2K94A

Structural modification of acyl carrier protein by butyryl group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k94A00
2K2QA 2JU2A 2FQ1A 1HY8A 2KR5A 4BPFA 2K93A 2KGEA 2MY5A 2LKIA 2FAEA 1OR5A 4HKGA 2L22A 2KW2A 1HQBA 2QNWA 2KOOA 2CNRA 2N5IA 2PNGA 2MR8A 2K92A 3EJDA 2KG8A 3EJBA 1X3OA 2ROQA 2CQ8A 2KOPA 2AVAA 2KOQA 2K94A 2FQ2A 2LMLA 4PXHB 2AF8A 2FACA 2N6YA 2L4BA 2KG6A 4PWVB 2MD9A 2VSQA 3RG2A 2JQ4A 5CZDB 5KP8B 2MR7A 2K0XA 4R0MA 2N6ZA 2LIWA 1DNYA 3GZLA 4CA3A 1ACPA 3CE7A 2KOSA 2L0QA 2MF4A 4H2XC 2LOLA 1T8KA 5EJDA 5HV8A 2CGQA 2FVEA 2KWLA 2N5HA 2LL8A 2AFEA 2MVUA 4DG9A 2LPKA 2FVAA 2N98A 4BPGA 2FQ0A 2KG9A 2L9FA 3NY7B 1VKUA 2GDXA 2KORA 5KP6B 2X2BA 2KGCA 4H2WC 2CG5B 2KGDA 2LIUA 4NEOA 1NQ4A 1AF8A 2FHSC 2JGPA 2FADA 5HVCA 2JU1A 2KGAA 5KP7B 3LMOA 1F80D 4MRTC 2EHTA 2XZ0D 2N50A 2XZ1C 1L0IA 2DNWA 4IZ6A 4BPHA 2GDYA 2AFDA 1DV5A 2FVFA 1L0HA 2MVVA 3EJEA 2GDWA 1KLPA 2LTEA 2EHSA 2M5RA 4H2YC 2K0YA 3GZMA
chains in the Genus database with same CATH superfamily
3Q20A 2K2QA 3DS2A 1HY8A 2KR5A 2M8NA 2K93A 3CCRP 5HGNA 1K8AQ 2LKIA 2QNWA 2QEXP 2Z45A 3EJDA 2KG8A 1X3OA 4XFYA 3U43A 2ROQA 3CD6P 1UJZA 3B5IA 3DS0A 2AF8A 2L4BA 1K73Q 4PWVB 1GXHA 1VHNA 1M6EX 5KP8B 2MR7A 1Z6MA 3CC2P 1E0HA 1E6JP 1YJ9P 1ACPA 3M1MA 2L0QA 2LOLA 1T8KA 1VQ9P 1EIAA 5HV8A 2CGQA 2N5HA 4U0FA 2MVUA 3WBHA 5I4TG 5JPAA 3B4QA 1K30A 2VLNA 1KQSO 2L9FA 3G0VA 1VQLP 1IMPA 1GPJA 2CG5B 1BAJA 2GYKA 2PEQA 2CWOA 2FHSC 4F37A 1Q86Q 2KGAA 3LMOA 1F80D 3CCMP 4MRTC 2EHTA 1N8RQ 2XZ1C 1L0IA 2PEJA 1IMQA 1L0HA 2MVVA 1YJNP 2EHSA 2DGYA 4NEOA 4XFXA 4COPA 2JU2A 2QA4P 3DPHA 2KGEA 3HYBA 4XFZA 4HKGA 1VQ6P 1HQBA 2KOOA 2CNRA 2MR8A 2K92A 3CMAP 1IUQA 2KOPA 2XXMA 4UHPB 2LMLA 2N6YA 2KG6A 3G6EP 2K0XA 2LIWA 2GZGA 2M8PA 3DTJA 3HZQA 4CA3A 3E2DA 2LF4A 4GR2A 2MF4A 2PENA 2KWLA 2LL8A 2AFEA 2JYGA 1ZNVA 3G4SP 4BPGA 2FQ0A 4XROA 4QKOA 2PEIA 1VKUA 3CXCO 2KORA 5KP6B 2X2BA 2JO0A 1VQMP 2XT1A 2GZEA 3DS1A 2JBGA 2JAZA 2FADA 1VQPP 2VLPA 4M0IA 2Z44A 5KP7B 2EFJA 1GXGA 1NJIQ 4IZ6A 2GDYA 2FVFA 1VQ8P 1QRJA 5BS1A 1VQNP 3G26A 4H2YC 3OW2O 3GZMA 2JB0A 3LRYA 2GZJA 2Z46A 5DCKA 1Q81Q 5HGMA 7CEIA 2MY5A 1ZMBA 4WYMA 1KD1Q 2KW2A 3I56P 3H4EA 2CQ8A 2AVAA 4U0CA 2L6EA 1YJWP 3H47A 2MD9A 5F2NA 3RG2A 2JQ4A 1YIJP 1Q82Q 4R0MA 4XRQA 1DNYA 1JJ2O 2BHVA 4H2XC 2FVEA 1M1KQ 1M6NA 4DG9A 2FVAA 2KODA 2EIAA 2E1MA 4COCA 2PEOA 1UNKA 3DS4A 5HGLA 4H2WC 2KGDA 1VQOP 3MGEA 5BS2A 2GZFA 3I55P 2LIUA 2GZIA 4U0AA 3DS3A 2JGPA 5HVCA 2NO8A 2JU1A 2XZ0D 3VRLC 3G1GA 2DNWA 5EW5E 4BPHA 2BUOA 2AFDA 1DV5A 3P05A 3EJEA 2GDWA 2LTEA 2M5RA 4PH0A 3DS5A 1VQ7P 2K0YA 2EG5A 1QVGO 3CCLP 4IPYA 3CMEP 2P9XA 4QNBA 2FQ1A 4PH1A 4BPFA 1VQ5P 2OTLP 2FAEA 1A8OA 1OR5A 1YHQP 2L22A 3G1IA 1FR2A 1A43A 2N5IA 2PNGA 3H0DA 3EJBA 2WPTA 2KOQA 2K94A 2FQ2A 4PXHB 2FACA 1RO2A 4U0EA 1CEIA 4U0BA 3CCQP 2VSQA 1K9MQ 3GJNA 2K0DX 1W2BO 5F2KA 5CZDB 1EOQA 2VLQA 3CCUP 3G21A 3NTEA 2N6ZA 1S72P 3GZLA 3CE7A 2KOSA 2OTJP 5EJDA 2K5XA 2ONTA 1RO0A 4GR6A 2XV6A 1RNIA 2LPKA 1VQ4P 1VQKP 2N98A 5F2OA 3GKLC 3CPWO 2KG9A 3NY7B 1MZ8A 2GDXA 3CC4P 2KGCA 3CCJP 1YI2P 1EMVA 2M8LA 1Q7YQ 1NQ4A 1AF8A 2OARA 2PEKA 3RG6C 1AUMA 1M90Q 1QVFO 2PEMA 1YITP 2VLOA 1AYIA 2N50A 2ERHA 1D1DA 3CCEP 1BXIA 4U0DA 5HGOA 3CC7P 2PY8A 1M74A 3G28A 2JYLA 1KLPA 3CCVP 3CCSP 1KC8Q 3G29A 3G71P
chains in the Genus database with same CATH topology
2K2QA 2JU2A 2FQ1A 1HY8A 2KR5A 4BPFA 2K93A 2KGEA 2MY5A 2LKIA 2FAEA 1OR5A 4HKGA 2L22A 2KW2A 1HQBA 2QNWA 2KOOA 2CNRA 2N5IA 2PNGA 2MR8A 2K92A 3EJDA 2KG8A 3EJBA 1X3OA 2ROQA 2CQ8A 2KOPA 2AVAA 2KOQA 2K94A 2FQ2A 2LMLA 4PXHB 2AF8A 2FACA 2N6YA 2L4BA 2KG6A 4PWVB 2MD9A 2VSQA 3RG2A 2JQ4A 5CZDB 5KP8B 2MR7A 2K0XA 4R0MA 2N6ZA 2LIWA 1DNYA 3GZLA 4CA3A 1ACPA 3CE7A 2KOSA 2L0QA 2MF4A 4H2XC 2LOLA 1T8KA 5EJDA 5HV8A 2CGQA 2FVEA 2KWLA 2N5HA 2LL8A 2AFEA 2MVUA 4DG9A 2LPKA 2FVAA 2N98A 4BPGA 2FQ0A 2KG9A 2L9FA 3NY7B 1VKUA 2GDXA 2KORA 5KP6B 2X2BA 2KGCA 4H2WC 2CG5B 2KGDA 2LIUA 4NEOA 1NQ4A 1AF8A 2FHSC 2JGPA 2FADA 5HVCA 2JU1A 2KGAA 5KP7B 3LMOA 1F80D 4MRTC 2EHTA 2XZ0D 2N50A 2XZ1C 1L0IA 2DNWA 4IZ6A 4BPHA 2GDYA 2AFDA 1DV5A 2FVFA 1L0HA 2MVVA 3EJEA 2GDWA 1KLPA 2LTEA 2EHSA 2M5RA 4H2YC 2K0YA 3GZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2Q A;  2JU2 A;  2FQ1 A;  1HY8 A;  2KR5 A;  4BPF A;  2K93 A;  2KGE A;  2MY5 A;  2LKI A;  2FAE A;  1OR5 A;  4HKG A;  2L22 A;  2KW2 A;  1HQB A;  2QNW A;  2KOO A;  2CNR A;  2N5I A;  2PNG A;  2MR8 A;  2K92 A;  3EJD A;  2KG8 A;  3EJB A;  1X3O A;  2ROQ A;  2CQ8 A;  2KOP A;  2AVA A;  2KOQ A;  2K94 A;  2FQ2 A;  2LML A;  4PXH B;  2AF8 A;  2FAC A;  2N6Y A;  2L4B A;  2KG6 A;  4PWV B;  2MD9 A;  2VSQ A;  3RG2 A;  2JQ4 A;  5CZD B;  5KP8 B;  2MR7 A;  2K0X A;  4R0M A;  2N6Z A;  2LIW A;  1DNY A;  3GZL A;  4CA3 A;  1ACP A;  3CE7 A;  2KOS A;  2L0Q A;  2MF4 A;  4H2X C;  2LOL A;  1T8K A;  5EJD A;  5HV8 A;  2CGQ A;  2FVE A;  2KWL A;  2N5H A;  2LL8 A;  2AFE A;  2MVU A;  4DG9 A;  2LPK A;  2FVA A;  2N98 A;  4BPG A;  2FQ0 A;  2KG9 A;  2L9F A;  3NY7 B;  1VKU A;  2GDX A;  2KOR A;  5KP6 B;  2X2B A;  2KGC A;  4H2W C;  2CG5 B;  2KGD A;  2LIU A;  4NEO A;  1NQ4 A;  1AF8 A;  2FHS C;  2JGP A;  2FAD A;  5HVC A;  2JU1 A;  2KGA A;  5KP7 B;  3LMO A;  1F80 D;  4MRT C;  2EHT A;  2XZ0 D;  2N50 A;  2XZ1 C;  1L0I A;  2DNW A;  4IZ6 A;  4BPH A;  2GDY A;  2AFD A;  1DV5 A;  2FVF A;  1L0H A;  2MVV A;  3EJE A;  2GDW A;  1KLP A;  2LTE A;  2EHS A;  2M5R A;  4H2Y C;  2K0Y A;  3GZM A; 
#chains in the Genus database with same CATH topology
 3Q20 A;  2K2Q A;  3DS2 A;  1HY8 A;  2KR5 A;  2M8N A;  2K93 A;  3CCR P;  5HGN A;  1K8A Q;  2LKI A;  2QNW A;  2QEX P;  2Z45 A;  3EJD A;  2KG8 A;  1X3O A;  4XFY A;  3U43 A;  2ROQ A;  3CD6 P;  1UJZ A;  3B5I A;  3DS0 A;  2AF8 A;  2L4B A;  1K73 Q;  4PWV B;  1GXH A;  1VHN A;  1M6E X;  5KP8 B;  2MR7 A;  1Z6M A;  3CC2 P;  1E0H A;  1E6J P;  1YJ9 P;  1ACP A;  3M1M A;  2L0Q A;  2LOL A;  1T8K A;  1VQ9 P;  1EIA A;  5HV8 A;  2CGQ A;  2N5H A;  4U0F A;  2MVU A;  3WBH A;  5I4T G;  5JPA A;  3B4Q A;  1K30 A;  2VLN A;  1KQS O;  2L9F A;  3G0V A;  1VQL P;  1IMP A;  1GPJ A;  2CG5 B;  1BAJ A;  2GYK A;  2PEQ A;  2CWO A;  2FHS C;  4F37 A;  1Q86 Q;  2KGA A;  3LMO A;  1F80 D;  3CCM P;  4MRT C;  2EHT A;  1N8R Q;  2XZ1 C;  1L0I A;  2PEJ A;  1IMQ A;  1L0H A;  2MVV A;  1YJN P;  2EHS A;  2DGY A;  4NEO A;  4XFX A;  4COP A;  2JU2 A;  2QA4 P;  3DPH A;  2KGE A;  3HYB A;  4XFZ A;  4HKG A;  1VQ6 P;  1HQB A;  2KOO A;  2CNR A;  2MR8 A;  2K92 A;  3CMA P;  1IUQ A;  2KOP A;  2XXM A;  4UHP B;  2LML A;  2N6Y A;  2KG6 A;  3G6E P;  2K0X A;  2LIW A;  2GZG A;  2M8P A;  3DTJ A;  3HZQ A;  4CA3 A;  3E2D A;  2LF4 A;  4GR2 A;  2MF4 A;  2PEN A;  2KWL A;  2LL8 A;  2AFE A;  2JYG A;  1ZNV A;  3G4S P;  4BPG A;  2FQ0 A;  4XRO A;  4QKO A;  2PEI A;  1VKU A;  3CXC O;  2KOR A;  5KP6 B;  2X2B A;  2JO0 A;  1VQM P;  2XT1 A;  2GZE A;  3DS1 A;  2JBG A;  2JAZ A;  2FAD A;  1VQP P;  2VLP A;  4M0I A;  2Z44 A;  5KP7 B;  2EFJ A;  1GXG A;  1NJI Q;  4IZ6 A;  2GDY A;  2FVF A;  1VQ8 P;  1QRJ A;  5BS1 A;  1VQN P;  3G26 A;  4H2Y C;  3OW2 O;  3GZM A;  2JB0 A;  3LRY A;  2GZJ A;  2Z46 A;  5DCK A;  1Q81 Q;  5HGM A;  7CEI A;  2MY5 A;  1ZMB A;  4WYM A;  1KD1 Q;  2KW2 A;  3I56 P;  3H4E A;  2CQ8 A;  2AVA A;  4U0C A;  2L6E A;  1YJW P;  3H47 A;  2MD9 A;  5F2N A;  3RG2 A;  2JQ4 A;  1YIJ P;  1Q82 Q;  4R0M A;  4XRQ A;  1DNY A;  1JJ2 O;  2BHV A;  4H2X C;  2FVE A;  1M1K Q;  1M6N A;  4DG9 A;  2FVA A;  2KOD A;  2EIA A;  2E1M A;  4COC A;  2PEO A;  1UNK A;  3DS4 A;  5HGL A;  4H2W C;  2KGD A;  1VQO P;  3MGE A;  5BS2 A;  2GZF A;  3I55 P;  2LIU A;  2GZI A;  4U0A A;  3DS3 A;  2JGP A;  5HVC A;  2NO8 A;  2JU1 A;  2XZ0 D;  3VRL C;  3G1G A;  2DNW A;  5EW5 E;  4BPH A;  2BUO A;  2AFD A;  1DV5 A;  3P05 A;  3EJE A;  2GDW A;  2LTE A;  2M5R A;  4PH0 A;  3DS5 A;  1VQ7 P;  2K0Y A;  2EG5 A;  1QVG O;  3CCL P;  4IPY A;  3CME P;  2P9X A;  4QNB A;  2FQ1 A;  4PH1 A;  4BPF A;  1VQ5 P;  2OTL P;  2FAE A;  1A8O A;  1OR5 A;  1YHQ P;  2L22 A;  3G1I A;  1FR2 A;  1A43 A;  2N5I A;  2PNG A;  3H0D A;  3EJB A;  2WPT A;  2KOQ A;  2K94 A;  2FQ2 A;  4PXH B;  2FAC A;  1RO2 A;  4U0E A;  1CEI A;  4U0B A;  3CCQ P;  2VSQ A;  1K9M Q;  3GJN A;  2K0D X;  1W2B O;  5F2K A;  5CZD B;  1EOQ A;  2VLQ A;  3CCU P;  3G21 A;  3NTE A;  2N6Z A;  1S72 P;  3GZL A;  3CE7 A;  2KOS A;  2OTJ P;  5EJD A;  2K5X A;  2ONT A;  1RO0 A;  4GR6 A;  2XV6 A;  1RNI A;  2LPK A;  1VQ4 P;  1VQK P;  2N98 A;  5F2O A;  3GKL C;  3CPW O;  2KG9 A;  3NY7 B;  1MZ8 A;  2GDX A;  3CC4 P;  2KGC A;  3CCJ P;  1YI2 P;  1EMV A;  2M8L A;  1Q7Y Q;  1NQ4 A;  1AF8 A;  2OAR A;  2PEK A;  3RG6 C;  1AUM A;  1M90 Q;  1QVF O;  2PEM A;  1YIT P;  2VLO A;  1AYI A;  2N50 A;  2ERH A;  1D1D A;  3CCE P;  1BXI A;  4U0D A;  5HGO A;  3CC7 P;  2PY8 A;  1M74 A;  3G28 A;  2JYL A;  1KLP A;  3CCV P;  3CCS P;  1KC8 Q;  3G29 A;  3G71 P; 
#chains in the Genus database with same CATH homology
 2K2Q A;  2JU2 A;  2FQ1 A;  1HY8 A;  2KR5 A;  4BPF A;  2K93 A;  2KGE A;  2MY5 A;  2LKI A;  2FAE A;  1OR5 A;  4HKG A;  2L22 A;  2KW2 A;  1HQB A;  2QNW A;  2KOO A;  2CNR A;  2N5I A;  2PNG A;  2MR8 A;  2K92 A;  3EJD A;  2KG8 A;  3EJB A;  1X3O A;  2ROQ A;  2CQ8 A;  2KOP A;  2AVA A;  2KOQ A;  2K94 A;  2FQ2 A;  2LML A;  4PXH B;  2AF8 A;  2FAC A;  2N6Y A;  2L4B A;  2KG6 A;  4PWV B;  2MD9 A;  2VSQ A;  3RG2 A;  2JQ4 A;  5CZD B;  5KP8 B;  2MR7 A;  2K0X A;  4R0M A;  2N6Z A;  2LIW A;  1DNY A;  3GZL A;  4CA3 A;  1ACP A;  3CE7 A;  2KOS A;  2L0Q A;  2MF4 A;  4H2X C;  2LOL A;  1T8K A;  5EJD A;  5HV8 A;  2CGQ A;  2FVE A;  2KWL A;  2N5H A;  2LL8 A;  2AFE A;  2MVU A;  4DG9 A;  2LPK A;  2FVA A;  2N98 A;  4BPG A;  2FQ0 A;  2KG9 A;  2L9F A;  3NY7 B;  1VKU A;  2GDX A;  2KOR A;  5KP6 B;  2X2B A;  2KGC A;  4H2W C;  2CG5 B;  2KGD A;  2LIU A;  4NEO A;  1NQ4 A;  1AF8 A;  2FHS C;  2JGP A;  2FAD A;  5HVC A;  2JU1 A;  2KGA A;  5KP7 B;  3LMO A;  1F80 D;  4MRT C;  2EHT A;  2XZ0 D;  2N50 A;  2XZ1 C;  1L0I A;  2DNW A;  4IZ6 A;  4BPH A;  2GDY A;  2AFD A;  1DV5 A;  2FVF A;  1L0H A;  2MVV A;  3EJE A;  2GDW A;  1KLP A;  2LTE A;  2EHS A;  2M5R A;  4H2Y C;  2K0Y A;  3GZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...