G29 A;  1HQB A;  2KR5 A;  2EG5 A;  4U0E A;  5KP6 B;  2FAD A;  3NTE A;  2CNR A;  3HZQ A;  2PEN A;  1BAJ A;  3RG6 C;  1F80 D;  2AVA A;  2X2B A;  1VQ5 P;  1OR5 A;  2JGP A;  3G6E P;  2JYL A;  3CCV P;  5I4T G;  2PEO A;  4WYM A;  1VQL P;  1VHN A;  1HY8 A;  1MZ8 A;  3HYB A;  4BPG A;  4PH0 A;  2LKI A;  3CD6 P;  2KG9 A;  2XV6 A;  1M6N A;  4H2Y C;  2N5I A;  2GZF A;  2FQ0 A;  2EIA A;  2AFE A;  3NY7 B;  2BHV A;  4U0C A;  5HGN A;  2LTE A;  1KQS O;  2LOL A;  1YJN P;  3WBH A;  2L22 A;  3VRL C;  1M90 Q;  3B5I A;  5F2O A;  4H2X C;  3G0V A;  1IMQ A;  2K2Q A;  2OTJ P;  1L0H A;  2LL8 A;  2LF4 A;  2VSQ A;  2GZE A;  1NJI Q;  3E2D A;  7CEI A;  1IUQ A;  2K0Y A;  5KP7 B;  1E6J P;  2M8P A;  4QNB A;  2L4B A;  4MRT C;  3CMA P;  1YJW P;  2JAZ A;  2KOS A;  2K94 A;  1K73 Q;  2JO0 A;  5HV8 A;  4F37 A;  1JJ2 O;  1X3O A;  2PNG A;  2L0Q A;  5HGO A;  3DS3 A;  3H47 A;  4R0M A;  4M0I A;  3CPW O;  5EW5 E;  2GZG A;  4PH1 A;  4IZ6 A;  1VQ9 P;  1ACP A;  2FHS C;  5HGL A;  1S72 P;  3GZM A;  2CWO A;  1VQO P;  4COP A;  1N8R Q;  2CQ8 A;  2FQ1 A;  4XFX A;  5BS2 A;  3CCJ P;  2EHS A;  1DV5 A;  4XRO A;  1RNI A;  2FVE A;  2GYK A;  2K92 A;  5CZD B;  1QVG O;  2GDX A;  4U0A A;  2KWL A;  1Q82 Q;  1EOQ A;  2MD9 A;  3LRY A;  2KGE A;  1DNY A;  2KGA A;  1Q86 Q;  1W2B O;  2MR8 A;  2K93 A;  1Z6M A;  3CCQ P;  2KOP A;  2JYG A;  2Z45 A;  3GJN A;  1L0I A;  1EIA A;  3DS5 A;  4GR2 A;  3B4Q A;  1ZMB A;  2XXM A;  2EHT A;  2NO8 A;  1M74 A;  3H4E A;  2GDY A;  1IMP A;  3CC2 P;  1GXG A;  2MVV A;  4BPH A;  2FAE A;  3G26 A;  2MR7 A;  2MVU A;  3CE7 A;  3CXC O;  1BXI A;  2LPK A;  5F2N A;  1UNK A;  3CCU P;  1KC8 Q;  1AF8 A;  4GR6 A;  3I56 P;  2VLP A;  1A43 A;  1K9M Q;  2GDW A;  1YI2 P;  3DS0 A;  2CGQ A;  2JU2 A;  2PY8 A;  2KOO A;  2VLN A;  4BPF A;  1M6E X;  3CME P;  1A8O A;  3GKL C;  4HKG A;  1E0H A;  2JBG A;  1EMV A;  1UJZ A;  2AF8 A;  2KG6 A;  2ONT A;  1ZNV A;  1FR2 A;  5HGM A;  3G71 P;  2JB0 A;  1Q81 Q;  2M5R A;  3H0D A;  4H2W C;  2N50 A;  3M1M A;  2FQ2 A;  2FVA A;  2PEQ A;  3DS4 A;  4XFY A;  2JU1 A;  2N6Y A;  4U0F A;  2PEM A;  1QVF O;  4CA3 A;  2N98 A;  2FVF A;  4DG9 A;  2FAC A;  4PXH B;  3OW2 O;  3DS1 A;  5JPA A;  2LML A;  4QKO A;  2M8N A;  3G28 A;  2XZ0 D;  1K8A Q;  3G1G A;  1CEI A;  3EJB A;  3CCL P;  1GXH A;  2LIW A;  3G1I A;  2OAR A;  2VLO A;  2KOD A;  5KP8 B;  1KLP A;  2P9X A;  2KOQ A;  1VQM P;  4IPY A;  1T8K A;  3MGE A;  2PEK A;  3EJD A;  4NEO A;  3GZL A;  2EFJ A;  3G4S P;  4U0B A;  1VQ8 P;  1NQ4 A;  2AFD A;  1D1D A;  2DNW A;  3DS2 A;  2JQ4 A;  2ROQ A;  2CG5 B;  2QNW A;  2WPT A;  2BUO A;  1GPJ A;  1RO2 A;  3CC7 P;  5DCK A;  4UHP B;  1K30 A;  1VQ7 P;  2XT1 A;  3CCM P;  1YIT P;  2K0D X;  2XZ1 C;  4COC A;  1YHQ P;  3DTJ A;  2GZI A;  3LMO A;  2M8L A;  1VQ4 P;  2KG8 A;  3Q20 A;  1VQP P;  1VQ6 P;  2Z44 A;  1AUM A;  3CCS P;  1YIJ P;  2N5H A;  2N6Z A;  5EJD A;  3I55 P;  1RO0 A;  2K5X A;  1QRJ A;  1KD1 Q;  2OTL P;  4PWV B;  2VLQ A;  1YJ9 P;  2PEI A;  2L9F A;  2KOR A;  3CC4 P;  1M1K Q;  5BS1 A;  5HVC A;  3EJE A;  3P05 A;  2L6E A;  2KGD A;  3CCR P;  2Z46 A;  2QA4 P;  2LIU A;  4XRQ A;  2DGY A;  1Q7Y Q;  2KW2 A;  3U43 A;  2MY5 A;  2E1M A; 
#chains in the Genus database with same CATH homology
 2FAE A;  1L0H A;  2LL8 A;  1T8K A;  2MR7 A;  2MVU A;  2VSQ A;  3CE7 A;  3EJD A;  4NEO A;  3GZL A;  2LPK A;  3RG2 A;  1NQ4 A;  2K0X A;  1AF8 A;  2AFD A;  1VKU A;  2K0Y A;  5KP7 B;  2DNW A;  2JQ4 A;  2L4B A;  4MRT C;  2KGC A;  2ROQ A;  2CG5 B;  2QNW A;  2MF4 A;  2KOS A;  2K94 A;  2GDW A;  5HV8 A;  1X3O A;  2PNG A;  2L0Q A;  4BPH A;  2CGQ A;  1HQB A;  2JU2 A;  4R0M A;  2KR5 A;  5KP6 B;  2KOO A;  2FAD A;  4BPF A;  2CNR A;  4IZ6 A;  2XZ1 C;  4HKG A;  1ACP A;  2FHS C;  1F80 D;  2AVA A;  2X2B A;  3GZM A;  1OR5 A;  2JGP A;  3LMO A;  2AF8 A;  2KG6 A;  2CQ8 A;  2FQ1 A;  2KG8 A;  2M5R A;  2EHS A;  4H2W C;  2N50 A;  2FQ2 A;  1DV5 A;  2FVA A;  2FVE A;  2JU1 A;  1HY8 A;  2N6Y A;  4BPG A;  2N5H A;  4CA3 A;  2K92 A;  2N6Z A;  5EJD A;  5CZD B;  2LKI A;  2GDX A;  2N98 A;  2FVF A;  2KG9 A;  2KWL A;  4DG9 A;  2FAC A;  4PWV B;  4PXH B;  2L9F A;  2MD9 A;  2KGE A;  1DNY A;  2KGA A;  2MR8 A;  4H2Y C;  2N5I A;  2KOR A;  2K93 A;  5HVC A;  2LML A;  3EJE A;  2FQ0 A;  2AFE A;  2KOP A;  3NY7 B;  2KGD A;  2XZ0 D;  1L0I A;  2LTE A;  2LOL A;  2LIU A;  2EHT A;  2L22 A;  3EJB A;  2LIW A;  4H2X C;  2KW2 A;  2GDY A;  5KP8 B;  2MY5 A;  2K2Q A;  2MVV A;  1KLP A;  2KOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...