2K94A

Structural modification of acyl carrier protein by butyryl group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k94A00
2FADA 2FAEA 2JQ4A 4BPHA 2AFDA 2K93A 4R0MA 2FQ2A 2N5IA 2FQ1A 1F80D 2LKIA 1X3OA 2KORA 2L4BA 2KGDA 4NEOA 2KR5A 2MVUA 2MD9A 4PXHB 2XZ1C 3LMOA 3CE7A 2KOQA 2K94A 3EJBA 2KGAA 2L9FA 2MF4A 2AF8A 2FVAA 2ROQA 4H2YC 3NY7B 2EHSA 2K0XA 1DV5A 2LIUA 2LMLA 2KG6A 2N6YA 5CZDB 2KG9A 2MR7A 2LL8A 2MVVA 2FHSC 2JU2A 2K2QA 1L0HA 4BPGA 2KG8A 2FQ0A 2VSQA 1ACPA 2JU1A 5KP7B 5EJDA 4CA3A 2N6ZA 2DNWA 2K92A 2KW2A 2N98A 1VKUA 2CNRA 2LTEA 1AF8A 2KOSA 2MY5A 3EJDA 2FACA 2KOOA 4DG9A 4H2XC 2KGCA 1OR5A 2KGEA 2QNWA 2N5HA 4BPFA 5HVCA 4PWVB 2EHTA 2GDXA 2L22A 5KP8B 2PNGA 1HQBA 2CG5B 3EJEA 2CQ8A 5KP6B 2AFEA 4HKGA 2KOPA 2M5RA 2XZ0D 1DNYA 4IZ6A 2KWLA 5HV8A 1NQ4A 2CGQA 2JGPA 2MR8A 2L0QA 3GZMA 2GDYA 2K0YA 2LOLA 3GZLA 1T8KA 2X2BA 1KLPA 2GDWA 4H2WC 2AVAA 4MRTC 2FVEA 2LPKA 3RG2A 2N50A 1L0IA 1HY8A 2FVFA 2LIWA
chains in the Genus database with same CATH superfamily
1JJ2O 2PENA 2K93A 4R0MA 3G26A 2LF4A 5HGNA 2M8PA 2LKIA 2PEQA 1ZMBA 2L4BA 4NEOA 3CD6P 2JBGA 1KQSO 2Z45A 1YJ9P 2XZ1C 3CE7A 2BUOA 4QKOA 3B4QA 4U0FA 2FVAA 1GXGA 2LIUA 2LMLA 1K30A 2N6YA 1IUQA 2EG5A 2MVVA 2JU2A 2JB0A 1K73Q 4BPGA 2VLPA 5F2NA 1Q86Q 2GZJA 4U0DA 4XFYA 4U0CA 2GZGA 2PEJA 2MY5A 2FACA 4DG9A 2KGCA 2QNWA 2JAZA 5HVCA 4PWVB 1VQ8P 2JO0A 2PNGA 1HQBA 2CG5B 3EJEA 5KP6B 1VQ5P 2QA4P 1DNYA 2E1MA 4IZ6A 2KWLA 5DCKA 4GR2A 1A43A 3U43A 3GZMA 1NJIQ 1KLPA 4MRTC 3CCQP 3RG2A 2N50A 1QRJA 1HY8A 2FADA 2FQ2A 4XRQA 1UNKA 1RO2A 1QVFO 3CCEP 3RG6C 3G28A 1F80D 7CEIA 1VQ6P 3CMEP 2KR5A 1BXIA 3G21A 3LMOA 3CC7P 2KOQA 2K94A 3EJBA 3CCVP 1VQLP 3CCLP 2ERHA 4U0AA 2AF8A 4COPA 1GPJA 1DV5A 2GZEA 3P05A 2KG6A 1CEIA 5CZDB 2KG9A 2LL8A 3CPWO 2JYLA 2FQ0A 1RO0A 3G1IA 3DS3A 3GKLC 5KP7B 1RNIA 1VQ7P 2DNWA 2OTJP 1VQPP 2VLQA 1YJNP 1VKUA 2CNRA 2KOOA 1VHNA 2K0DX 2EHTA 3G0VA 2GDXA 3CCUP 5KP8B 4M0IA 2EIAA 1YITP 3HZQA 4XFXA 5HV8A 3H0DA 2MR8A 2GDYA 2K0YA 2BHVA 2PEKA 2X2BA 4WYMA 2GDWA 3DTJA 2AVAA 3Q20A 4H2WC 1IMPA 2LPKA 4PH1A 2FAEA 1Q82Q 2K5XA 2FQ1A 1X3OA 1M1KQ 2OTLP 3CCMP 1FR2A 3DS5A 3CCJP 2MF4A 3CCRP 5F2KA 4H2YC 3NY7B 2K0XA 3B5IA 1VQMP 2GZIA 5EW5E 5I4TG 2MR7A 2ONTA 3H4EA 2WPTA 2NO8A 2VSQA 3LRYA 1VQ9P 3DS0A 1VQ4P 5F2OA 1EOQA 5EJDA 2N6ZA 3G6EP 2PY8A 1EIAA 2GZFA 3DS4A 2M8LA 1VQOP 2KOSA 3EJDA 3H47A 4H2XC 2P9XA 1M6NA 1OR5A 2KGEA 2N5HA 4BPFA 2XV6A 2L22A 2M8NA 2KODA 2PEIA 2PEMA 1KD1Q 1D1DA 3CCSP 2CQ8A 1QVGO 1MZ8A 1AYIA 4IPYA 1M6EX 3E2DA 4HKGA 3G4SP 2L6EA 1ZNVA 2M5RA 2XZ0D 1GXHA 3G1GA 3CC4P 1NQ4A 1VQNP 2CGQA 2JGPA 2CWOA 2L0QA 2LOLA 3GZLA 1UJZA 1KC8Q 3OW2O 1S72P 2PEOA 2FVFA 2LIWA 1AUMA 1Q81Q 2JQ4A 3DS2A 4BPHA 2AFDA 3M1MA 4COCA 4XROA 2N5IA 1Q7YQ 2KORA 5BS2A 2KGDA 2Z46A 2QEXP 2MVUA 1IMQA 3VRLC 2MD9A 4PXHB 1EMVA 2KGAA 2L9FA 3G71P 2ROQA 2EHSA 2OARA 1M74A 2Z44A 4GR6A 3CMAP 4F37A 5JPAA 2VLOA 2FHSC 2K2QA 2JYGA 4UHPB 1L0HA 2KG8A 4QNBA 1ACPA 2JU1A 1K8AQ 4CA3A 2K92A 2KW2A 2N98A 3CC2P 4U0BA 3I55P 1YI2P 2LTEA 1W2BO 3MGEA 1AF8A 1M90Q 2GYKA 3CXCO 3DS1A 1N8RQ 5BS1A 4XFZA 1Z6MA 1E6JP 5HGMA 1YHQP 1YJWP 3I56P 1A8OA 2AFEA 3NTEA 3DPHA 3WBHA 3HYBA 1K9MQ 2KOPA 5HGOA 1VQKP 1E0HA 3G29A 3GJNA 5HGLA 2XXMA 1T8KA 2DGYA 4U0EA 2EFJA 4PH0A 2FVEA 2VLNA 1L0IA 1BAJA 2XT1A 1YIJP
chains in the Genus database with same CATH topology
2FADA 2FAEA 2JQ4A 4BPHA 2AFDA 2K93A 4R0MA 2FQ2A 2N5IA 2FQ1A 1F80D 2LKIA 1X3OA 2KORA 2L4BA 2KGDA 4NEOA 2KR5A 2MVUA 2MD9A 4PXHB 2XZ1C 3LMOA 3CE7A 2KOQA 2K94A 3EJBA 2KGAA 2L9FA 2MF4A 2AF8A 2FVAA 2ROQA 4H2YC 3NY7B 2EHSA 2K0XA 1DV5A 2LIUA 2LMLA 2KG6A 2N6YA 5CZDB 2KG9A 2MR7A 2LL8A 2MVVA 2FHSC 2JU2A 2K2QA 1L0HA 4BPGA 2KG8A 2FQ0A 2VSQA 1ACPA 2JU1A 5KP7B 5EJDA 4CA3A 2N6ZA 2DNWA 2K92A 2KW2A 2N98A 1VKUA 2CNRA 2LTEA 1AF8A 2KOSA 2MY5A 3EJDA 2FACA 2KOOA 4DG9A 4H2XC 2KGCA 1OR5A 2KGEA 2QNWA 2N5HA 4BPFA 5HVCA 4PWVB 2EHTA 2GDXA 2L22A 5KP8B 2PNGA 1HQBA 2CG5B 3EJEA 2CQ8A 5KP6B 2AFEA 4HKGA 2KOPA 2M5RA 2XZ0D 1DNYA 4IZ6A 2KWLA 5HV8A 1NQ4A 2CGQA 2JGPA 2MR8A 2L0QA 3GZMA 2GDYA 2K0YA 2LOLA 3GZLA 1T8KA 2X2BA 1KLPA 2GDWA 4H2WC 2AVAA 4MRTC 2FVEA 2LPKA 3RG2A 2N50A 1L0IA 1HY8A 2FVFA 2LIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2FAE A;  2JQ4 A;  4BPH A;  2AFD A;  2K93 A;  4R0M A;  2FQ2 A;  2N5I A;  2FQ1 A;  1F80 D;  2LKI A;  1X3O A;  2KOR A;  2L4B A;  2KGD A;  4NEO A;  2KR5 A;  2MVU A;  2MD9 A;  4PXH B;  2XZ1 C;  3LMO A;  3CE7 A;  2KOQ A;  2K94 A;  3EJB A;  2KGA A;  2L9F A;  2MF4 A;  2AF8 A;  2FVA A;  2ROQ A;  4H2Y C;  3NY7 B;  2EHS A;  2K0X A;  1DV5 A;  2LIU A;  2LML A;  2KG6 A;  2N6Y A;  5CZD B;  2KG9 A;  2MR7 A;  2LL8 A;  2MVV A;  2FHS C;  2JU2 A;  2K2Q A;  1L0H A;  4BPG A;  2KG8 A;  2FQ0 A;  2VSQ A;  1ACP A;  2JU1 A;  5KP7 B;  5EJD A;  4CA3 A;  2N6Z A;  2DNW A;  2K92 A;  2KW2 A;  2N98 A;  1VKU A;  2CNR A;  2LTE A;  1AF8 A;  2KOS A;  2MY5 A;  3EJD A;  2FAC A;  2KOO A;  4DG9 A;  4H2X C;  2KGC A;  1OR5 A;  2KGE A;  2QNW A;  2N5H A;  4BPF A;  5HVC A;  4PWV B;  2EHT A;  2GDX A;  2L22 A;  5KP8 B;  2PNG A;  1HQB A;  2CG5 B;  3EJE A;  2CQ8 A;  5KP6 B;  2AFE A;  4HKG A;  2KOP A;  2M5R A;  2XZ0 D;  1DNY A;  4IZ6 A;  2KWL A;  5HV8 A;  1NQ4 A;  2CGQ A;  2JGP A;  2MR8 A;  2L0Q A;  3GZM A;  2GDY A;  2K0Y A;  2LOL A;  3GZL A;  1T8K A;  2X2B A;  1KLP A;  2GDW A;  4H2W C;  2AVA A;  4MRT C;  2FVE A;  2LPK A;  3RG2 A;  2N50 A;  1L0I A;  1HY8 A;  2FVF A;  2LIW A; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  2PEN A;  2K93 A;  4R0M A;  3G26 A;  2LF4 A;  5HGN A;  2M8P A;  2LKI A;  2PEQ A;  1ZMB A;  2L4B A;  4NEO A;  3CD6 P;  2JBG A;  1KQS O;  2Z45 A;  1YJ9 P;  2XZ1 C;  3CE7 A;  2BUO A;  4QKO A;  3B4Q A;  4U0F A;  2FVA A;  1GXG A;  2LIU A;  2LML A;  1K30 A;  2N6Y A;  1IUQ A;  2EG5 A;  2MVV A;  2JU2 A;  2JB0 A;  1K73 Q;  4BPG A;  2VLP A;  5F2N A;  1Q86 Q;  2GZJ A;  4U0D A;  4XFY A;  4U0C A;  2GZG A;  2PEJ A;  2MY5 A;  2FAC A;  4DG9 A;  2KGC A;  2QNW A;  2JAZ A;  5HVC A;  4PWV B;  1VQ8 P;  2JO0 A;  2PNG A;  1HQB A;  2CG5 B;  3EJE A;  5KP6 B;  1VQ5 P;  2QA4 P;  1DNY A;  2E1M A;  4IZ6 A;  2KWL A;  5DCK A;  4GR2 A;  1A43 A;  3U43 A;  3GZM A;  1NJI Q;  1KLP A;  4MRT C;  3CCQ P;  3RG2 A;  2N50 A;  1QRJ A;  1HY8 A;  2FAD A;  2FQ2 A;  4XRQ A;  1UNK A;  1RO2 A;  1QVF O;  3CCE P;  3RG6 C;  3G28 A;  1F80 D;  7CEI A;  1VQ6 P;  3CME P;  2KR5 A;  1BXI A;  3G21 A;  3LMO A;  3CC7 P;  2KOQ A;  2K94 A;  3EJB A;  3CCV P;  1VQL P;  3CCL P;  2ERH A;  4U0A A;  2AF8 A;  4COP A;  1GPJ A;  1DV5 A;  2GZE A;  3P05 A;  2KG6 A;  1CEI A;  5CZD B;  2KG9 A;  2LL8 A;  3CPW O;  2JYL A;  2FQ0 A;  1RO0 A;  3G1I A;  3DS3 A;  3GKL C;  5KP7 B;  1RNI A;  1VQ7 P;  2DNW A;  2OTJ P;  1VQP P;  2VLQ A;  1YJN P;  1VKU A;  2CNR A;  2KOO A;  1VHN A;  2K0D X;  2EHT A;  3G0V A;  2GDX A;  3CCU P;  5KP8 B;  4M0I A;  2EIA A;  1YIT P;  3HZQ A;  4XFX A;  5HV8 A;  3H0D A;  2MR8 A;  2GDY A;  2K0Y A;  2BHV A;  2PEK A;  2X2B A;  4WYM A;  2GDW A;  3DTJ A;  2AVA A;  3Q20 A;  4H2W C;  1IMP A;  2LPK A;  4PH1 A;  2FAE A;  1Q82 Q;  2K5X A;  2FQ1 A;  1X3O A;  1M1K Q;  2OTL P;  3CCM P;  1FR2 A;  3DS5 A;  3CCJ P;  2MF4 A;  3CCR P;  5F2K A;  4H2Y C;  3NY7 B;  2K0X A;  3B5I A;  1VQM P;  2GZI A;  5EW5 E;  5I4T G;  2MR7 A;  2ONT A;  3H4E A;  2WPT A;  2NO8 A;  2VSQ A;  3LRY A;  1VQ9 P;  3DS0 A;  1VQ4 P;  5F2O A;  1EOQ A;  5EJD A;  2N6Z A;  3G6E P;  2PY8 A;  1EIA A;  2GZF A;  3DS4 A;  2M8L A;  1VQO P;  2KOS A;  3EJD A;  3H47 A;  4H2X C;  2P9X A;  1M6N A;  1OR5 A;  2KGE A;  2N5H A;  4BPF A;  2XV6 A;  2L22 A;  2M8N A;  2KOD A;  2PEI A;  2PEM A;  1KD1 Q;  1D1D A;  3CCS P;  2CQ8 A;  1QVG O;  1MZ8 A;  1AYI A;  4IPY A;  1M6E X;  3E2D A;  4HKG A;  3G4S P;  2L6E A;  1ZNV A;  2M5R A;  2XZ0 D;  1GXH A;  3G1G A;  3CC4 P;  1NQ4 A;  1VQN P;  2CGQ A;  2JGP A;  2CWO A;  2L0Q A;  2LOL A;  3GZL A;  1UJZ A;  1KC8 Q;  3OW2 O;  1S72 P;  2PEO A;  2FVF A;  2LIW A;  1AUM A;  1Q81 Q;  2JQ4 A;  3DS2 A;  4BPH A;  2AFD A;  3M1M A;  4COC A;  4XRO A;  2N5I A;  1Q7Y Q;  2KOR A;  5BS2 A;  2KGD A;  2Z46 A;  2QEX P;  2MVU A;  1IMQ A;  3VRL C;  2MD9 A;  4PXH B;  1EMV A;  2KGA A;  2L9F A;  3G71 P;  2ROQ A;  2EHS A;  2OAR A;  1M74 A;  2Z44 A;  4GR6 A;  3CMA P;  4F37 A;  5JPA A;  2VLO A;  2FHS C;  2K2Q A;  2JYG A;  4UHP B;  1L0H A;  2KG8 A;  4QNB A;  1ACP A;  2JU1 A;  1K8A Q;  4CA3 A;  2K92 A;  2KW2 A;  2N98 A;  3CC2 P;  4U0B A;  3I55 P;  1YI2 P;  2LTE A;  1W2B O;  3MGE A;  1AF8 A;  1M90 Q;  2GYK A;  3CXC O;  3DS1 A;  1N8R Q;  5BS1 A;  4XFZ A;  1Z6M A;  1E6J P;  5HGM A;  1YHQ P;  1YJW P;  3I56 P;  1A8O A;  2AFE A;  3NTE A;  3DPH A;  3WBH A;  3HYB A;  1K9M Q;  2KOP A;  5HGO A;  1VQK P;  1E0H A;  3G29 A;  3GJN A;  5HGL A;  2XXM A;  1T8K A;  2DGY A;  4U0E A;  2EFJ A;  4PH0 A;  2FVE A;  2VLN A;  1L0I A;  1BAJ A;  2XT1 A;  1YIJ P; 
#chains in the Genus database with same CATH homology
 2FAD A;  2FAE A;  2JQ4 A;  4BPH A;  2AFD A;  2K93 A;  4R0M A;  2FQ2 A;  2N5I A;  2FQ1 A;  1F80 D;  2LKI A;  1X3O A;  2KOR A;  2L4B A;  2KGD A;  4NEO A;  2KR5 A;  2MVU A;  2MD9 A;  4PXH B;  2XZ1 C;  3LMO A;  3CE7 A;  2KOQ A;  2K94 A;  3EJB A;  2KGA A;  2L9F A;  2MF4 A;  2AF8 A;  2FVA A;  2ROQ A;  4H2Y C;  3NY7 B;  2EHS A;  2K0X A;  1DV5 A;  2LIU A;  2LML A;  2KG6 A;  2N6Y A;  5CZD B;  2KG9 A;  2MR7 A;  2LL8 A;  2MVV A;  2FHS C;  2JU2 A;  2K2Q A;  1L0H A;  4BPG A;  2KG8 A;  2FQ0 A;  2VSQ A;  1ACP A;  2JU1 A;  5KP7 B;  5EJD A;  4CA3 A;  2N6Z A;  2DNW A;  2K92 A;  2KW2 A;  2N98 A;  1VKU A;  2CNR A;  2LTE A;  1AF8 A;  2KOS A;  2MY5 A;  3EJD A;  2FAC A;  2KOO A;  4DG9 A;  4H2X C;  2KGC A;  1OR5 A;  2KGE A;  2QNW A;  2N5H A;  4BPF A;  5HVC A;  4PWV B;  2EHT A;  2GDX A;  2L22 A;  5KP8 B;  2PNG A;  1HQB A;  2CG5 B;  3EJE A;  2CQ8 A;  5KP6 B;  2AFE A;  4HKG A;  2KOP A;  2M5R A;  2XZ0 D;  1DNY A;  4IZ6 A;  2KWL A;  5HV8 A;  1NQ4 A;  2CGQ A;  2JGP A;  2MR8 A;  2L0Q A;  3GZM A;  2GDY A;  2K0Y A;  2LOL A;  3GZL A;  1T8K A;  2X2B A;  1KLP A;  2GDW A;  4H2W C;  2AVA A;  4MRT C;  2FVE A;  2LPK A;  3RG2 A;  2N50 A;  1L0I A;  1HY8 A;  2FVF A;  2LIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...