3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
3CCLP 3CC7P 1YIJP 1YITP 3G6EP 1QVFO 3CCRP 1VQMP 1KC8Q 1QVGO 1W2BO 3CCMP 3CCJP 3CPWO 1S72P 2QA4P 3CCUP 1VQPP 1Q86Q 3I55P 1JJ2O 1K9MQ 1VQ8P 1M90Q 3CMAP 1KQSO 1N8RQ 1M1KQ 3CCVP 3CCSP 3CC2P 3CC4P 1VQ7P 2OTJP 1YI2P 3I56P 1VQ9P 1VQ4P 1K73Q 1VQOP 3CD6P 1VQLP 2OTLP 1Q81Q 1YJWP 1VQ6P 3CCQP 1K8AQ 1VQ5P 3G71P 1NJIQ 1YJ9P 3OW2O 1VQKP 1Q82Q 1VQNP 3CXCO 1Q7YQ 2QEXP 1YHQP 3CCEP 3CMEP 3G4SP 1YJNP 1KD1Q
chains in the Genus database with same CATH superfamily
1L0NG 1LTBC 2LOLA 1PP9E 3Q5PA 5F2NA 2ZVOB 1ZOYC 3U1CA 1NU1J 4M3LA 1DEEG 3WU2H 1L0NJ 2VLPA 2YMYA 1IFMA 4XFYA 1E6JP 2WSSH 2OYIB 2KNCB 1P84E 1FAVA 3L70E 2N9YB 2QEXP 3L73J 2BCCG 2IYPA 3M1MA 1N7SD 1RF1A 1N7LA 3KZIH 1FZAA 1NU1K 2BCCJ 4QNBA 1JY3O 1L0NK 2BQ1E 2D2CB 3BATA 3MIWA 3U1AA 2OYIC 3GHGA 2FYZA 3CWBG 1X3OA 3V5BA 3RK3E 5EFWB 1SLQA 2K94A 4H44D 1BCCE 2Y9YA 3GG2A 2D2CC 1AF8A 1Q2NA 3A0BE 3P8CE 1CI6B 1FOSF 1T3UA 1NTKG 2ZXEB 2VLOA 2JEEA 2K3RA 2WWWA 2R3SA 2H43A 3V2RA 1NTKJ 3G6EP 2HODB 2MKVA 2WSCJ 4U3FG 3O6QB 2E76D 5CZDB 3JSVC 1RE3C 1GW4A 1FE6A 3PH0A 1ZNVA 3L74G 1GDTA 1P84I 1RF0C 2Z4EA 3G26A 3DPHA 2K88A 5B5EE 3L4FA 2FHSC 5DJUB 1K05A 2NRGA 1NTKK 1EC5A 4DCKA 2WVRA 4GKGA 1RF1B 1QL2A 5B66H 1NU1E 1VQ7P 1MKMA 1BE3D 1L0NE 3Q5RA 4ASWA 2HR3A 1S5LH 1KYOH 2KP8A 1J1EB 4D6TG 2XDJA 2EHSA 5C39A 3RK2D 4AQRD 4HKGA 2JR8A 3H1IJ 1LT1A 3GHGB 4D6TJ 1RF1C 2KOOA 1PP9D 1NTMG 3RL0g 2BCCE 3AEDC 4WWIA 1CSBA 5CJ4A 3AE2C 2KORA 1T6AA 1J1EC 3A0HH 5TISE 2CPBA 1NTMJ 3BRTB 1AYIA 3GHGC 2GDWA 1P84D 2IFMA 3L70D 3EQ2A 2K37A 4PXHB 1BGYJ 2N9BA 3CWBE 1PV3A 1QRJA 4HB1A 4WYMA 1GTWA 3HYBA 2MVVA 3AE8C 1NTMK 4BRYA 5KKZB 4I6MC 1M8OB 3VOPA 4U0BA 1NTZG 1PGPA 2GUVA 1EZVG 1W5CE 2M3BA 4H2YC 1KB9H 3CX5E 3RK3D 1SQPG 1NTKE 1KN7A 1GU5A 1AUMA 1NTZJ 1FS0E 1BCCD 1SQPJ 3O8ZA 4U3FE 2R5BA 1Y47A 5KKZC 4MRTC 1VF5D 3H1HG 1HUCA 1YTZI 1KQGB 1YITP 3L74E 2Q7CA 1NTZK 5TJHA 1LTSC 3KQGA 4WB4A 2KS1A 1SQPK 1T2KC 1JMMA 4K3AA 2J5UA 3OJAB 3GLMA 5HGMA 1NAFA 4TLFA 1SVFA 1EIAA 5APXA 4RJTA 2XZ0D 4R0MA 1GL2A 4D6TE 1IMQA 3EWKA 3G1IA 5KAFH 2O1KA 2NPSA 3L37A 1NJIQ 2IDBA 5E79E 1NTME 1Q7YQ 1YHQP 1GW3A 2GZGA 3CX5I 2FQ1A 2FY8A 3RBZA 2KSEA 1IC2A 5KP8B 1E79H 4XROA 2Q1KA 4H2XC 3CD6P 2BCCD 4WY4B 2KGDA 1S9KE 1N73B 4YXDC 1BSHA 2IPPA 3CXHH 2Q3EA 2E75B 1VKUA 1ZXGA 1MFTA 2E75D 1NTZE 3CWBD 3H1JG 2LXBA 3IR9A 4WY4C 1EZVE 1N73C 2KS1B 1SQPE 4IL6H 1JNMA 2P9XA 3H1JJ 2KOPA 3CCLP 3HUSA 2MR7A 2IBZG 1TU3F 2E75C 2E1MA 3CX5D 1HVVA 3H1HE 3CMAP 1NTKD 4HH2A 2JU1A 1KFMA 4IFFA 1GL2B 2Y9ZA 1VQ6P 1LTJB 4XRQA 2WPSA 4ZKPA 5GTHE 4U3FD 1IFDA 4HJGH 2V7QJ 2E5TA 1FC2C 2L4BA 3H1KJ 3L72J 1DEBA 3AEBC 1KC8Q 2M3EA 4DJGA 3L74D 4GDOA 5HGLA 1GL2C 2QJPB 3MP7B 4BWNA 1S5LX 2ZYGA 3IFMA 3ITKA 3A0HE 1LTJC 3H32B 2C9LY 1NYHA 1VQ5P 4EI2A 1FOSE 2B87A 3AE3C 3WMM0 1QVFO 4NEOA 1S2EA 1G2CA 2WSEH 2QJPC 3SWYA 1EZVI 5AW2B 2WPTA 4D6TD 2H89C 1PEQA 3H25A 1URQA 3HE4A 3B71A 1VQLP 5CCHC 2PAJA 1KV4A 3G3ZA 4L76A 2KB7P 5K5GB 2GZJA 2CGQA 2OYOA 3LIDA 2W83C 1KMIZ 3KHUA 4ZMDA 4JYCA 1KYOI 2IYOA 5BS2A 3HE5B 1H88A 5JPAA 2XV5A 4UB6H 1FDIA 1VQKP 3DTJA 2Q5UA 1S9KD 3LRYA 5AW7B 3H1JE 1L0LG 3KYQA 2YKPA 2P10A 3CCVP 2W6JH 1L0LJ 1ACPA 1LP1A 3AE1C 1NTZD 2R44A 4U0EA 3VYIA 2B9BA 4XA4A 1OFCX 2FQ2A 1SQPD 3MGEA 4U0DA 5AVSB 1YIJP 2JYLA 2FXMA 3R2PA 1AJYA 3H1KE 3HTKA 1LT9B 1SQVG 1L0LK 2WTYA 2PP6A 1L2PA 3H1HD 3D6ZA 1T3JA 2K9JA 2YIUB 3TNUA 1HJ0A 1AV1A 1A43A 3WUUA 1KB9I 5CJ0A 4WVZA 1EQ7A 2WSEJ 3EJBA 5KJ7D 1IFIA 1UIXA 2JO1A 3JCUE 1PGOA 1LT9C 5APQA 1RH5B 2W8ZA 1ZRTD 3DS0A 1PL5A 1SFCA 2W90A 2YIUC 2N50A 1Y8AA 4PV1B 5DJTB 2YO3A 4A7PA 4ZKUA 3M0AA 1QX8A 2FYUD 4PV1D 1IJDB 4YTPC 2WQYC 3HD7B 3PJSK 1S4XA 2XXMA 3V2QA 1N7SA 3HD7D 4PV1C 3IN6A 4IL6E 3C1LA 3CCQP 1FZBA 2O3JA 5AVXB 3M0DA 3RGUA 1CZQA 1J2JB 2FVAA 4L75A 2M8PA 3HD7C 3V4WA 1Z56A 5HV8A 2ZAEB 2LKMA 3BASA 2Y0CA 3HTKB 1FR2A 2CQ8A 5BS1A 1L0LE 1DX7A 2OQQA 4IZ6A 5APUA 1NU1G 2ERHA 4GOFA 1IUQA 5EJDA 1M1JB 2W6AA 3B5NB 2ONTA 3H1JD 3TF5A 1NKNA 1SQXJ 3MHVA 1H0TB 3UIAA 3B5ND 2FVFA 1BAJA 3L73G 1OMIA 2FKWB 2IBZD 1SQVE 1JY2N 3CXHI 3CXCO 4AUWA 1YQ3C 2FAEA 3CCEP 2RH0A 3TGUJ 4CA3A 1M1JC 1EXIA 2Q3IA 3VMYA 3B5NC 4PD4D 2R5DA 3L71G 3P8MC 3VP9A 2LIUA 5CCGD 4W7YA 2O01N 1GU4A 1LTGC 3L71J 5AW3B 3MZWB 4ASVA 2DNWA 2GDXA 2D2CD 1W2EA 3LMOA 3AEEC 1LTTC 4OGQB 5CCGC 3D71A 1GK6A 3B4SA 3NXSA 2JDIH 2O1JA 1KQSO 1NHLA 1MFZA 1SQQD 2CWOA 1T8ZA 1SQBD 1EDKA 1GD2E 1CEIA 1X9VA 4OGQC 4PH0A 1BSNA 3F5HA 2MJZA 3VRLC 2ITAA 3R4YA 2FXOA 1GK4A 2P2UA 2WT7A 5AW6B 3G28A 2B89A 5HGOA 1OWAA 1HJBA 1KZUB 2IFNA 2VSQA 5AW4B 2QM7A 2E5YA 2N5HA 1YBKA 1Q86Q 2FBWC 3AE5C 1X0TA 2PRRA 2PEMA 3U43A 5AW5B 4UB8H 4BXLA 2C0WA 1GZLA 3H1IG 3LW5H 3V4QA 1RE4A 1QEXA 1L0LD 2R32A 1IMPA 1FZGA 1Q82Q 5AW9B 1S1CX 3MTUE 3L73E 1HF9A 1L4AA 1NKZB 1FZCA 2PENA 3CL3D 2N1TA 1EMVA 3I55P 4UHPB 3VMXA 2YKOA 3TK1A 3CLQA 1VQ9P 3P32A 4JBZA 2N98A 3L71E 3K5BA 3U59A 1MZ9A 1BGYG 4GOEA 4LC1A 1SQVD 1AQTA 1JJ2O 3VMZA 2QRXA 2KK7A 2AEFA 1OVRA 2J59M 3VP8A 1K04A 4Y28J 2V4HA 2KODA 1VDFA 4W7ZA 1UNKA 1UJZA 2WPVB 2OYHA 3SWKA 4Y99B 4YXWH 1L0HA 1LTIC 3KXDA 1RNIA 4DG9A 3P8CD 3FGAD 2K0YA 2PY8A 2CK3H 1U7JA 1T2KD 4R4LA 2JWAA 5APWA 2Y0EA 3AEFC 2G8YA 1IO4A 3AE6C 4O9BA 4Y99C 1NGMB 5HVCA 3FXEA 2JWDA 4IOIH 4PJ0H 3WU2E 1DD3A 3A3YB 1JTHA 1OR5A 1K73Q 4GR2A 1GPJA 4H2WC 3QH9A 2FFDA 5KAIH 4NPDA 2PGDA 1AFOA 4KT0J 3EFGA 3A2AA 3KZIE 3H1IE 2A45H 1G1IA 3CCMP 1USDA 1S72P 1OW7A 1Q81Q 1NU1D 2KSJA 1L0ND 1R5LA 1RO2A 1NWQA 4BRYB 4NPFX 2QNWA 3L73D 3PRJA 1JCDA 2K2QA 2M5RA 4H13B 1BGYE 2SPZA 4KHXA 1HGZA 1KILA 1E0HA 3L71D 2M8LA 4WY4D 1N2DC 2M5AA 2MF4A 3AE4C 2MR8A 4H13C 4GIFA 1YYCA 3DS2A 1ZMEC 1VHNA 1JY2P 2H88C 4TT3H 1JB0J 5APTA 3L75J 3G9RA 1HGVA 1EDJA 4OH8B 2FYNB 3I5CA 2XZRA 5GTIH 2I1KA 3WUVA 3RL0B 3NTEA 5B66E 3NY7B 1X22A 1YI2P 2N5IA 2PFXA 1S5LE 1KYOE 1CW5A 2P58A 1VPCA 3L72G 2XNXA 2A06G 2KOGA 1D1DA 2L0QA 3H1KG 2LF4A 1GL2D 2NPSB 2KIKA 2FYNC 5BVZA 1FJKA 1KTMA 3AE7C 2Z46A 2NPSD 1MUUA 3RL0C 2N6ZA 1LWUA 1JY2O 2AEJA 5KP6B 2FACA 2K9YA 1YJWP 2KR5A 2N6YA 3S4RA 1MV8A 2NPSC 1A8OA 5F2KA 1A02J 3GZLA 2K0XA 3Q3DA 2LL8A 2GM4A 3A5TA 1XTGB 5CCHD 2WSFH 3CPWO 4N78E 4BPFA 2IX7C 3H1ID 3M9BA 3AECC 1RQUA 4KJMA 2JB0A 3P05A 1NO4A 3E1RA 1X79B 5KP7B 3CI9A 1KQLA 2KGEA 1P84H 2NZ2A 1NTMD 2K5XA 1KB9E 1T8KA 3H0DA 4CPGA 3FWNA 2YNYA 2KG9A 1U57A 3HUSB 3ZDMA 2E43A 2OGUA 5KJ7A 3D6YA 2VLNA 4EIJA 4DOJA 1BGYD 1DNYA 3GF3A 2W6BA 2MD9A 3VTPC 2KG6A 3TDKA 3HUSC 4W80A 3BVHA 3M9QA 5M1BA 2AVAA 3B4QA 2JYGA 1KFNA 1IK9A 3MUDA 3B5IA 1EZVD 1M57D 2FXPA 1JUNA 1M74A 5AW1B 2B87B 2C9NY 1FDMA 2LMLA 3L72E 1BE3J 2A06E 3Q20A 4C7NA 4U0CA 5KAFE 2Z44A 1G2CB 2JAZA 4AYCA 1IFNA 1XTCC 2PEOA 3PTZA 1KYOD 1URQB 3HE4B 5B5EH 2WSFJ 4BPHA 1QGKB 1G1JA 1URQD 2EFJA 4IFDK 2KYVA 3L35A 3V2PA 2QJKB 1D7MA 2OTJP 1L0IA 5KTBA 2AEMA 2LR2A 1URQC 4JPZB 4DZOA 2E74B 2ZVNB 4U0FA 3IAOA 3CXHE 4RKUJ 2LIWA 1GXGA 1M56D 3TYYA 3S9OA 1IZNB 2QJKC 4N78D 2HYNA 2OYIA 2KNCA 1VQ4P 2XV6A 5TISH 2RN0A 2E74C 4H0LB 2EG5A 1NAYA 1LP1B 2AXCA 5GTIE 2GYKA 2YXQB 5AVRB 3N4XA 4IFMA 2QE7H 1KB9D 2FVEA 1K9MQ 1RQVA 4C7NB 1IFJA 4H0LC 3DS3A 4HKZH 1SQXG 2K9JB 3TNUB 5APVA 1BDCA 3GKLC 2XZ1C 2WITA 1RE3A 3CX5H 2KXPB 1CI6A 2WSCH 3B8EB 2H8PD 3GW6A 2PNGA 3CC4P 4R4MA 3H47A 4EDFA 1NH4A 3TGUG 1JO5A 4OVNF 1SFCB 1WRGA 5CMZA 2HODA 4U0AA 3AEAC 2Q6QA 2ZT9B 1FJPA 1SFCD 1IFPA 3GF7A 2B88A 5AVUB 2ZT9D 2JJLA 4DT0A 2KG8A 1NVOA 1SQXK 2RMZA 1AVOA 3NFQA 5KLVG 3H1KD 3L72D 2A06D 1FZFA 1SFCC 3II6A 3RG6C 2ZT9C 2QM8A 1HQBA 2PEJA 1N7SB 5KLVJ 4XFXA 4NPEA 2KGCA 2DW3A 3VN0A 4N6JA 3EJDA 2KZIA 4OGQD 1JMBA 2CPSA 1IK7A 1N8RQ 2VRSA 3NTNA 1H89A 4LLHA 1GXHA 4UB6E 1N7SC 4XFZA 5KLVK 1Z6MA 1AVYA 5E79H 3M06A 3M0DC 2LPKA 4H44B 5AVYB 2WZ7A 3CWBJ 2BEQD 3CXHD 1JOCA 4WBAA 2BUOA 3SSUA 2L22A 1KQFB 5AVTB 2KUBA 2H7HA 1K30A 2KZJA 2E76B 4H44C 2KLVA 3SFDC 4I7ZB 1HTLC 2MY5A 1OXZA 1FBMA 5L8RJ 1DH3A 1SS1A 2EIAA 1QL1A 4C46A 1SQXE 1ZN5A 4U3FJ 2Q9IA 3MD0A 2E76C 3BCCG 1S3JA 3L74J 1MZ8A 4OWFA 4I7ZC 3G21A 3EJEA 2KW2A 2Z45A 3TGUE 2IZ0A 3BCCJ 3HRNA 4I2LC 4M0IA 1OVVA 1ZV8A 1J1DB 1U7MA 3RK2B 2K1AA 3AEGC 2M0BA 2QIWA 1HWTC 3IF4A 2XNDH 1N86A 5GTHH 1LJ2A 5KLVE 2QG4A 2KLUA 1WT6A 1AQ5A 2LXCB 1DV5A 2VLQA 5CBOA 2PEIA 4YPCA 2GZFA 2WPRA 1ZP0C 3RK2C 1J1DC 3DS1A 3EFFK 5BU5A 1ZLLA 2WT7B 3SFEC 1YJ9P 1LGHB 2EHTA 4K35A 1A02F 4RO0A 3CMEP 3CC7P 1YQ4C 1GMJA 2K93A 4JYBA 5APSA 3Q2YA 1EXJA 3CC2P 3W67A 1M6EX 2C0XA 2P67A 3N7NA 2DGYA 3RK3B 2POHA 1OIPA 1AA0A 4GODA 1JM0A 3MGNA 4WY4A 2QVAA 2ZFCA 5AW8B 1L4AB 1VF5B 3LW5J 1FZCB 1N73A 2N1TB 2PEKA 3M91A 2QSIA 1L4AD 1FDOA 2KI7B 3RK3C 2N1TD 1FU1A 1RE4C 4COPA 2J58A 2GA1A 4I1LA 1PEUA 4COCA 1DD4A 3G1GA 1KILE 2XU6A 3FX0A 3S1KA 3H1HJ 2R3CA 1L4AC 1VF5C 4HYTB 1OVUA 1RO0A 3BCCE 1FZCC 2N1TC 1PZQA 3GZMA 3QWOC 1NOHA 3A7OA 1SQXD 1PEOA 3M9HA 4N3YB 1OW8A 2KWLA 4EYYQ 4PD4H 2I8DA 4PH1A 2LTEA 2V7QH 3F89A 2FYUG 5AVZB 2HG5D 1VQPP 3TGUD 1LTJA 3OAKA 3NMDA 4QKOA 1EDIA 2OYHB 3V6IA 2K0DX 4L73A 2FYUJ 5HGNA 4H13D 4L74A 1JY3N 3D70A 3G4SP 1YJNP 2UWJE 3TSIA 5KLVD 5AVQB 5AVVB 3H1LG 3JCUH 3H32A 4Z1MH 2OYHC 3L75G 1PEMA 5CCHA 2FYUK 2JBGA 3H1LJ 1LTAC 3USSA 2E42A 1PPJG 5AVWB 2YO2A 3FWLA 2OTKE 2ZYDA 2HFED 1JTHB 2ZXXA 2GDYA 5BU8B 2K92A 2FFDB 2P1JA 2QJYB 5APYA 1BXIA 1KLPA 3C9IA 1EDLA 1ZW0A 4UB8E 3V2NA 1VQOP 2A45G 3RL0D 2KGAA 2WPQA 1RHZB 3WUTA 4C7RA 1ZR2A 1VQNP 1EOQA 2JO0A 4GT1A 1NQ4A 2P7JA 2ROQA 2FFDC 2L9FA 3CCRP 2QJYC 3H4EA 2QA4P 3CCUP 3L36A 3HE5A 3SWFA 1PIXA 2I1JA 5H2FH 2Z5HA 2ZJSE 2AXTH 4U7JA 3G29A 4JF7A 3LIEA 4PWVB 1OW6A 1OX3A 2NO8A 1KORA 1KILB 1ZRTE 1LNQA 2IZ1A 1VQMP 2M5AB 2BEZF 1KILD 2M8NA 1JEKA 1M1KQ 3BCCD 2FYUE 1M7LA 2L91A 1SQQG 3H6PA 2BASA 2CG5B 4QMAA 1Y9BA 1KILC 2OTLP 3T97A 5CHXA 3Q1MA 1LT9A 1SQBG 2M8RA 3C8VA 1SQQJ 2XT1A 1PFIA 1M90Q 3E7KA 1SQBJ 1DIPA 1FZEA 2JQ4A 4EOTA 3H1LE 2JKVA 1HH0A 3L75E 1KD1Q 2HLOA 1SQQK 1PPJE 4XFJA 1W2BO 1PGJA 2X2BA 1SQBK 4PJ0E 2ZYAA 3G0VA 2L5GB 1LWUB 3A0BH 3JC22 3DS5A 2AFEA 5KAIE 1BE3G 1UIIA 4B86A 1R8EA 3GJNA 3HD7A 2JP3A 2PEQA 2HPCA 1F80D 5AW0B 1LWUC 3CCSP 2RKLA 2IBZE 1PP9G 1HBWA 2O01H 1SP4A 1ZR4A 4XE5B 5DCKA 4PD4E 1PP9J 3RBXA 4F37A 2KOQA 5CBNA 1OZHA 3T97B 3GMAA 2FADA 1WMKA 3L70G 1VQ8P 3KDPB 1SQVJ 3L70J 3AE9C 1M6NA 4GR6A 1M1JA 3WBHA 3B5NA 2GUSA 1H0TA 3DS4A 3HZQA 2E74D 1RY3A 1SQQE 3CE7A 1SQBE 1SQVK 2Y0DA 1ZMBA 5KJ7C 3W68A 3E1IA 2JU2A 2LKIA 1K8AQ 4RESB 1H8AA 3G71P 5EW5E 1YTZT 3OW2O 4IPYA 3PP5A 1BCCG 5I4TG 5CCGA 2A45I 2XKMA 2GZEA 5F2OA 2OARA 2G3AA 1JCCA 2L6EA 1Q90D 2YKQA 3ABVC 4H0LD 3Q5SA 1QVGO 1BCCJ 4BPGA 3BRVB 2IBZI 4LGDE 4ZNCA 2HPCB 2CNRA 3VMAA 4PD4I 2YXRB 1X8YA 1E5WA 3PHLA 3H1LD 3RG2A 1R5SA 4MN4C 3MUDC 5KLIB 2AFDA 2BHVA 1PGQA 2AF8A 3L75D 3KPEA 3CCJP 2FQ0A 3OA7A 2KOSA 1PPJD 2YMKA 7CEIA 4IL6X 1QLED 1BE3E 1HY8A 3PLNA 2O01J 2Z5IA 1RF0A 5H2FE 3I56P 1USEA 1VL2A 1JY3P 2AXTE 3FXDA 2W27A 3E2DA 4JQ0D 1BDDA 2JGPA 2GZIA 3P7KA 5KLIC 2MVUA 2WMMA 3O6QA
chains in the Genus database with same CATH topology
3CCLP 4U0FA 4PH0A 1YITP 4PH1A 3VRLC 2E1MA 1VQMP 5F2NA 2M8PA 2PEIA 3H0DA 1VQPP 2M8NA 1VQ8P 3CMAP 1N8RQ 3DS2A 1M1KQ 3CCVP 3DS1A 1VQ7P 4XFYA 3G28A 5BS1A 1VQ4P 1VQ6P 5HGNA 1E6JP 5HGOA 4XRQA 2XV6A 4XFZA 4U0EA 1RNIA 1YJ9P 5HGMA 1M6NA 4GR6A 1EIAA 2EG5A 2PY8A 3WBHA 2QEXP 3MGEA 3CMEP 3G4SP 1YJNP 4U0DA 2OTLP 3CC7P 1YIJP 3M1MA 2JYLA 1IUQA 1KC8Q 3DS4A 3HZQA 2ONTA 1Q86Q 2XT1A 1K9MQ 4QNBA 5HGLA 1M90Q 3NTEA 2PEMA 3G1IA 3CC2P 1PEMA 2BQ1E 2BUOA 1BAJA 1YI2P 1M6EX 1K73Q 1ZMBA 2JYGA 4GR2A 2DGYA 1VQ5P 1K8AQ 3DS3A 3G71P 1NJIQ 3B5IA 1D1DA 1A43A 2LF4A 4IPYA 3OW2O 1Q82Q 1K30A 5I4TG 3CXCO 1Q7YQ 1YHQP 1M74A 3CCEP 5F2OA 1KD1Q 2OARA 2L6EA 2Z46A 1QVFO 1QVGO 1W2BO 3CCMP 2PENA 1S72P 3I55P 3Q20A 3DS0A 2EIAA 3G0VA 4U0CA 2Z44A 1QRJA 3CC4P 4WYMA 3H47A 4XROA 3HYBA 1PEQA 2PEKA 1VQ9P 3CD6P 1VQOP 1VQLP 1Q81Q 1YJWP 1A8OA 2PEOA 3DS5A 5F2KA 4U0AA 1VQNP 4COPA 2JO0A 1EOQA 4U0BA 3G21A 1RO2A 1PEUA 2BHVA 4COCA 3G1GA 2Z45A 3G6EP 2EFJA 3CCRP 3H4EA 2PEQA 3CPWO 3CCJP 2QA4P 3CCUP 1JJ2O 1AUMA 1RO0A 1KQSO 4M0IA 3CCSP 2XXMA 2OTJP 3P05A 3I56P 3RG6C 5BS2A 3E2DA 2CWOA 3DPHA 3G26A 5JPAA 3CCQP 1PEOA 3G29A 2PEJA 1VQKP 5DCKA 4XFXA 2P9XA 3DTJA 2KODA 2M8LA 3LRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CC7 P;  1YIJ P;  1YIT P;  3G6E P;  1QVF O;  3CCR P;  1VQM P;  1KC8 Q;  1QVG O;  1W2B O;  3CCM P;  3CCJ P;  3CPW O;  1S72 P;  2QA4 P;  3CCU P;  1VQP P;  1Q86 Q;  3I55 P;  1JJ2 O;  1K9M Q;  1VQ8 P;  1M90 Q;  3CMA P;  1KQS O;  1N8R Q;  1M1K Q;  3CCV P;  3CCS P;  3CC2 P;  3CC4 P;  1VQ7 P;  2OTJ P;  1YI2 P;  3I56 P;  1VQ9 P;  1VQ4 P;  1K73 Q;  1VQO P;  3CD6 P;  1VQL P;  2OTL P;  1Q81 Q;  1YJW P;  1VQ6 P;  3CCQ P;  1K8A Q;  1VQ5 P;  3G71 P;  1NJI Q;  1YJ9 P;  3OW2 O;  1VQK P;  1Q82 Q;  1VQN P;  3CXC O;  1Q7Y Q;  2QEX P;  1YHQ P;  3CCE P;  3CME P;  3G4S P;  1YJN P;  1KD1 Q; 
#chains in the Genus database with same CATH topology
 1L0N G;  1LTB C;  2LOL A;  1PP9 E;  3Q5P A;  5F2N A;  2ZVO B;  1ZOY C;  3U1C A;  1NU1 J;  4M3L A;  1DEE G;  3WU2 H;  1L0N J;  2VLP A;  2YMY A;  1IFM A;  4XFY A;  1E6J P;  2WSS H;  2OYI B;  2KNC B;  1P84 E;  1FAV A;  3L70 E;  2N9Y B;  2QEX P;  3L73 J;  2BCC G;  2IYP A;  3M1M A;  1N7S D;  1RF1 A;  1N7L A;  3KZI H;  1FZA A;  1NU1 K;  2BCC J;  4QNB A;  1JY3 O;  1L0N K;  2BQ1 E;  2D2C B;  3BAT A;  3MIW A;  3U1A A;  2OYI C;  3GHG A;  2FYZ A;  3CWB G;  1X3O A;  3V5B A;  3RK3 E;  5EFW B;  1SLQ A;  2K94 A;  4H44 D;  1BCC E;  2Y9Y A;  3GG2 A;  2D2C C;  1AF8 A;  1Q2N A;  3A0B E;  3P8C E;  1CI6 B;  1FOS F;  1T3U A;  1NTK G;  2ZXE B;  2VLO A;  2JEE A;  2K3R A;  2WWW A;  2R3S A;  2H43 A;  3V2R A;  1NTK J;  3G6E P;  2HOD B;  2MKV A;  2WSC J;  4U3F G;  3O6Q B;  2E76 D;  5CZD B;  3JSV C;  1RE3 C;  1GW4 A;  1FE6 A;  3PH0 A;  1ZNV A;  3L74 G;  1GDT A;  1P84 I;  1RF0 C;  2Z4E A;  3G26 A;  3DPH A;  2K88 A;  5B5E E;  3L4F A;  2FHS C;  5DJU B;  1K05 A;  2NRG A;  1NTK K;  1EC5 A;  4DCK A;  2WVR A;  4GKG A;  1RF1 B;  1QL2 A;  5B66 H;  1NU1 E;  1VQ7 P;  1MKM A;  1BE3 D;  1L0N E;  3Q5R A;  4ASW A;  2HR3 A;  1S5L H;  1KYO H;  2KP8 A;  1J1E B;  4D6T G;  2XDJ A;  2EHS A;  5C39 A;  3RK2 D;  4AQR D;  4HKG A;  2JR8 A;  3H1I J;  1LT1 A;  3GHG B;  4D6T J;  1RF1 C;  2KOO A;  1PP9 D;  1NTM G;  3RL0 g;  2BCC E;  3AED C;  4WWI A;  1CSB A;  5CJ4 A;  3AE2 C;  2KOR A;  1T6A A;  1J1E C;  3A0H H;  5TIS E;  2CPB A;  1NTM J;  3BRT B;  1AYI A;  3GHG C;  2GDW A;  1P84 D;  2IFM A;  3L70 D;  3EQ2 A;  2K37 A;  4PXH B;  1BGY J;  2N9B A;  3CWB E;  1PV3 A;  1QRJ A;  4HB1 A;  4WYM A;  1GTW A;  3HYB A;  2MVV A;  3AE8 C;  1NTM K;  4BRY A;  5KKZ B;  4I6M C;  1M8O B;  3VOP A;  4U0B A;  1NTZ G;  1PGP A;  2GUV A;  1EZV G;  1W5C E;  2M3B A;  4H2Y C;  1KB9 H;  3CX5 E;  3RK3 D;  1SQP G;  1NTK E;  1KN7 A;  1GU5 A;  1AUM A;  1NTZ J;  1FS0 E;  1BCC D;  1SQP J;  3O8Z A;  4U3F E;  2R5B A;  1Y47 A;  5KKZ C;  4MRT C;  1VF5 D;  3H1H G;  1HUC A;  1YTZ I;  1KQG B;  1YIT P;  3L74 E;  2Q7C A;  1NTZ K;  5TJH A;  1LTS C;  3KQG A;  4WB4 A;  2KS1 A;  1SQP K;  1T2K C;  1JMM A;  4K3A A;  2J5U A;  3OJA B;  3GLM A;  5HGM A;  1NAF A;  4TLF A;  1SVF A;  1EIA A;  5APX A;  4RJT A;  2XZ0 D;  4R0M A;  1GL2 A;  4D6T E;  1IMQ A;  3EWK A;  3G1I A;  5KAF H;  2O1K A;  2NPS A;  3L37 A;  1NJI Q;  2IDB A;  5E79 E;  1NTM E;  1Q7Y Q;  1YHQ P;  1GW3 A;  2GZG A;  3CX5 I;  2FQ1 A;  2FY8 A;  3RBZ A;  2KSE A;  1IC2 A;  5KP8 B;  1E79 H;  4XRO A;  2Q1K A;  4H2X C;  3CD6 P;  2BCC D;  4WY4 B;  2KGD A;  1S9K E;  1N73 B;  4YXD C;  1BSH A;  2IPP A;  3CXH H;  2Q3E A;  2E75 B;  1VKU A;  1ZXG A;  1MFT A;  2E75 D;  1NTZ E;  3CWB D;  3H1J G;  2LXB A;  3IR9 A;  4WY4 C;  1EZV E;  1N73 C;  2KS1 B;  1SQP E;  4IL6 H;  1JNM A;  2P9X A;  3H1J J;  2KOP A;  3CCL P;  3HUS A;  2MR7 A;  2IBZ G;  1TU3 F;  2E75 C;  2E1M A;  3CX5 D;  1HVV A;  3H1H E;  3CMA P;  1NTK D;  4HH2 A;  2JU1 A;  1KFM A;  4IFF A;  1GL2 B;  2Y9Z A;  1VQ6 P;  1LTJ B;  4XRQ A;  2WPS A;  4ZKP A;  5GTH E;  4U3F D;  1IFD A;  4HJG H;  2V7Q J;  2E5T A;  1FC2 C;  2L4B A;  3H1K J;  3L72 J;  1DEB A;  3AEB C;  1KC8 Q;  2M3E A;  4DJG A;  3L74 D;  4GDO A;  5HGL A;  1GL2 C;  2QJP B;  3MP7 B;  4BWN A;  1S5L X;  2ZYG A;  3IFM A;  3ITK A;  3A0H E;  1LTJ C;  3H32 B;  2C9L Y;  1NYH A;  1VQ5 P;  4EI2 A;  1FOS E;  2B87 A;  3AE3 C;  3WMM 0;  1QVF O;  4NEO A;  1S2E A;  1G2C A;  2WSE H;  2QJP C;  3SWY A;  1EZV I;  5AW2 B;  2WPT A;  4D6T D;  2H89 C;  1PEQ A;  3H25 A;  1URQ A;  3HE4 A;  3B71 A;  1VQL P;  5CCH C;  2PAJ A;  1KV4 A;  3G3Z A;  4L76 A;  2KB7 P;  5K5G B;  2GZJ A;  2CGQ A;  2OYO A;  3LID A;  2W83 C;  1KMI Z;  3KHU A;  4ZMD A;  4JYC A;  1KYO I;  2IYO A;  5BS2 A;  3HE5 B;  1H88 A;  5JPA A;  2XV5 A;  4UB6 H;  1FDI A;  1VQK P;  3DTJ A;  2Q5U A;  1S9K D;  3LRY A;  5AW7 B;  3H1J E;  1L0L G;  3KYQ A;  2YKP A;  2P10 A;  3CCV P;  2W6J H;  1L0L J;  1ACP A;  1LP1 A;  3AE1 C;  1NTZ D;  2R44 A;  4U0E A;  3VYI A;  2B9B A;  4XA4 A;  1OFC X;  2FQ2 A;  1SQP D;  3MGE A;  4U0D A;  5AVS B;  1YIJ P;  2JYL A;  2FXM A;  3R2P A;  1AJY A;  3H1K E;  3HTK A;  1LT9 B;  1SQV G;  1L0L K;  2WTY A;  2PP6 A;  1L2P A;  3H1H D;  3D6Z A;  1T3J A;  2K9J A;  2YIU B;  3TNU A;  1HJ0 A;  1AV1 A;  1A43 A;  3WUU A;  1KB9 I;  5CJ0 A;  4WVZ A;  1EQ7 A;  2WSE J;  3EJB A;  5KJ7 D;  1IFI A;  1UIX A;  2JO1 A;  3JCU E;  1PGO A;  1LT9 C;  5APQ A;  1RH5 B;  2W8Z A;  1ZRT D;  3DS0 A;  1PL5 A;  1SFC A;  2W90 A;  2YIU C;  2N50 A;  1Y8A A;  4PV1 B;  5DJT B;  2YO3 A;  4A7P A;  4ZKU A;  3M0A A;  1QX8 A;  2FYU D;  4PV1 D;  1IJD B;  4YTP C;  2WQY C;  3HD7 B;  3PJS K;  1S4X A;  2XXM A;  3V2Q A;  1N7S A;  3HD7 D;  4PV1 C;  3IN6 A;  4IL6 E;  3C1L A;  3CCQ P;  1FZB A;  2O3J A;  5AVX B;  3M0D A;  3RGU A;  1CZQ A;  1J2J B;  2FVA A;  4L75 A;  2M8P A;  3HD7 C;  3V4W A;  1Z56 A;  5HV8 A;  2ZAE B;  2LKM A;  3BAS A;  2Y0C A;  3HTK B;  1FR2 A;  2CQ8 A;  5BS1 A;  1L0L E;  1DX7 A;  2OQQ A;  4IZ6 A;  5APU A;  1NU1 G;  2ERH A;  4GOF A;  1IUQ A;  5EJD A;  1M1J B;  2W6A A;  3B5N B;  2ONT A;  3H1J D;  3TF5 A;  1NKN A;  1SQX J;  3MHV A;  1H0T B;  3UIA A;  3B5N D;  2FVF A;  1BAJ A;  3L73 G;  1OMI A;  2FKW B;  2IBZ D;  1SQV E;  1JY2 N;  3CXH I;  3CXC O;  4AUW A;  1YQ3 C;  2FAE A;  3CCE P;  2RH0 A;  3TGU J;  4CA3 A;  1M1J C;  1EXI A;  2Q3I A;  3VMY A;  3B5N C;  4PD4 D;  2R5D A;  3L71 G;  3P8M C;  3VP9 A;  2LIU A;  5CCG D;  4W7Y A;  2O01 N;  1GU4 A;  1LTG C;  3L71 J;  5AW3 B;  3MZW B;  4ASV A;  2DNW A;  2GDX A;  2D2C D;  1W2E A;  3LMO A;  3AEE C;  1LTT C;  4OGQ B;  5CCG C;  3D71 A;  1GK6 A;  3B4S A;  3NXS A;  2JDI H;  2O1J A;  1KQS O;  1NHL A;  1MFZ A;  1SQQ D;  2CWO A;  1T8Z A;  1SQB D;  1EDK A;  1GD2 E;  1CEI A;  1X9V A;  4OGQ C;  4PH0 A;  1BSN A;  3F5H A;  2MJZ A;  3VRL C;  2ITA A;  3R4Y A;  2FXO A;  1GK4 A;  2P2U A;  2WT7 A;  5AW6 B;  3G28 A;  2B89 A;  5HGO A;  1OWA A;  1HJB A;  1KZU B;  2IFN A;  2VSQ A;  5AW4 B;  2QM7 A;  2E5Y A;  2N5H A;  1YBK A;  1Q86 Q;  2FBW C;  3AE5 C;  1X0T A;  2PRR A;  2PEM A;  3U43 A;  5AW5 B;  4UB8 H;  4BXL A;  2C0W A;  1GZL A;  3H1I G;  3LW5 H;  3V4Q A;  1RE4 A;  1QEX A;  1L0L D;  2R32 A;  1IMP A;  1FZG A;  1Q82 Q;  5AW9 B;  1S1C X;  3MTU E;  3L73 E;  1HF9 A;  1L4A A;  1NKZ B;  1FZC A;  2PEN A;  3CL3 D;  2N1T A;  1EMV A;  3I55 P;  4UHP B;  3VMX A;  2YKO A;  3TK1 A;  3CLQ A;  1VQ9 P;  3P32 A;  4JBZ A;  2N98 A;  3L71 E;  3K5B A;  3U59 A;  1MZ9 A;  1BGY G;  4GOE A;  4LC1 A;  1SQV D;  1AQT A;  1JJ2 O;  3VMZ A;  2QRX A;  2KK7 A;  2AEF A;  1OVR A;  2J59 M;  3VP8 A;  1K04 A;  4Y28 J;  2V4H A;  2KOD A;  1VDF A;  4W7Z A;  1UNK A;  1UJZ A;  2WPV B;  2OYH A;  3SWK A;  4Y99 B;  4YXW H;  1L0H A;  1LTI C;  3KXD A;  1RNI A;  4DG9 A;  3P8C D;  3FGA D;  2K0Y A;  2PY8 A;  2CK3 H;  1U7J A;  1T2K D;  4R4L A;  2JWA A;  5APW A;  2Y0E A;  3AEF C;  2G8Y A;  1IO4 A;  3AE6 C;  4O9B A;  4Y99 C;  1NGM B;  5HVC A;  3FXE A;  2JWD A;  4IOI H;  4PJ0 H;  3WU2 E;  1DD3 A;  3A3Y B;  1JTH A;  1OR5 A;  1K73 Q;  4GR2 A;  1GPJ A;  4H2W C;  3QH9 A;  2FFD A;  5KAI H;  4NPD A;  2PGD A;  1AFO A;  4KT0 J;  3EFG A;  3A2A A;  3KZI E;  3H1I E;  2A45 H;  1G1I A;  3CCM P;  1USD A;  1S72 P;  1OW7 A;  1Q81 Q;  1NU1 D;  2KSJ A;  1L0N D;  1R5L A;  1RO2 A;  1NWQ A;  4BRY B;  4NPF X;  2QNW A;  3L73 D;  3PRJ A;  1JCD A;  2K2Q A;  2M5R A;  4H13 B;  1BGY E;  2SPZ A;  4KHX A;  1HGZ A;  1KIL A;  1E0H A;  3L71 D;  2M8L A;  4WY4 D;  1N2D C;  2M5A A;  2MF4 A;  3AE4 C;  2MR8 A;  4H13 C;  4GIF A;  1YYC A;  3DS2 A;  1ZME C;  1VHN A;  1JY2 P;  2H88 C;  4TT3 H;  1JB0 J;  5APT A;  3L75 J;  3G9R A;  1HGV A;  1EDJ A;  4OH8 B;  2FYN B;  3I5C A;  2XZR A;  5GTI H;  2I1K A;  3WUV A;  3RL0 B;  3NTE A;  5B66 E;  3NY7 B;  1X22 A;  1YI2 P;  2N5I A;  2PFX A;  1S5L E;  1KYO E;  1CW5 A;  2P58 A;  1VPC A;  3L72 G;  2XNX A;  2A06 G;  2KOG A;  1D1D A;  2L0Q A;  3H1K G;  2LF4 A;  1GL2 D;  2NPS B;  2KIK A;  2FYN C;  5BVZ A;  1FJK A;  1KTM A;  3AE7 C;  2Z46 A;  2NPS D;  1MUU A;  3RL0 C;  2N6Z A;  1LWU A;  1JY2 O;  2AEJ A;  5KP6 B;  2FAC A;  2K9Y A;  1YJW P;  2KR5 A;  2N6Y A;  3S4R A;  1MV8 A;  2NPS C;  1A8O A;  5F2K A;  1A02 J;  3GZL A;  2K0X A;  3Q3D A;  2LL8 A;  2GM4 A;  3A5T A;  1XTG B;  5CCH D;  2WSF H;  3CPW O;  4N78 E;  4BPF A;  2IX7 C;  3H1I D;  3M9B A;  3AEC C;  1RQU A;  4KJM A;  2JB0 A;  3P05 A;  1NO4 A;  3E1R A;  1X79 B;  5KP7 B;  3CI9 A;  1KQL A;  2KGE A;  1P84 H;  2NZ2 A;  1NTM D;  2K5X A;  1KB9 E;  1T8K A;  3H0D A;  4CPG A;  3FWN A;  2YNY A;  2KG9 A;  1U57 A;  3HUS B;  3ZDM A;  2E43 A;  2OGU A;  5KJ7 A;  3D6Y A;  2VLN A;  4EIJ A;  4DOJ A;  1BGY D;  1DNY A;  3GF3 A;  2W6B A;  2MD9 A;  3VTP C;  2KG6 A;  3TDK A;  3HUS C;  4W80 A;  3BVH A;  3M9Q A;  5M1B A;  2AVA A;  3B4Q A;  2JYG A;  1KFN A;  1IK9 A;  3MUD A;  3B5I A;  1EZV D;  1M57 D;  2FXP A;  1JUN A;  1M74 A;  5AW1 B;  2B87 B;  2C9N Y;  1FDM A;  2LML A;  3L72 E;  1BE3 J;  2A06 E;  3Q20 A;  4C7N A;  4U0C A;  5KAF E;  2Z44 A;  1G2C B;  2JAZ A;  4AYC A;  1IFN A;  1XTC C;  2PEO A;  3PTZ A;  1KYO D;  1URQ B;  3HE4 B;  5B5E H;  2WSF J;  4BPH A;  1QGK B;  1G1J A;  1URQ D;  2EFJ A;  4IFD K;  2KYV A;  3L35 A;  3V2P A;  2QJK B;  1D7M A;  2OTJ P;  1L0I A;  5KTB A;  2AEM A;  2LR2 A;  1URQ C;  4JPZ B;  4DZO A;  2E74 B;  2ZVN B;  4U0F A;  3IAO A;  3CXH E;  4RKU J;  2LIW A;  1GXG A;  1M56 D;  3TYY A;  3S9O A;  1IZN B;  2QJK C;  4N78 D;  2HYN A;  2OYI A;  2KNC A;  1VQ4 P;  2XV6 A;  5TIS H;  2RN0 A;  2E74 C;  4H0L B;  2EG5 A;  1NAY A;  1LP1 B;  2AXC A;  5GTI E;  2GYK A;  2YXQ B;  5AVR B;  3N4X A;  4IFM A;  2QE7 H;  1KB9 D;  2FVE A;  1K9M Q;  1RQV A;  4C7N B;  1IFJ A;  4H0L C;  3DS3 A;  4HKZ H;  1SQX G;  2K9J B;  3TNU B;  5APV A;  1BDC A;  3GKL C;  2XZ1 C;  2WIT A;  1RE3 A;  3CX5 H;  2KXP B;  1CI6 A;  2WSC H;  3B8E B;  2H8P D;  3GW6 A;  2PNG A;  3CC4 P;  4R4M A;  3H47 A;  4EDF A;  1NH4 A;  3TGU G;  1JO5 A;  4OVN F;  1SFC B;  1WRG A;  5CMZ A;  2HOD A;  4U0A A;  3AEA C;  2Q6Q A;  2ZT9 B;  1FJP A;  1SFC D;  1IFP A;  3GF7 A;  2B88 A;  5AVU B;  2ZT9 D;  2JJL A;  4DT0 A;  2KG8 A;  1NVO A;  1SQX K;  2RMZ A;  1AVO A;  3NFQ A;  5KLV G;  3H1K D;  3L72 D;  2A06 D;  1FZF A;  1SFC C;  3II6 A;  3RG6 C;  2ZT9 C;  2QM8 A;  1HQB A;  2PEJ A;  1N7S B;  5KLV J;  4XFX A;  4NPE A;  2KGC A;  2DW3 A;  3VN0 A;  4N6J A;  3EJD A;  2KZI A;  4OGQ D;  1JMB A;  2CPS A;  1IK7 A;  1N8R Q;  2VRS A;  3NTN A;  1H89 A;  4LLH A;  1GXH A;  4UB6 E;  1N7S C;  4XFZ A;  5KLV K;  1Z6M A;  1AVY A;  5E79 H;  3M06 A;  3M0D C;  2LPK A;  4H44 B;  5AVY B;  2WZ7 A;  3CWB J;  2BEQ D;  3CXH D;  1JOC A;  4WBA A;  2BUO A;  3SSU A;  2L22 A;  1KQF B;  5AVT B;  2KUB A;  2H7H A;  1K30 A;  2KZJ A;  2E76 B;  4H44 C;  2KLV A;  3SFD C;  4I7Z B;  1HTL C;  2MY5 A;  1OXZ A;  1FBM A;  5L8R J;  1DH3 A;  1SS1 A;  2EIA A;  1QL1 A;  4C46 A;  1SQX E;  1ZN5 A;  4U3F J;  2Q9I A;  3MD0 A;  2E76 C;  3BCC G;  1S3J A;  3L74 J;  1MZ8 A;  4OWF A;  4I7Z C;  3G21 A;  3EJE A;  2KW2 A;  2Z45 A;  3TGU E;  2IZ0 A;  3BCC J;  3HRN A;  4I2L C;  4M0I A;  1OVV A;  1ZV8 A;  1J1D B;  1U7M A;  3RK2 B;  2K1A A;  3AEG C;  2M0B A;  2QIW A;  1HWT C;  3IF4 A;  2XND H;  1N86 A;  5GTH H;  1LJ2 A;  5KLV E;  2QG4 A;  2KLU A;  1WT6 A;  1AQ5 A;  2LXC B;  1DV5 A;  2VLQ A;  5CBO A;  2PEI A;  4YPC A;  2GZF A;  2WPR A;  1ZP0 C;  3RK2 C;  1J1D C;  3DS1 A;  3EFF K;  5BU5 A;  1ZLL A;  2WT7 B;  3SFE C;  1YJ9 P;  1LGH B;  2EHT A;  4K35 A;  1A02 F;  4RO0 A;  3CME P;  3CC7 P;  1YQ4 C;  1GMJ A;  2K93 A;  4JYB A;  5APS A;  3Q2Y A;  1EXJ A;  3CC2 P;  3W67 A;  1M6E X;  2C0X A;  2P67 A;  3N7N A;  2DGY A;  3RK3 B;  2POH A;  1OIP A;  1AA0 A;  4GOD A;  1JM0 A;  3MGN A;  4WY4 A;  2QVA A;  2ZFC A;  5AW8 B;  1L4A B;  1VF5 B;  3LW5 J;  1FZC B;  1N73 A;  2N1T B;  2PEK A;  3M91 A;  2QSI A;  1L4A D;  1FDO A;  2KI7 B;  3RK3 C;  2N1T D;  1FU1 A;  1RE4 C;  4COP A;  2J58 A;  2GA1 A;  4I1L A;  1PEU A;  4COC A;  1DD4 A;  3G1G A;  1KIL E;  2XU6 A;  3FX0 A;  3S1K A;  3H1H J;  2R3C A;  1L4A C;  1VF5 C;  4HYT B;  1OVU A;  1RO0 A;  3BCC E;  1FZC C;  2N1T C;  1PZQ A;  3GZM A;  3QWO C;  1NOH A;  3A7O A;  1SQX D;  1PEO A;  3M9H A;  4N3Y B;  1OW8 A;  2KWL A;  4EYY Q;  4PD4 H;  2I8D A;  4PH1 A;  2LTE A;  2V7Q H;  3F89 A;  2FYU G;  5AVZ B;  2HG5 D;  1VQP P;  3TGU D;  1LTJ A;  3OAK A;  3NMD A;  4QKO A;  1EDI A;  2OYH B;  3V6I A;  2K0D X;  4L73 A;  2FYU J;  5HGN A;  4H13 D;  4L74 A;  1JY3 N;  3D70 A;  3G4S P;  1YJN P;  2UWJ E;  3TSI A;  5KLV D;  5AVQ B;  5AVV B;  3H1L G;  3JCU H;  3H32 A;  4Z1M H;  2OYH C;  3L75 G;  1PEM A;  5CCH A;  2FYU K;  2JBG A;  3H1L J;  1LTA C;  3USS A;  2E42 A;  1PPJ G;  5AVW B;  2YO2 A;  3FWL A;  2OTK E;  2ZYD A;  2HFE D;  1JTH B;  2ZXX A;  2GDY A;  5BU8 B;  2K92 A;  2FFD B;  2P1J A;  2QJY B;  5APY A;  1BXI A;  1KLP A;  3C9I A;  1EDL A;  1ZW0 A;  4UB8 E;  3V2N A;  1VQO P;  2A45 G;  3RL0 D;  2KGA A;  2WPQ A;  1RHZ B;  3WUT A;  4C7R A;  1ZR2 A;  1VQN P;  1EOQ A;  2JO0 A;  4GT1 A;  1NQ4 A;  2P7J A;  2ROQ A;  2FFD C;  2L9F A;  3CCR P;  2QJY C;  3H4E A;  2QA4 P;  3CCU P;  3L36 A;  3HE5 A;  3SWF A;  1PIX A;  2I1J A;  5H2F H;  2Z5H A;  2ZJS E;  2AXT H;  4U7J A;  3G29 A;  4JF7 A;  3LIE A;  4PWV B;  1OW6 A;  1OX3 A;  2NO8 A;  1KOR A;  1KIL B;  1ZRT E;  1LNQ A;  2IZ1 A;  1VQM P;  2M5A B;  2BEZ F;  1KIL D;  2M8N A;  1JEK A;  1M1K Q;  3BCC D;  2FYU E;  1M7L A;  2L91 A;  1SQQ G;  3H6P A;  2BAS A;  2CG5 B;  4QMA A;  1Y9B A;  1KIL C;  2OTL P;  3T97 A;  5CHX A;  3Q1M A;  1LT9 A;  1SQB G;  2M8R A;  3C8V A;  1SQQ J;  2XT1 A;  1PFI A;  1M90 Q;  3E7K A;  1SQB J;  1DIP A;  1FZE A;  2JQ4 A;  4EOT A;  3H1L E;  2JKV A;  1HH0 A;  3L75 E;  1KD1 Q;  2HLO A;  1SQQ K;  1PPJ E;  4XFJ A;  1W2B O;  1PGJ A;  2X2B A;  1SQB K;  4PJ0 E;  2ZYA A;  3G0V A;  2L5G B;  1LWU B;  3A0B H;  3JC2 2;  3DS5 A;  2AFE A;  5KAI E;  1BE3 G;  1UII A;  4B86 A;  1R8E A;  3GJN A;  3HD7 A;  2JP3 A;  2PEQ A;  2HPC A;  1F80 D;  5AW0 B;  1LWU C;  3CCS P;  2RKL A;  2IBZ E;  1PP9 G;  1HBW A;  2O01 H;  1SP4 A;  1ZR4 A;  4XE5 B;  5DCK A;  4PD4 E;  1PP9 J;  3RBX A;  4F37 A;  2KOQ A;  5CBN A;  1OZH A;  3T97 B;  3GMA A;  2FAD A;  1WMK A;  3L70 G;  1VQ8 P;  3KDP B;  1SQV J;  3L70 J;  3AE9 C;  1M6N A;  4GR6 A;  1M1J A;  3WBH A;  3B5N A;  2GUS A;  1H0T A;  3DS4 A;  3HZQ A;  2E74 D;  1RY3 A;  1SQQ E;  3CE7 A;  1SQB E;  1SQV K;  2Y0D A;  1ZMB A;  5KJ7 C;  3W68 A;  3E1I A;  2JU2 A;  2LKI A;  1K8A Q;  4RES B;  1H8A A;  3G71 P;  5EW5 E;  1YTZ T;  3OW2 O;  4IPY A;  3PP5 A;  1BCC G;  5I4T G;  5CCG A;  2A45 I;  2XKM A;  2GZE A;  5F2O A;  2OAR A;  2G3A A;  1JCC A;  2L6E A;  1Q90 D;  2YKQ A;  3ABV C;  4H0L D;  3Q5S A;  1QVG O;  1BCC J;  4BPG A;  3BRV B;  2IBZ I;  4LGD E;  4ZNC A;  2HPC B;  2CNR A;  3VMA A;  4PD4 I;  2YXR B;  1X8Y A;  1E5W A;  3PHL A;  3H1L D;  3RG2 A;  1R5S A;  4MN4 C;  3MUD C;  5KLI B;  2AFD A;  2BHV A;  1PGQ A;  2AF8 A;  3L75 D;  3KPE A;  3CCJ P;  2FQ0 A;  3OA7 A;  2KOS A;  1PPJ D;  2YMK A;  7CEI A;  4IL6 X;  1QLE D;  1BE3 E;  1HY8 A;  3PLN A;  2O01 J;  2Z5I A;  1RF0 A;  5H2F E;  3I56 P;  1USE A;  1VL2 A;  1JY3 P;  2AXT E;  3FXD A;  2W27 A;  3E2D A;  4JQ0 D;  1BDD A;  2JGP A;  2GZI A;  3P7K A;  5KLI C;  2MVU A;  2WMM A;  3O6Q A; 
#chains in the Genus database with same CATH homology
 3CCL P;  4U0F A;  4PH0 A;  1YIT P;  4PH1 A;  3VRL C;  2E1M A;  1VQM P;  5F2N A;  2M8P A;  2PEI A;  3H0D A;  1VQP P;  2M8N A;  1VQ8 P;  3CMA P;  1N8R Q;  3DS2 A;  1M1K Q;  3CCV P;  3DS1 A;  1VQ7 P;  4XFY A;  3G28 A;  5BS1 A;  1VQ4 P;  1VQ6 P;  5HGN A;  1E6J P;  5HGO A;  4XRQ A;  2XV6 A;  4XFZ A;  4U0E A;  1RNI A;  1YJ9 P;  5HGM A;  1M6N A;  4GR6 A;  1EIA A;  2EG5 A;  2PY8 A;  3WBH A;  2QEX P;  3MGE A;  3CME P;  3G4S P;  1YJN P;  4U0D A;  2OTL P;  3CC7 P;  1YIJ P;  3M1M A;  2JYL A;  1IUQ A;  1KC8 Q;  3DS4 A;  3HZQ A;  2ONT A;  1Q86 Q;  2XT1 A;  1K9M Q;  4QNB A;  5HGL A;  1M90 Q;  3NTE A;  2PEM A;  3G1I A;  3CC2 P;  1PEM A;  2BQ1 E;  2BUO A;  1BAJ A;  1YI2 P;  1M6E X;  1K73 Q;  1ZMB A;  2JYG A;  4GR2 A;  2DGY A;  1VQ5 P;  1K8A Q;  3DS3 A;  3G71 P;  1NJI Q;  3B5I A;  1D1D A;  1A43 A;  2LF4 A;  4IPY A;  3OW2 O;  1Q82 Q;  1K30 A;  5I4T G;  3CXC O;  1Q7Y Q;  1YHQ P;  1M74 A;  3CCE P;  5F2O A;  1KD1 Q;  2OAR A;  2L6E A;  2Z46 A;  1QVF O;  1QVG O;  1W2B O;  3CCM P;  2PEN A;  1S72 P;  3I55 P;  3Q20 A;  3DS0 A;  2EIA A;  3G0V A;  4U0C A;  2Z44 A;  1QRJ A;  3CC4 P;  4WYM A;  3H47 A;  4XRO A;  3HYB A;  1PEQ A;  2PEK A;  1VQ9 P;  3CD6 P;  1VQO P;  1VQL P;  1Q81 Q;  1YJW P;  1A8O A;  2PEO A;  3DS5 A;  5F2K A;  4U0A A;  1VQN P;  4COP A;  2JO0 A;  1EOQ A;  4U0B A;  3G21 A;  1RO2 A;  1PEU A;  2BHV A;  4COC A;  3G1G A;  2Z45 A;  3G6E P;  2EFJ A;  3CCR P;  3H4E A;  2PEQ A;  3CPW O;  3CCJ P;  2QA4 P;  3CCU P;  1JJ2 O;  1AUM A;  1RO0 A;  1KQS O;  4M0I A;  3CCS P;  2XXM A;  2OTJ P;  3P05 A;  3I56 P;  3RG6 C;  5BS2 A;  3E2D A;  2CWO A;  3DPH A;  3G26 A;  5JPA A;  3CCQ P;  1PEO A;  3G29 A;  2PEJ A;  1VQK P;  5DCK A;  4XFX A;  2P9X A;  3DTJ A;  2KOD A;  2M8L A;  3LRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...