2K94A

Structural modification of acyl carrier protein by butyryl group
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k94A00
2KOOA 2N6YA 2L9FA 1OR5A 2KGDA 2LKIA 1HY8A 2K94A 2GDYA 2VSQA 2MY5A 3RG2A 5EJDA 2N50A 2MR8A 2KOQA 2JU2A 4H2YC 2PNGA 1X3OA 2FQ1A 2AFDA 2EHTA 3EJDA 4PXHB 2KG9A 2K0YA 2FHSC 3LMOA 4MRTC 3GZLA 2KG6A 1HQBA 2FVFA 2KGAA 2MR7A 4HKGA 2KWLA 2FQ2A 2FAEA 1T8KA 2L0QA 1VKUA 5CZDB 2M5RA 2FQ0A 2LPKA 2DNWA 2K92A 2MVUA 2L22A 5KP7B 2MD9A 1AF8A 2XZ1C 2CNRA 2ROQA 2CQ8A 2FACA 2LTEA 2JU1A 2KW2A 2XZ0D 4H2XC 2FVEA 2X2BA 2KG8A 2CGQA 2N5HA 2AFEA 1L0IA 4PWVB 2FADA 4BPHA 4NEOA 2LMLA 4CA3A 2K93A 1ACPA 3GZMA 2LL8A 1DNYA 2LIUA 3CE7A 5HVCA 2JGPA 2L4BA 3EJBA 2GDXA 2KORA 2KR5A 4BPFA 2CG5B 2MF4A 2K2QA 2AVAA 2KOSA 3NY7B 5HV8A 1DV5A 4H2WC 2FVAA 2LOLA 2EHSA 2KOPA 1F80D 2K0XA 3EJEA 4IZ6A 2LIWA 1NQ4A 4DG9A 5KP6B 2MVVA 2N6ZA 1KLPA 2QNWA 4R0MA 4BPGA 1L0HA 2GDWA 2KGEA 2AF8A 2N5IA 2JQ4A 2N98A 5KP8B 2KGCA
chains in the Genus database with same CATH superfamily
2JO0A 3G21A 2KGDA 1YI2P 2GDYA 2VSQA 1M6NA 1VQ9P 1ZNVA 3G71P 3CXCO 1ZMBA 2GZJA 1K30A 2XXMA 2OTJP 3G26A 3DPHA 4U0FA 1M1KQ 1VQMP 3DS3A 4PXHB 2PEIA 2K0YA 1UNKA 3LRYA 3CCSP 1BXIA 3G0VA 1YIJP 2MR7A 1YJNP 2KWLA 1Q82Q 2FQ2A 1T8KA 2L0QA 5I4TG 1YHQP 1K8AQ 1Q7YQ 2DNWA 3DS5A 2L6EA 3CCVP 2M8PA 2LTEA 3I56P 2JU1A 4PH1A 2EFJA 3H4EA 2CGQA 1RNIA 2AFEA 1EIAA 3DS0A 2K93A 3GZMA 1IMPA 2LL8A 2PEJA 2LIUA 5HVCA 2GDXA 3CMEP 1YJWP 2KORA 1D1DA 2AVAA 3NY7B 3DS1A 3U43A 4H2WC 2WPTA 3WBHA 1NQ4A 2EG5A 1K73Q 3OW2O 1KLPA 4BPGA 1L0HA 1RO2A 2N5IA 2JQ4A 5JPAA 5KP8B 2XT1A 2L9FA 2PENA 5HGLA 5DCKA 1E0HA 1HY8A 3RG2A 2N50A 2LF4A 2MR8A 3DTJA 3DS2A 1E6JP 1X3OA 2KG9A 2FHSC 1HQBA 3G6EP 4HKGA 4U0AA 1M74A 7CEIA 1S72P 1VQ4P 2M5RA 2GYKA 2K5XA 2FQ0A 1UJZA 4GR6A 2LPKA 3H0DA 1VQKP 2K92A 1GXHA 2ONTA 5KP7B 3CCLP 1AF8A 2XZ1C 2CNRA 2JYGA 2M8LA 4UHPB 1YJ9P 3G1IA 2KG8A 4XFYA 4IPYA 5HGNA 2BHVA 4BPHA 3CC2P 2DGYA 2VLNA 2JBGA 2LMLA 2KODA 1GPJA 1DNYA 1EOQA 2L4BA 5EW5E 1GXGA 1IUQA 3I55P 2NO8A 2KOPA 3EJEA 2GZFA 4DG9A 3NTEA 2MVVA 1VQ5P 2OTLP 2OARA 3MGEA 2GDWA 4XRQA 2PEMA 4PH0A 1VQOP 2KOOA 1A43A 3GJNA 1KD1Q 3CPWO 1OR5A 3CCEP 2P9XA 1A8OA 1BAJA 1EMVA 2LKIA 2K94A 2MY5A 2VLOA 5EJDA 1VQ6P 4WYMA 1KQSO 1VQ7P 1AUMA 2KOQA 4H2YC 2PNGA 2FQ1A 1QRJA 5F2OA 2JYLA 3VRLC 2GZEA 2Z44A 2GZGA 3CCMP 1KC8Q 2FVFA 4U0EA 3G1GA 2FAEA 1VKUA 5CZDB 1CEIA 2VLPA 3G29A 1VQPP 2E1MA 3CD6P 2MD9A 2PEKA 2ROQA 3E2DA 2XZ0D 4H2XC 2X2BA 1QVFO 2N5HA 1M6EX 1L0IA 1FR2A 4PWVB 2FADA 4NEOA 3B4QA 4CA3A 2Z46A 2JB0A 2CWOA 3CE7A 2QA4P 3HZQA 3CC4P 4XROA 1M90Q 3EJBA 2Z45A 2KR5A 5F2NA 2KOSA 2GZIA 2FVAA 1RO0A 1Q86Q 2K0XA 5KP6B 2N6ZA 3GKLC 4R0MA 2KGEA 5BS2A 2AF8A 1VQLP 2JAZA 2PEOA 2KGCA 2N6YA 1Q81Q 2K0DX 2ERHA 3CCUP 3HYBA 4XFZA 1NJIQ 1N8RQ 2JU2A 3RG6C 2AFDA 3CC7P 2EHTA 3EJDA 5F2KA 3LMOA 4MRTC 2EIAA 3GZLA 2BUOA 2KG6A 5HGMA 2M8NA 2KGAA 5BS1A 1Z6MA 4COPA 2VLQA 3G4SP 1VQ8P 3CMAP 3G28A 2MVUA 2L22A 1AYIA 3CCRP 1W2BO 2CQ8A 1IMQA 4XFXA 2FACA 2KW2A 3CCQP 2FVEA 2XV6A 4QNBA 1JJ2O 3H47A 4U0DA 4GR2A 2QEXP 1ACPA 1YITP 1VHNA 2JGPA 2PY8A 3DS4A 4BPFA 1K9MQ 2CG5B 2MF4A 2K2QA 2PEQA 5HV8A 4QKOA 1DV5A 1MZ8A 2LOLA 4U0BA 2EHSA 1F80D 4IZ6A 3M1MA 1QVGO 2LIWA 1VQNP 5HGOA 4F37A 3CCJP 4M0IA 3B5IA 2QNWA 4COCA 3P05A 2N98A 4U0CA 3Q20A
chains in the Genus database with same CATH topology
2KOOA 2N6YA 2L9FA 1OR5A 2KGDA 2LKIA 1HY8A 2K94A 2GDYA 2VSQA 2MY5A 3RG2A 5EJDA 2N50A 2MR8A 2KOQA 2JU2A 4H2YC 2PNGA 1X3OA 2FQ1A 2AFDA 2EHTA 3EJDA 4PXHB 2KG9A 2K0YA 2FHSC 3LMOA 4MRTC 3GZLA 2KG6A 1HQBA 2FVFA 2KGAA 2MR7A 4HKGA 2KWLA 2FQ2A 2FAEA 1T8KA 2L0QA 1VKUA 5CZDB 2M5RA 2FQ0A 2LPKA 2DNWA 2K92A 2MVUA 2L22A 5KP7B 2MD9A 1AF8A 2XZ1C 2CNRA 2ROQA 2CQ8A 2FACA 2LTEA 2JU1A 2KW2A 2XZ0D 4H2XC 2FVEA 2X2BA 2KG8A 2CGQA 2N5HA 2AFEA 1L0IA 4PWVB 2FADA 4BPHA 4NEOA 2LMLA 4CA3A 2K93A 1ACPA 3GZMA 2LL8A 1DNYA 2LIUA 3CE7A 5HVCA 2JGPA 2L4BA 3EJBA 2GDXA 2KORA 2KR5A 4BPFA 2CG5B 2MF4A 2K2QA 2AVAA 2KOSA 3NY7B 5HV8A 1DV5A 4H2WC 2FVAA 2LOLA 2EHSA 2KOPA 1F80D 2K0XA 3EJEA 4IZ6A 2LIWA 1NQ4A 4DG9A 5KP6B 2MVVA 2N6ZA 1KLPA 2QNWA 4R0MA 4BPGA 1L0HA 2GDWA 2KGEA 2AF8A 2N5IA 2JQ4A 2N98A 5KP8B 2KGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOO A;  2N6Y A;  2L9F A;  1OR5 A;  2KGD A;  2LKI A;  1HY8 A;  2K94 A;  2GDY A;  2VSQ A;  2MY5 A;  3RG2 A;  5EJD A;  2N50 A;  2MR8 A;  2KOQ A;  2JU2 A;  4H2Y C;  2PNG A;  1X3O A;  2FQ1 A;  2AFD A;  2EHT A;  3EJD A;  4PXH B;  2KG9 A;  2K0Y A;  2FHS C;  3LMO A;  4MRT C;  3GZL A;  2KG6 A;  1HQB A;  2FVF A;  2KGA A;  2MR7 A;  4HKG A;  2KWL A;  2FQ2 A;  2FAE A;  1T8K A;  2L0Q A;  1VKU A;  5CZD B;  2M5R A;  2FQ0 A;  2LPK A;  2DNW A;  2K92 A;  2MVU A;  2L22 A;  5KP7 B;  2MD9 A;  1AF8 A;  2XZ1 C;  2CNR A;  2ROQ A;  2CQ8 A;  2FAC A;  2LTE A;  2JU1 A;  2KW2 A;  2XZ0 D;  4H2X C;  2FVE A;  2X2B A;  2KG8 A;  2CGQ A;  2N5H A;  2AFE A;  1L0I A;  4PWV B;  2FAD A;  4BPH A;  4NEO A;  2LML A;  4CA3 A;  2K93 A;  1ACP A;  3GZM A;  2LL8 A;  1DNY A;  2LIU A;  3CE7 A;  5HVC A;  2JGP A;  2L4B A;  3EJB A;  2GDX A;  2KOR A;  2KR5 A;  4BPF A;  2CG5 B;  2MF4 A;  2K2Q A;  2AVA A;  2KOS A;  3NY7 B;  5HV8 A;  1DV5 A;  4H2W C;  2FVA A;  2LOL A;  2EHS A;  2KOP A;  1F80 D;  2K0X A;  3EJE A;  4IZ6 A;  2LIW A;  1NQ4 A;  4DG9 A;  5KP6 B;  2MVV A;  2N6Z A;  1KLP A;  2QNW A;  4R0M A;  4BPG A;  1L0H A;  2GDW A;  2KGE A;  2AF8 A;  2N5I A;  2JQ4 A;  2N98 A;  5KP8 B;  2KGC A; 
#chains in the Genus database with same CATH topology
 2JO0 A;  3G21 A;  2KGD A;  1YI2 P;  2GDY A;  2VSQ A;  1M6N A;  1VQ9 P;  1ZNV A;  3G71 P;  3CXC O;  1ZMB A;  2GZJ A;  1K30 A;  2XXM A;  2OTJ P;  3G26 A;  3DPH A;  4U0F A;  1M1K Q;  1VQM P;  3DS3 A;  4PXH B;  2PEI A;  2K0Y A;  1UNK A;  3LRY A;  3CCS P;  1BXI A;  3G0V A;  1YIJ P;  2MR7 A;  1YJN P;  2KWL A;  1Q82 Q;  2FQ2 A;  1T8K A;  2L0Q A;  5I4T G;  1YHQ P;  1K8A Q;  1Q7Y Q;  2DNW A;  3DS5 A;  2L6E A;  3CCV P;  2M8P A;  2LTE A;  3I56 P;  2JU1 A;  4PH1 A;  2EFJ A;  3H4E A;  2CGQ A;  1RNI A;  2AFE A;  1EIA A;  3DS0 A;  2K93 A;  3GZM A;  1IMP A;  2LL8 A;  2PEJ A;  2LIU A;  5HVC A;  2GDX A;  3CME P;  1YJW P;  2KOR A;  1D1D A;  2AVA A;  3NY7 B;  3DS1 A;  3U43 A;  4H2W C;  2WPT A;  3WBH A;  1NQ4 A;  2EG5 A;  1K73 Q;  3OW2 O;  1KLP A;  4BPG A;  1L0H A;  1RO2 A;  2N5I A;  2JQ4 A;  5JPA A;  5KP8 B;  2XT1 A;  2L9F A;  2PEN A;  5HGL A;  5DCK A;  1E0H A;  1HY8 A;  3RG2 A;  2N50 A;  2LF4 A;  2MR8 A;  3DTJ A;  3DS2 A;  1E6J P;  1X3O A;  2KG9 A;  2FHS C;  1HQB A;  3G6E P;  4HKG A;  4U0A A;  1M74 A;  7CEI A;  1S72 P;  1VQ4 P;  2M5R A;  2GYK A;  2K5X A;  2FQ0 A;  1UJZ A;  4GR6 A;  2LPK A;  3H0D A;  1VQK P;  2K92 A;  1GXH A;  2ONT A;  5KP7 B;  3CCL P;  1AF8 A;  2XZ1 C;  2CNR A;  2JYG A;  2M8L A;  4UHP B;  1YJ9 P;  3G1I A;  2KG8 A;  4XFY A;  4IPY A;  5HGN A;  2BHV A;  4BPH A;  3CC2 P;  2DGY A;  2VLN A;  2JBG A;  2LML A;  2KOD A;  1GPJ A;  1DNY A;  1EOQ A;  2L4B A;  5EW5 E;  1GXG A;  1IUQ A;  3I55 P;  2NO8 A;  2KOP A;  3EJE A;  2GZF A;  4DG9 A;  3NTE A;  2MVV A;  1VQ5 P;  2OTL P;  2OAR A;  3MGE A;  2GDW A;  4XRQ A;  2PEM A;  4PH0 A;  1VQO P;  2KOO A;  1A43 A;  3GJN A;  1KD1 Q;  3CPW O;  1OR5 A;  3CCE P;  2P9X A;  1A8O A;  1BAJ A;  1EMV A;  2LKI A;  2K94 A;  2MY5 A;  2VLO A;  5EJD A;  1VQ6 P;  4WYM A;  1KQS O;  1VQ7 P;  1AUM A;  2KOQ A;  4H2Y C;  2PNG A;  2FQ1 A;  1QRJ A;  5F2O A;  2JYL A;  3VRL C;  2GZE A;  2Z44 A;  2GZG A;  3CCM P;  1KC8 Q;  2FVF A;  4U0E A;  3G1G A;  2FAE A;  1VKU A;  5CZD B;  1CEI A;  2VLP A;  3G29 A;  1VQP P;  2E1M A;  3CD6 P;  2MD9 A;  2PEK A;  2ROQ A;  3E2D A;  2XZ0 D;  4H2X C;  2X2B A;  1QVF O;  2N5H A;  1M6E X;  1L0I A;  1FR2 A;  4PWV B;  2FAD A;  4NEO A;  3B4Q A;  4CA3 A;  2Z46 A;  2JB0 A;  2CWO A;  3CE7 A;  2QA4 P;  3HZQ A;  3CC4 P;  4XRO A;  1M90 Q;  3EJB A;  2Z45 A;  2KR5 A;  5F2N A;  2KOS A;  2GZI A;  2FVA A;  1RO0 A;  1Q86 Q;  2K0X A;  5KP6 B;  2N6Z A;  3GKL C;  4R0M A;  2KGE A;  5BS2 A;  2AF8 A;  1VQL P;  2JAZ A;  2PEO A;  2KGC A;  2N6Y A;  1Q81 Q;  2K0D X;  2ERH A;  3CCU P;  3HYB A;  4XFZ A;  1NJI Q;  1N8R Q;  2JU2 A;  3RG6 C;  2AFD A;  3CC7 P;  2EHT A;  3EJD A;  5F2K A;  3LMO A;  4MRT C;  2EIA A;  3GZL A;  2BUO A;  2KG6 A;  5HGM A;  2M8N A;  2KGA A;  5BS1 A;  1Z6M A;  4COP A;  2VLQ A;  3G4S P;  1VQ8 P;  3CMA P;  3G28 A;  2MVU A;  2L22 A;  1AYI A;  3CCR P;  1W2B O;  2CQ8 A;  1IMQ A;  4XFX A;  2FAC A;  2KW2 A;  3CCQ P;  2FVE A;  2XV6 A;  4QNB A;  1JJ2 O;  3H47 A;  4U0D A;  4GR2 A;  2QEX P;  1ACP A;  1YIT P;  1VHN A;  2JGP A;  2PY8 A;  3DS4 A;  4BPF A;  1K9M Q;  2CG5 B;  2MF4 A;  2K2Q A;  2PEQ A;  5HV8 A;  4QKO A;  1DV5 A;  1MZ8 A;  2LOL A;  4U0B A;  2EHS A;  1F80 D;  4IZ6 A;  3M1M A;  1QVG O;  2LIW A;  1VQN P;  5HGO A;  4F37 A;  3CCJ P;  4M0I A;  3B5I A;  2QNW A;  4COC A;  3P05 A;  2N98 A;  4U0C A;  3Q20 A; 
#chains in the Genus database with same CATH homology
 2KOO A;  2N6Y A;  2L9F A;  1OR5 A;  2KGD A;  2LKI A;  1HY8 A;  2K94 A;  2GDY A;  2VSQ A;  2MY5 A;  3RG2 A;  5EJD A;  2N50 A;  2MR8 A;  2KOQ A;  2JU2 A;  4H2Y C;  2PNG A;  1X3O A;  2FQ1 A;  2AFD A;  2EHT A;  3EJD A;  4PXH B;  2KG9 A;  2K0Y A;  2FHS C;  3LMO A;  4MRT C;  3GZL A;  2KG6 A;  1HQB A;  2FVF A;  2KGA A;  2MR7 A;  4HKG A;  2KWL A;  2FQ2 A;  2FAE A;  1T8K A;  2L0Q A;  1VKU A;  5CZD B;  2M5R A;  2FQ0 A;  2LPK A;  2DNW A;  2K92 A;  2MVU A;  2L22 A;  5KP7 B;  2MD9 A;  1AF8 A;  2XZ1 C;  2CNR A;  2ROQ A;  2CQ8 A;  2FAC A;  2LTE A;  2JU1 A;  2KW2 A;  2XZ0 D;  4H2X C;  2FVE A;  2X2B A;  2KG8 A;  2CGQ A;  2N5H A;  2AFE A;  1L0I A;  4PWV B;  2FAD A;  4BPH A;  4NEO A;  2LML A;  4CA3 A;  2K93 A;  1ACP A;  3GZM A;  2LL8 A;  1DNY A;  2LIU A;  3CE7 A;  5HVC A;  2JGP A;  2L4B A;  3EJB A;  2GDX A;  2KOR A;  2KR5 A;  4BPF A;  2CG5 B;  2MF4 A;  2K2Q A;  2AVA A;  2KOS A;  3NY7 B;  5HV8 A;  1DV5 A;  4H2W C;  2FVA A;  2LOL A;  2EHS A;  2KOP A;  1F80 D;  2K0X A;  3EJE A;  4IZ6 A;  2LIW A;  1NQ4 A;  4DG9 A;  5KP6 B;  2MVV A;  2N6Z A;  1KLP A;  2QNW A;  4R0M A;  4BPG A;  1L0H A;  2GDW A;  2KGE A;  2AF8 A;  2N5I A;  2JQ4 A;  2N98 A;  5KP8 B;  2KGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...