3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
1W2BO 1VQPP 1Q86Q 1Q82Q 3CC7P 2QEXP 1YITP 2QA4P 1YJNP 2OTLP 2OTJP 3I56P 1VQOP 1NJIQ 1Q7YQ 1M1KQ 1VQ6P 3CMAP 1N8RQ 3CCJP 1K9MQ 3OW2O 3CCEP 3CMEP 3G6EP 3CC2P 1YHQP 1M90Q 1JJ2O 1QVGO 1VQ7P 1Q81Q 3CCQP 3CCSP 1YIJP 3CPWO 1S72P 3CCRP 1VQLP 3CCLP 1QVFO 1VQ8P 3CCUP 1KD1Q 3G71P 1K73Q 1K8AQ 1KQSO 1YJWP 3CC4P 3G4SP 1VQMP 1VQ5P 3I55P 1VQ4P 1VQNP 3CD6P 1YJ9P 3CCVP 1VQ9P 1KC8Q 3CXCO 1YI2P 3CCMP 1VQKP
chains in the Genus database with same CATH superfamily
3D6ZA 1JCDA 5HGLA 1OX3A 1RE4A 1SQQJ 4RESB 3QH9A 2OYHA 2C9NY 2L9FA 1SQXK 2OTKE 3K5BA 1ZW0A 1X3OA 2C0WA 4DJGA 2Z44A 2FYZA 3Q5RA 3AE6C 4YXWH 2QIWA 2LR2A 4I2LC 1RE3C 1T2KC 3HE5B 1UIXA 1EMVA 2KSEA 3H1KJ 2VLOA 3H1LG 1BGYG 1USEA 2E1MA 5KKZB 2N50A 1A02F 1EQ7A 2NPSB 1MV8A 3GF7A 4DG9A 1OW6A 1T8ZA 2K9JA 1BCCD 1VQ4P 4PH0A 2KIKA 3GZLA 4XFJA 3RGUA 1X9VA 1L0LK 3CMAP 1SQPK 3CMEP 1R5LA 2Y9ZA 2N5IA 1VKUA 3CCSP 1S72P 3SWFA 1EOQA 2B87A 3H4EA 5CJ4A 5KLVG 1PEUA 1S9KD 4C7NB 1JMBA 2YNYA 1SP4A 3H1HJ 3I55P 4U3FJ 1IMQA 3L74G 1L4AC 1SQBE 1MKMA 1RF1A 1SQPD 1KZUB 1KMIZ 1N8RQ 1G2CA 1NGMB 2JO1A 1PEQA 5TJHA 1RF0C 3EJEA 3MGNA 5B5EE 3BCCD 1KC8Q 4NPDA 2PENA 5B66H 3MTUE 1DEEG 1BGYJ 5AVWB 1SQQK 1NTMJ 3L75G 4AQRD 2RMZA 1HH0A 4XA4A 1HGVA 4MRTC 1L0HA 4RJTA 1PP9G 1AUMA 2A45H 3CXHH 3L73J 4ZKPA 2XT1A 1Z56A 3GZMA 1LP1B 3EJBA 4LGDE 1OZHA 1DX7A 3G1GA 2PRRA 2KXPB 5HGNA 3CXHD 4I7ZC 1YJNP 3EWKA 3L72J 1VQ6P 5KTBA 4DZOA 2BHVA 4L74A 2KGCA 4PJ0E 3RK2B 3WUTA 1U57A 1FC2C 3C8VA 2M5AA 3HTKB 4Z1MH 3CE7A 1KILA 1VQPP 2YO3A 2IX7C 3M9HA 2LIWA 1PEMA 5KP6B 2GDXA 2O01H 2A06G 3RK2D 1ZRTD 2JB0A 4OH8B 2HPCB 5EW5E 1KORA 1OVUA 1F80D 2CGQA 2AFEA 3H25A 5HVCA 1FZCC 4IFDK 3NTNA 2KP8A 2FACA 1HTLC 2W27A 3L75J 3CWBE 2LMLA 1YQ4C 2WSEJ 5AVXB 1NAYA 1LT9C 3AE3C 3HD7A 1DH3A 3H1ID 4C7RA 4BPGA 2Y0CA 1IFMA 5CCHD 5GTIE 3I5CA 2K2QA 3B5NB 2WZ7A 4GIFA 4U0EA 3GHGC 4QNBA 5AVSB 1OW8A 2JU1A 2BUOA 5APYA 1KD1Q 4N78E 2FQ2A 3G71P 4UB6H 1HGZA 2IYOA 3B5ND 1NWQA 4U0AA 3OA7A 2L0QA 3HRNA 1QLED 1FOSE 1U7JA 3DS2A 3H1LD 5E79H 4PD4D 2FQ0A 2FFDC 2RN0A 2GA1A 5M1BA 4AYCA 2IBZE 3CC2P 1QGKB 3U1AA 1YHQP 4BWNA 3WU2E 5KLVK 2GZFA 3CCRP 2N9YB 5APWA 2QJKB 4HKGA 1S2EA 4KHXA 1PL5A 4K35A 4R0MA 3A5TA 3N7NA 5AVTB 2VRSA 5KLVD 1AFOA 3V4QA 3AE7C 3L74D 2Z5HA 2ZJSE 3V2NA 1FZBA 2IPPA 2WT7A 1K30A 2NZ2A 3E1RA 1KTMA 1Y9BA 1Q82Q 4L75A 1E5WA 4UHPB 3M0DC 3MIWA 3B4QA 3SWKA 5CBOA 3L70G 1ZR2A 2WSEH 3P32A 1H88A 2DGYA 1N7SB 4QKOA 2WPSA 3Q3DA 2GUSA 2N1TC 2K88A 2LIUA 4EYYQ 1AV1A 3L71G 2IZ0A 3A0HH 3G1IA 4D6TE 2OYIA 3RBZA 2K3RA 1PP9D 1EIAA 1GDTA 1CZQA 2NO8A 1N7SD 1AF8A 2KK7A 2XNXA 1L0LE 3RL0g 3RG6C 5DJTB 1SQPE 2KI7B 5APUA 2H7HA 1RE3A 2P58A 3TNUA 2OYHB 4OGQB 1BSHA 4PD4I 1UJZA 2ZAEB 1GXHA 1LTIC 1P84I 2M8PA 5KLIC 5AW5B 3BCCE 4Y99C 3RG2A 3CCJP 1GMJA 1KQGB 3M0AA 1SVFA 4U7JA 1RH5B 2ITAA 5APTA 1HY8A 2G3AA 4OGQD 2K1AA 1Y8AA 4I1LA 2R44A 1N73A 2ERHA 2KOSA 3NFQA 3S4RA 4JQ0D 1CSBA 1ZLLA 3CWBJ 2YMYA 3ZDMA 2A06D 5B66E 3OAKA 2K9JB 2D2CC 4ASWA 2NRGA 1SQQE 3CXHE 1N2DC 2J58A 3DS5A 5GTHH 5I4TG 3WBHA 2FYNC 2K9YA 2O1KA 3G26A 2I1KA 5AVRB 1ZN5A 1RY3A 1NTZG 1H8AA 2B87B 3DS4A 1G1IA 2LL8A 2IFMA 2M8LA 2AF8A 1BAJA 1K9MQ 3A3YB 5BS2A 2Y0EA 2MVVA 3CCQP 4IFFA 1G1JA 1G2CB 1KB9D 4BPHA 1KV4A 2EHTA 2E43A 1GL2C 1FZAA 1M57D 1BDCA 2QNWA 4EDFA 3IF4A 5KAIH 2HLOA 3FWLA 2WVRA 3M1MA 1KFMA 2PEOA 3AE1C 3M91A 2E76C 1X79B 3RBXA 3A2AA 2Z5IA 3MUDC 3EFGA 4I6MC 3W68A 2E75B 4XFXA 1T6AA 4U0DA 3AEFC 1LTJB 2YKOA 2H8PD 1QRJA 4DCKA 2ZYGA 2HYNA 1BCCJ 1KYOE 1HBWA 1FAVA 3LW5H 4KT0J 1EDIA 2M3EA 2BASA 2M5AB 4L76A 2WMMA 2UWJE 3L37A 1GW3A 4QMAA 3H1LE 4COCA 1BGYE 1M90Q 1KILB 4ZKUA 5BU8B 1TU3F 3KQGA 4UB6E 1EC5A 5F2KA 1JCCA 2JJLA 3L70D 5E79E 4R4LA 1KILD 1SQPJ 2AXTH 3VOPA 3R4YA 3E2DA 1KLPA 3ITKA 1X0TA 3L71D 3CPWO 1JMMA 5F2NA 1KB9I 3G29A 1QL2A 4EIJA 5KLVE 3HD7B 1M1JC 1ZMBA 2KB7P 3KPEA 3GHGA 2KUBA 3BCCJ 4GDOA 1GW4A 2OTLP 1LWUB 2W83C 1LGHB 5KKZC 3PP5A 3HD7D 2NPSC 2AVAA 3W67A 5AW4B 1FDOA 2SPZA 2E74C 1GXGA 3TGUG 2W6AA 1KQFB 2KNCA 1JY2N 4O9BA 2Y9YA 1S1CX 4WVZA 2QE7H 2YIUC 3L75E 5EFWB 3Q20A 2ROQA 1L0NG 1QVGO 3P05A 1EXIA 3Q2YA 3MGEA 4H0LB 4RKUJ 2JO0A 1K8AQ 2FXPA 2YXQB 1NTZK 3A0HE 2WQYC 4XRQA 2MR7A 4H0LD 3H0DA 2JEEA 1IK7A 1N7LA 1NTZD 1GU4A 2M5RA 2FHSC 2YXRB 3VP8A 2QM8A 2PP6A 3C1LA 2XKMA 1JY2P 1JEKA 2O01J 1JY3N 1W2BO 3LIEA 2ZT9C 2N1TA 2WT7B 3G28A 1FZEA 3HE4A 2YKQA 1YQ3C 1OVRA 3H1IJ 2P7JA 2B89A 1VQKP 1GD2E 2PY8A 1ZOYC 3NMDA 1GU5A 2OYIB 2LKMA 4B86A 1USDA 5GTHE 1YTZI 2V4HA 1AQ5A 2H89C 1QEXA 3EQ2A 4U0FA 1GK6A 5KJ7C 1SFCA 5BVZA 3TNUB 2K92A 2JKVA 2GM4A 1W5CE 3B71A 1OVVA 2KODA 3C9IA 3H1LJ 2QJYB 1NU1G 1IFJA 1RHZB 4H44B 2KGEA 3FX0A 2IBZI 3IFMA 2C9LY 1NO4A 3SFDC 1DEBA 4U0CA 1VQNP 4TT3H 1N73B 3USSA 5KAFE 5KAIE 4H44D 1NQ4A 2OQQA 2KOPA 1ZXGA 5KLVJ 1Q81Q 2I8DA 3L74J 1EDJA 1FS0E 1HUCA 2VLQA 2K0DX 3DPHA 3B5NC 3CXCO 4BXLA 4XFZA 2JAZA 2KW2A 2JGPA 3B8EB 1MFTA 2XZ0D 1FBMA 3KZIH 4HH2A 3E7KA 1S5LH 3G4SP 3L35A 2BCCG 3TYYA 3WMM0 2XNDH 2X2BA 5CJ0A 3S1KA 2PGDA 2KSJA 1PFIA 5BU5A 4LLHA 1PP9J 4TLFA 1L0NK 1FR2A 3L70E 3TGUD 1L2PA 2KS1A 1KILE 1SQVD 2FVEA 3VYIA 7CEIA 2QJKC 3L71E 1QL1A 1SQBG 2QSIA 1L0ND 1T8KA 1ZNVA 2XDJA 3L36A 2AXTE 3CCEP 1JO5A 1M6NA 1QX8A 1WMKA 3AECC 4PD4H 1M7LA 4YTPC 1P84H 3KXDA 1PPJG 2K93A 3CCVP 2LF4A 3PH0A 2B9BA 4M3LA 1URQA 3S9OA 1EDLA 1FDIA 3BRTB 2M8RA 3GKLC 4JYBA 1P84D 3O8ZA 2L22A 4WY4A 1LTBC 2R3SA 1N7SC 2WPVB 2V7QH 5KP8B 1OIPA 2GZJA 3T97A 2BEZF 2CNRA 1VQMP 2K94A 3RL0C 3AEAC 2PEQA 3MP7B 2QEXP 4KJMA 2M0BA 3FXDA 4NEOA 3CL3D 4AUWA 1M1JA 1RE4C 2FVAA 2VLPA 2VLNA 2KOOA 3CCUP 2OYHC 2E5TA 4OGQC 2JWAA 1YYCA 1Z6MA 3N4XA 3HUSA 5BS1A 1NTZE 2RKLA 2O1JA 1AVYA 2NPSA 3HYBA 1EDKA 3Q5PA 1BCCE 3GHGB 3OW2O 3U59A 1DIPA 2PEJA 2LOLA 4GOEA 1NKNA 5AVQB 1FE6A 3AEEC 1JB0J 4UB8H 1RNIA 2W90A 1NU1D 4BPFA 4W80A 1S9KE 2OGUA 2QVAA 3CX5I 4C7NA 3GF3A 1NTKD 2FYUG 1IFIA 4CA3A 4ZNCA 5CBNA 4PV1B 2XV5A 1M74A 1IO4A 1FOSF 2B88A 1KYOI 3BATA 1J1DB 3AEBC 3E1IA 4XE5B 3IR9A 2AEMA 1PGPA 5CCGC 4RO0A 3VRLC 5AW7B 4PV1D 1VL2A 3LW5J 2AXCA 1YI2P 2OTJP 3L70J 1DNYA 2Z46A 1CI6A 2KOGA 3AE8C 5AVUB 3D71A 2IBZG 1FZGA 1PEOA 1EZVI 2BCCD 1HF9A 2PEIA 2N1TB 1L4AA 3L71J 3L4FA 4N6JA 2XU6A 3HE4B 3VMAA 2XZ1C 2ZXEB 2JQ4A 3NXSA 2GYKA 3LMOA 3V5BA 1KB9H 1RF0A 2ZFCA 2N1TD 2E75C 1J2JB 1SQXG 2W8ZA 1RF1B 5KJ7A 1SQBD 5CMZA 1LTJC 1ZRTE 2FKWB 3P8CD 4Y99B 1VF5B 1AA0A 3GMAA 3G6EP 1KILC 2QRXA 1SFCB 2LXCB 3V2QA 1PPJD 1LTSC 1H89A 3QWOC 2JWDA 2MVUA 1VQ8P 1RQUA 3U1CA 3A0BH 4WWIA 1AJYA 1S5LE 1KQSO 1CW5A 3H1IE 3GJNA 2CWOA 3NY7B 3H1JG 1VF5D 2FY8A 1SFCD 5AVZB 2I1JA 2Q7CA 3H47A 1L0LG 3GW6A 3DS0A 1SLQA 3EFFK 1L0NE 1VHNA 1VQ7P 4H2XC 4PJ0H 2Q6QA 1J1EB 2FXMA 1YBKA 3HD7C 1PIXA 1NTZJ 2ZYDA 2JP3A 3D6YA 2JBGA 2D2CD 3G21A 4WB4A 5AW2B 3DS3A 1LWUC 3DTJA 2GUVA 5HGOA 5F2OA 3R2PA 4GT1A 1BE3G 4PD4E 1NH4A 2JDIH 1PGJA 2WSFJ 1FZCA 2EFJA 2H43A 1IZNB 1P84E 3UIAA 2DNWA 3HZQA 1S3JA 2N98A 1LT9A 3RK3B 1DV5A 3TSIA 1KFNA 1SS1A 5TISH 1SQQG 3G9RA 2FXOA 3VN0A 1R8EA 2KGAA 4YPCA 2KG8A 4H0LC 2K0XA 4U0BA 1KQLA 3RK3D 4GODA 4GKGA 3VMZA 2KS1B 3FXEA 1JTHA 1VDFA 3L74E 2AEJA 2FYUD 4BRYA 2E42A 2ZYAA 2XXMA 2KLVA 3SFEC 3G3ZA 1OFCX 4IOIH 4JYCA 2Y0DA 5HGMA 3H1KG 2FADA 5EJDA 1R5SA 2QG4A 3WUVA 1K73Q 2CPBA 2FFDA 1NAFA 1ZV8A 2GZIA 2L4BA 5APXA 1SQVG 2K37A 2WPQA 2G8YA 2CQ8A 3V4WA 4N78D 3U43A 1OMIA 3MZWB 1HJBA 1AYIA 1URQB 1PP9E 2ZVOB 2IZ1A 2W6JH 2JYLA 4PH1A 4WY4B 5AVVB 4UB8E 2IBZD 1HQBA 1JY2O 4U3FG 3H1HG 2KZJA 2JU2A 3KYQA 5AW1B 3T97B 1URQD 4H13B 2OYIC 1NOHA 2L6EA 3B5IA 4WY4D 5KP7B 2LTEA 2XZRA 1NYHA 2KYVA 4XFYA 1M1JB 3M0DA 4H2YC 2WSFH 1T3JA 1MZ9A 2MY5A 3LIDA 4H13D 2PEMA 1M1KQ 1JUNA 2C0XA 4NPEA 2LKIA 2QJPB 1SQXD 1RO0A 2KORA 3I56P 3AE5C 3HUSB 2QJYC 1IFPA 2A06E 4H44C 2WITA 2Z4EA 1NTMG 3TGUJ 1IJDB 2E74B 1SQVJ 3AEGC 3L73G 3PTZA 1LT1A 2ONTA 1BSNA 2BCCE 1N73C 2PEKA 2Q9IA 1S4XA 2BQ1E 4HKZH 1YITP 1X8YA 1JY3O 1EZVG 3M9BA 2GDWA 4GR6A 1L0NJ 1IFDA 2NPSD 2YIUB 3L72G 1VPCA 2E74D 3B4SA 1S5LX 4JPZB 4D6TD 2Q3EA 4DOJA 3H1JD 3RK2C 5AW0B 3H32A 4L73A 2AEFA 5H2FH 1IFNA 1L0LD 4GOFA 1UNKA 4IL6H 2KR5A 1JY3P 2L5GB 1KB9E 5CCGA 3MHVA 3P8CE 3TDKA 3OJAB 4IZ6A 1WT6A 2MJZA 3F5HA 2JR8A 3BVHA 5HV8A 1PPJE 1NTKG 5CCHC 1T2KD 2PAJA 1BE3D 2K0YA 2ZT9B 1A02J 3GG2A 2V7QJ 4LC1A 2MR8A 1NKZB 5AW3B 3ABVC 2PFXA 1CI6B 3A0BE 2N6ZA 4M0IA 3JSVC 1A43A 3CC4P 3F89A 3CD6P 4HJGH 2ZT9D 1SQQD 1L4AB 1D1DA 1AQTA 3V2RA 1LTJA 2GZGA 4F37A 3JC22 3O6QA 1PGQA 2IFNA 1A8OA 2J59M 1GL2A 3FWNA 3CLQA 1LTGC 1L4AD 1PV3A 1SQVK 1Y47A 1YJ9P 3FGAD 2FAEA 1AVOA 1E6JP 1NU1J 3H1KD 3DS1A 3SWYA 1JOCA 2HFED 2P9XA 4ASVA 1NTKJ 5KJ7D 3MUDA 2FQ1A 4W7YA 4PWVB 1HVVA 4CPGA 4JBZA 1FJPA 2Q3IA 3CX5H 1BXIA 5TISE 3RK3E 4K3AA 4I7ZB 3VTPC 3VMYA 2FYUE 2MD9A 4N3YB 1ZMEC 2M8NA 3Q1MA 3CX5D 4U3FD 3H1HD 2P10A 1LWUA 2P2UA 1DD4A 4W7ZA 1H0TA 1VQ5P 1CEIA 2R32A 1KYOH 2EHSA 2GZEA 3JCUH 1GPJA 2N9BA 1NTMK 1BDDA 4PXHB 3CI9A 3CCLP 1KYOD 1Q2NA 2HODA 2BCCJ 1MFZA 2P1JA 3H6PA 2A45I 2RH0A 3CXHI 2O3JA 3M9QA 2HG5D 1MZ8A 1FZCB 1BGYD 2FVFA 2BEQD 3CC7P 2H88C 1NTMD 3A7OA 1IC2A 4HB1A 1M56D 1LT9B 2YKPA 3L73D 2KLUA 3V2PA 3AE2C 2OYOA 2KWLA 5AW6B 1M6EX 2PNGA 1SQBJ 1IUQA 3HE5A 1NVOA 2WTYA 1EZVD 3AE4C 4EOTA 4PV1C 3L72D 1Q86Q 2WSSH 2KZIA 5L8RJ 2YMKA 2Z45A 1NU1K 2EIAA 1J1DC 1JTHB 2KG6A 2POHA 3GLMA 1SQXE 4BRYB 1OR5A 2XV6A 1NTKK 5CHXA 4YXDC 4COPA 3D70A 2VSQA 1ACPA 2AFDA 3EJDA 2L91A 5DJUB 4HYTB 1LNQA 3CWBG 1PGOA 1OXZA 3LRYA 1ZP0C 2FFDB 2KNCB 3G0VA 2CK3H 2QM7A 1FDMA 4ZMDA 3M06A 3L75D 2O01N 3H1JE 3RL0B 5APSA 2KGDA 2CG5B 4OVNF 3KDPB 1JNMA 2E5YA 3MD0A 1RF1C 5K5GB 5AVYB 1N86A 2J5UA 1LTTC 4C46A 3RL0D 5H2FE 1FZFA 1KN7A 1DD3A 1GK4A 1RQVA 4IL6E 1NHLA 1FJKA 1VF5C 5AW8B 1SFCC 2R3CA 1LP1A 1XTGB 1BE3E 4WYMA 4WBAA 5AW9B 2Q5UA 5JPAA 1SQBK 4NPFX 2MF4A 2OARA 1M8OB 2FYUJ 1OWAA 5APVA 3HTKA 1J1EC 4R4MA 2P67A 3PRJA 1D7MA 1K05A 5APQA 5B5EH 1LTAC 3PJSK 3TK1A 4H2WC 3H32B 1K04A 5C39A 3AEDC 3PLNA 2HPCA 1BCCG 5KLIB 2WWWA 5CCHA 3H1KE 4JF7A 1YIJP 5DCKA 1FU1A 1HWTC 2EG5A 1XTCC 3KZIE 3WUUA 1YJWP 3TGUE 4D6TG 3RK3C 2N5HA 1SQVE 3II6A 2KG9A 5KAFH 2DW3A 1IMPA 2WSCJ 4MN4C 1UIIA 2K5XA 2R5BA 2D2CB 3VMXA 1SQPG 1OW7A 5CCGD 1VQLP 1QVFO 2LPKA 1EXJA 3B5NA 1JM0A 3Q5SA 2FYNB 1LJ2A 2W6BA 2YO2A 3CX5E 2CPSA 4U3FE 3H1HE 1T3UA 2QA4P 3BCCG 1NJIQ 4GR2A 1SQXJ 3NTEA 2Q1KA 2LXBA 1MUUA 1Q90D 1E0HA 3O6QB 2JYGA 2WPTA 1WRGA 1PZQA 3SSUA 1GL2B 2MKVA 1X22A 3JCUE 2E75D 4OWFA 1Q7YQ 2KOQA 3BRVB 2FYUK 1URQC 2A45G 1IK9A 1JJ2O 1NTME 1L0IA 3BASA 3KHUA 4D6TJ 4WY4C 4EI2A 3H1JJ 3CWBD 3L73E 1RO2A 5CZDB 1GL2D 5GTIH 2E76B 3P7KA 1E79H 1L0LJ 2HR3A 3PHLA 3TF5A 1EZVE 4H13C 1VQOP 2R5DA 3P8MC 2ZXXA 1GZLA 3L72E 4DT0A 1W2EA 3AE9C 3V6IA 2E76D 3IN6A 2GDYA 2FBWC 3CCMP 2ZVNB 2QJPC 1N7SA 3HUSC 1ZR4A 1H0TB 1BE3J 2IDBA 1YTZT 1NU1E 2N6YA 4Y28J 2WPRA 4XROA 2WSCH 4A7PA 3WU2H 2M3BA 3IAOA 4IL6X 3VP9A 3H1IG 4IFMA 1GTWA 1NTKE 1VQ9P 1U7MA 2IYPA 4IPYA 1HJ0A 2HODB
chains in the Genus database with same CATH topology
1D1DA 1EIAA 5HGLA 3CC7P 3HYBA 2QA4P 2OTLP 1RO0A 3I56P 1NJIQ 4U0EA 4GR2A 2PY8A 3NTEA 3OW2O 3RG6C 4QNBA 1AUMA 2PEJA 4WYMA 2BUOA 3M1MA 1A8OA 2XT1A 2Z44A 1KD1Q 1M6EX 4U0BA 3G71P 1IUQA 5JPAA 2JYGA 2PEOA 4U0FA 4U0AA 2ONTA 1YJ9P 3G1GA 1RNIA 2PEKA 5HGNA 2BQ1E 1E6JP 2M8PA 3DS2A 1Q86Q 2OARA 1YITP 1YJNP 3DS1A 2KODA 2Z45A 4GR6A 1Q7YQ 1M1KQ 1VQ6P 2XXMA 2EIAA 2P9XA 3CCJP 3CCEP 3G6EP 3CC2P 5HGMA 2BHVA 3Q20A 1M6NA 1YHQP 2E1MA 1JJ2O 1QVGO 3P05A 4XFXA 3CCRP 4U0DA 1VQ8P 3MGEA 2XV6A 1RO2A 2JO0A 1K73Q 1QRJA 1K8AQ 1KQSO 4COPA 1VQ4P 4U0CA 1VQNP 3CCVP 2LF4A 2CWOA 4PH0A 1VQPP 1M74A 1PEMA 3LRYA 1VQOP 3H47A 3CMAP 4XRQA 3DS0A 3CMEP 3G0VA 3H0DA 4COCA 1M90Q 1VQ7P 3DS5A 2M8NA 3CCSP 1Q81Q 1YIJP 1S72P 5DCKA 5I4TG 1EOQA 3WBHA 2EG5A 3H4EA 2JYLA 1PEUA 4PH1A 1YJWP 3G26A 3VRLC 1VQMP 3I55P 1VQ5P 1K30A 5F2KA 3DPHA 3CXCO 1YI2P 3CCMP 3DS4A 2PEQA 1W2BO 4XFZA 3G21A 1Q82Q 2QEXP 3DS3A 2OTJP 3DTJA 2Z46A 2M8LA 5HGOA 3G28A 1N8RQ 1BAJA 5F2OA 2L6EA 1K9MQ 3B5IA 3E2DA 1PEOA 5BS2A 2DGYA 4XROA 1PEQA 3CCLP 3CCQP 1VQLP 3CPWO 1QVFO 2PEIA 2EFJA 5F2NA 3CCUP 3G29A 4M0IA 1A43A 4XFYA 1ZMBA 3CC4P 3CD6P 3G4SP 1VQ9P 3G1IA 3HZQA 5BS1A 4IPYA 1KC8Q 2PEMA 1VQKP 2PENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1VQP P;  1Q86 Q;  1Q82 Q;  3CC7 P;  2QEX P;  1YIT P;  2QA4 P;  1YJN P;  2OTL P;  2OTJ P;  3I56 P;  1VQO P;  1NJI Q;  1Q7Y Q;  1M1K Q;  1VQ6 P;  3CMA P;  1N8R Q;  3CCJ P;  1K9M Q;  3OW2 O;  3CCE P;  3CME P;  3G6E P;  3CC2 P;  1YHQ P;  1M90 Q;  1JJ2 O;  1QVG O;  1VQ7 P;  1Q81 Q;  3CCQ P;  3CCS P;  1YIJ P;  3CPW O;  1S72 P;  3CCR P;  1VQL P;  3CCL P;  1QVF O;  1VQ8 P;  3CCU P;  1KD1 Q;  3G71 P;  1K73 Q;  1K8A Q;  1KQS O;  1YJW P;  3CC4 P;  3G4S P;  1VQM P;  1VQ5 P;  3I55 P;  1VQ4 P;  1VQN P;  3CD6 P;  1YJ9 P;  3CCV P;  1VQ9 P;  1KC8 Q;  3CXC O;  1YI2 P;  3CCM P;  1VQK P; 
#chains in the Genus database with same CATH topology
 3D6Z A;  1JCD A;  5HGL A;  1OX3 A;  1RE4 A;  1SQQ J;  4RES B;  3QH9 A;  2OYH A;  2C9N Y;  2L9F A;  1SQX K;  2OTK E;  3K5B A;  1ZW0 A;  1X3O A;  2C0W A;  4DJG A;  2Z44 A;  2FYZ A;  3Q5R A;  3AE6 C;  4YXW H;  2QIW A;  2LR2 A;  4I2L C;  1RE3 C;  1T2K C;  3HE5 B;  1UIX A;  1EMV A;  2KSE A;  3H1K J;  2VLO A;  3H1L G;  1BGY G;  1USE A;  2E1M A;  5KKZ B;  2N50 A;  1A02 F;  1EQ7 A;  2NPS B;  1MV8 A;  3GF7 A;  4DG9 A;  1OW6 A;  1T8Z A;  2K9J A;  1BCC D;  1VQ4 P;  4PH0 A;  2KIK A;  3GZL A;  4XFJ A;  3RGU A;  1X9V A;  1L0L K;  3CMA P;  1SQP K;  3CME P;  1R5L A;  2Y9Z A;  2N5I A;  1VKU A;  3CCS P;  1S72 P;  3SWF A;  1EOQ A;  2B87 A;  3H4E A;  5CJ4 A;  5KLV G;  1PEU A;  1S9K D;  4C7N B;  1JMB A;  2YNY A;  1SP4 A;  3H1H J;  3I55 P;  4U3F J;  1IMQ A;  3L74 G;  1L4A C;  1SQB E;  1MKM A;  1RF1 A;  1SQP D;  1KZU B;  1KMI Z;  1N8R Q;  1G2C A;  1NGM B;  2JO1 A;  1PEQ A;  5TJH A;  1RF0 C;  3EJE A;  3MGN A;  5B5E E;  3BCC D;  1KC8 Q;  4NPD A;  2PEN A;  5B66 H;  3MTU E;  1DEE G;  1BGY J;  5AVW B;  1SQQ K;  1NTM J;  3L75 G;  4AQR D;  2RMZ A;  1HH0 A;  4XA4 A;  1HGV A;  4MRT C;  1L0H A;  4RJT A;  1PP9 G;  1AUM A;  2A45 H;  3CXH H;  3L73 J;  4ZKP A;  2XT1 A;  1Z56 A;  3GZM A;  1LP1 B;  3EJB A;  4LGD E;  1OZH A;  1DX7 A;  3G1G A;  2PRR A;  2KXP B;  5HGN A;  3CXH D;  4I7Z C;  1YJN P;  3EWK A;  3L72 J;  1VQ6 P;  5KTB A;  4DZO A;  2BHV A;  4L74 A;  2KGC A;  4PJ0 E;  3RK2 B;  3WUT A;  1U57 A;  1FC2 C;  3C8V A;  2M5A A;  3HTK B;  4Z1M H;  3CE7 A;  1KIL A;  1VQP P;  2YO3 A;  2IX7 C;  3M9H A;  2LIW A;  1PEM A;  5KP6 B;  2GDX A;  2O01 H;  2A06 G;  3RK2 D;  1ZRT D;  2JB0 A;  4OH8 B;  2HPC B;  5EW5 E;  1KOR A;  1OVU A;  1F80 D;  2CGQ A;  2AFE A;  3H25 A;  5HVC A;  1FZC C;  4IFD K;  3NTN A;  2KP8 A;  2FAC A;  1HTL C;  2W27 A;  3L75 J;  3CWB E;  2LML A;  1YQ4 C;  2WSE J;  5AVX B;  1NAY A;  1LT9 C;  3AE3 C;  3HD7 A;  1DH3 A;  3H1I D;  4C7R A;  4BPG A;  2Y0C A;  1IFM A;  5CCH D;  5GTI E;  3I5C A;  2K2Q A;  3B5N B;  2WZ7 A;  4GIF A;  4U0E A;  3GHG C;  4QNB A;  5AVS B;  1OW8 A;  2JU1 A;  2BUO A;  5APY A;  1KD1 Q;  4N78 E;  2FQ2 A;  3G71 P;  4UB6 H;  1HGZ A;  2IYO A;  3B5N D;  1NWQ A;  4U0A A;  3OA7 A;  2L0Q A;  3HRN A;  1QLE D;  1FOS E;  1U7J A;  3DS2 A;  3H1L D;  5E79 H;  4PD4 D;  2FQ0 A;  2FFD C;  2RN0 A;  2GA1 A;  5M1B A;  4AYC A;  2IBZ E;  3CC2 P;  1QGK B;  3U1A A;  1YHQ P;  4BWN A;  3WU2 E;  5KLV K;  2GZF A;  3CCR P;  2N9Y B;  5APW A;  2QJK B;  4HKG A;  1S2E A;  4KHX A;  1PL5 A;  4K35 A;  4R0M A;  3A5T A;  3N7N A;  5AVT B;  2VRS A;  5KLV D;  1AFO A;  3V4Q A;  3AE7 C;  3L74 D;  2Z5H A;  2ZJS E;  3V2N A;  1FZB A;  2IPP A;  2WT7 A;  1K30 A;  2NZ2 A;  3E1R A;  1KTM A;  1Y9B A;  1Q82 Q;  4L75 A;  1E5W A;  4UHP B;  3M0D C;  3MIW A;  3B4Q A;  3SWK A;  5CBO A;  3L70 G;  1ZR2 A;  2WSE H;  3P32 A;  1H88 A;  2DGY A;  1N7S B;  4QKO A;  2WPS A;  3Q3D A;  2GUS A;  2N1T C;  2K88 A;  2LIU A;  4EYY Q;  1AV1 A;  3L71 G;  2IZ0 A;  3A0H H;  3G1I A;  4D6T E;  2OYI A;  3RBZ A;  2K3R A;  1PP9 D;  1EIA A;  1GDT A;  1CZQ A;  2NO8 A;  1N7S D;  1AF8 A;  2KK7 A;  2XNX A;  1L0L E;  3RL0 g;  3RG6 C;  5DJT B;  1SQP E;  2KI7 B;  5APU A;  2H7H A;  1RE3 A;  2P58 A;  3TNU A;  2OYH B;  4OGQ B;  1BSH A;  4PD4 I;  1UJZ A;  2ZAE B;  1GXH A;  1LTI C;  1P84 I;  2M8P A;  5KLI C;  5AW5 B;  3BCC E;  4Y99 C;  3RG2 A;  3CCJ P;  1GMJ A;  1KQG B;  3M0A A;  1SVF A;  4U7J A;  1RH5 B;  2ITA A;  5APT A;  1HY8 A;  2G3A A;  4OGQ D;  2K1A A;  1Y8A A;  4I1L A;  2R44 A;  1N73 A;  2ERH A;  2KOS A;  3NFQ A;  3S4R A;  4JQ0 D;  1CSB A;  1ZLL A;  3CWB J;  2YMY A;  3ZDM A;  2A06 D;  5B66 E;  3OAK A;  2K9J B;  2D2C C;  4ASW A;  2NRG A;  1SQQ E;  3CXH E;  1N2D C;  2J58 A;  3DS5 A;  5GTH H;  5I4T G;  3WBH A;  2FYN C;  2K9Y A;  2O1K A;  3G26 A;  2I1K A;  5AVR B;  1ZN5 A;  1RY3 A;  1NTZ G;  1H8A A;  2B87 B;  3DS4 A;  1G1I A;  2LL8 A;  2IFM A;  2M8L A;  2AF8 A;  1BAJ A;  1K9M Q;  3A3Y B;  5BS2 A;  2Y0E A;  2MVV A;  3CCQ P;  4IFF A;  1G1J A;  1G2C B;  1KB9 D;  4BPH A;  1KV4 A;  2EHT A;  2E43 A;  1GL2 C;  1FZA A;  1M57 D;  1BDC A;  2QNW A;  4EDF A;  3IF4 A;  5KAI H;  2HLO A;  3FWL A;  2WVR A;  3M1M A;  1KFM A;  2PEO A;  3AE1 C;  3M91 A;  2E76 C;  1X79 B;  3RBX A;  3A2A A;  2Z5I A;  3MUD C;  3EFG A;  4I6M C;  3W68 A;  2E75 B;  4XFX A;  1T6A A;  4U0D A;  3AEF C;  1LTJ B;  2YKO A;  2H8P D;  1QRJ A;  4DCK A;  2ZYG A;  2HYN A;  1BCC J;  1KYO E;  1HBW A;  1FAV A;  3LW5 H;  4KT0 J;  1EDI A;  2M3E A;  2BAS A;  2M5A B;  4L76 A;  2WMM A;  2UWJ E;  3L37 A;  1GW3 A;  4QMA A;  3H1L E;  4COC A;  1BGY E;  1M90 Q;  1KIL B;  4ZKU A;  5BU8 B;  1TU3 F;  3KQG A;  4UB6 E;  1EC5 A;  5F2K A;  1JCC A;  2JJL A;  3L70 D;  5E79 E;  4R4L A;  1KIL D;  1SQP J;  2AXT H;  3VOP A;  3R4Y A;  3E2D A;  1KLP A;  3ITK A;  1X0T A;  3L71 D;  3CPW O;  1JMM A;  5F2N A;  1KB9 I;  3G29 A;  1QL2 A;  4EIJ A;  5KLV E;  3HD7 B;  1M1J C;  1ZMB A;  2KB7 P;  3KPE A;  3GHG A;  2KUB A;  3BCC J;  4GDO A;  1GW4 A;  2OTL P;  1LWU B;  2W83 C;  1LGH B;  5KKZ C;  3PP5 A;  3HD7 D;  2NPS C;  2AVA A;  3W67 A;  5AW4 B;  1FDO A;  2SPZ A;  2E74 C;  1GXG A;  3TGU G;  2W6A A;  1KQF B;  2KNC A;  1JY2 N;  4O9B A;  2Y9Y A;  1S1C X;  4WVZ A;  2QE7 H;  2YIU C;  3L75 E;  5EFW B;  3Q20 A;  2ROQ A;  1L0N G;  1QVG O;  3P05 A;  1EXI A;  3Q2Y A;  3MGE A;  4H0L B;  4RKU J;  2JO0 A;  1K8A Q;  2FXP A;  2YXQ B;  1NTZ K;  3A0H E;  2WQY C;  4XRQ A;  2MR7 A;  4H0L D;  3H0D A;  2JEE A;  1IK7 A;  1N7L A;  1NTZ D;  1GU4 A;  2M5R A;  2FHS C;  2YXR B;  3VP8 A;  2QM8 A;  2PP6 A;  3C1L A;  2XKM A;  1JY2 P;  1JEK A;  2O01 J;  1JY3 N;  1W2B O;  3LIE A;  2ZT9 C;  2N1T A;  2WT7 B;  3G28 A;  1FZE A;  3HE4 A;  2YKQ A;  1YQ3 C;  1OVR A;  3H1I J;  2P7J A;  2B89 A;  1VQK P;  1GD2 E;  2PY8 A;  1ZOY C;  3NMD A;  1GU5 A;  2OYI B;  2LKM A;  4B86 A;  1USD A;  5GTH E;  1YTZ I;  2V4H A;  1AQ5 A;  2H89 C;  1QEX A;  3EQ2 A;  4U0F A;  1GK6 A;  5KJ7 C;  1SFC A;  5BVZ A;  3TNU B;  2K92 A;  2JKV A;  2GM4 A;  1W5C E;  3B71 A;  1OVV A;  2KOD A;  3C9I A;  3H1L J;  2QJY B;  1NU1 G;  1IFJ A;  1RHZ B;  4H44 B;  2KGE A;  3FX0 A;  2IBZ I;  3IFM A;  2C9L Y;  1NO4 A;  3SFD C;  1DEB A;  4U0C A;  1VQN P;  4TT3 H;  1N73 B;  3USS A;  5KAF E;  5KAI E;  4H44 D;  1NQ4 A;  2OQQ A;  2KOP A;  1ZXG A;  5KLV J;  1Q81 Q;  2I8D A;  3L74 J;  1EDJ A;  1FS0 E;  1HUC A;  2VLQ A;  2K0D X;  3DPH A;  3B5N C;  3CXC O;  4BXL A;  4XFZ A;  2JAZ A;  2KW2 A;  2JGP A;  3B8E B;  1MFT A;  2XZ0 D;  1FBM A;  3KZI H;  4HH2 A;  3E7K A;  1S5L H;  3G4S P;  3L35 A;  2BCC G;  3TYY A;  3WMM 0;  2XND H;  2X2B A;  5CJ0 A;  3S1K A;  2PGD A;  2KSJ A;  1PFI A;  5BU5 A;  4LLH A;  1PP9 J;  4TLF A;  1L0N K;  1FR2 A;  3L70 E;  3TGU D;  1L2P A;  2KS1 A;  1KIL E;  1SQV D;  2FVE A;  3VYI A;  7CEI A;  2QJK C;  3L71 E;  1QL1 A;  1SQB G;  2QSI A;  1L0N D;  1T8K A;  1ZNV A;  2XDJ A;  3L36 A;  2AXT E;  3CCE P;  1JO5 A;  1M6N A;  1QX8 A;  1WMK A;  3AEC C;  4PD4 H;  1M7L A;  4YTP C;  1P84 H;  3KXD A;  1PPJ G;  2K93 A;  3CCV P;  2LF4 A;  3PH0 A;  2B9B A;  4M3L A;  1URQ A;  3S9O A;  1EDL A;  1FDI A;  3BRT B;  2M8R A;  3GKL C;  4JYB A;  1P84 D;  3O8Z A;  2L22 A;  4WY4 A;  1LTB C;  2R3S A;  1N7S C;  2WPV B;  2V7Q H;  5KP8 B;  1OIP A;  2GZJ A;  3T97 A;  2BEZ F;  2CNR A;  1VQM P;  2K94 A;  3RL0 C;  3AEA C;  2PEQ A;  3MP7 B;  2QEX P;  4KJM A;  2M0B A;  3FXD A;  4NEO A;  3CL3 D;  4AUW A;  1M1J A;  1RE4 C;  2FVA A;  2VLP A;  2VLN A;  2KOO A;  3CCU P;  2OYH C;  2E5T A;  4OGQ C;  2JWA A;  1YYC A;  1Z6M A;  3N4X A;  3HUS A;  5BS1 A;  1NTZ E;  2RKL A;  2O1J A;  1AVY A;  2NPS A;  3HYB A;  1EDK A;  3Q5P A;  1BCC E;  3GHG B;  3OW2 O;  3U59 A;  1DIP A;  2PEJ A;  2LOL A;  4GOE A;  1NKN A;  5AVQ B;  1FE6 A;  3AEE C;  1JB0 J;  4UB8 H;  1RNI A;  2W90 A;  1NU1 D;  4BPF A;  4W80 A;  1S9K E;  2OGU A;  2QVA A;  3CX5 I;  4C7N A;  3GF3 A;  1NTK D;  2FYU G;  1IFI A;  4CA3 A;  4ZNC A;  5CBN A;  4PV1 B;  2XV5 A;  1M74 A;  1IO4 A;  1FOS F;  2B88 A;  1KYO I;  3BAT A;  1J1D B;  3AEB C;  3E1I A;  4XE5 B;  3IR9 A;  2AEM A;  1PGP A;  5CCG C;  4RO0 A;  3VRL C;  5AW7 B;  4PV1 D;  1VL2 A;  3LW5 J;  2AXC A;  1YI2 P;  2OTJ P;  3L70 J;  1DNY A;  2Z46 A;  1CI6 A;  2KOG A;  3AE8 C;  5AVU B;  3D71 A;  2IBZ G;  1FZG A;  1PEO A;  1EZV I;  2BCC D;  1HF9 A;  2PEI A;  2N1T B;  1L4A A;  3L71 J;  3L4F A;  4N6J A;  2XU6 A;  3HE4 B;  3VMA A;  2XZ1 C;  2ZXE B;  2JQ4 A;  3NXS A;  2GYK A;  3LMO A;  3V5B A;  1KB9 H;  1RF0 A;  2ZFC A;  2N1T D;  2E75 C;  1J2J B;  1SQX G;  2W8Z A;  1RF1 B;  5KJ7 A;  1SQB D;  5CMZ A;  1LTJ C;  1ZRT E;  2FKW B;  3P8C D;  4Y99 B;  1VF5 B;  1AA0 A;  3GMA A;  3G6E P;  1KIL C;  2QRX A;  1SFC B;  2LXC B;  3V2Q A;  1PPJ D;  1LTS C;  1H89 A;  3QWO C;  2JWD A;  2MVU A;  1VQ8 P;  1RQU A;  3U1C A;  3A0B H;  4WWI A;  1AJY A;  1S5L E;  1KQS O;  1CW5 A;  3H1I E;  3GJN A;  2CWO A;  3NY7 B;  3H1J G;  1VF5 D;  2FY8 A;  1SFC D;  5AVZ B;  2I1J A;  2Q7C A;  3H47 A;  1L0L G;  3GW6 A;  3DS0 A;  1SLQ A;  3EFF K;  1L0N E;  1VHN A;  1VQ7 P;  4H2X C;  4PJ0 H;  2Q6Q A;  1J1E B;  2FXM A;  1YBK A;  3HD7 C;  1PIX A;  1NTZ J;  2ZYD A;  2JP3 A;  3D6Y A;  2JBG A;  2D2C D;  3G21 A;  4WB4 A;  5AW2 B;  3DS3 A;  1LWU C;  3DTJ A;  2GUV A;  5HGO A;  5F2O A;  3R2P A;  4GT1 A;  1BE3 G;  4PD4 E;  1NH4 A;  2JDI H;  1PGJ A;  2WSF J;  1FZC A;  2EFJ A;  2H43 A;  1IZN B;  1P84 E;  3UIA A;  2DNW A;  3HZQ A;  1S3J A;  2N98 A;  1LT9 A;  3RK3 B;  1DV5 A;  3TSI A;  1KFN A;  1SS1 A;  5TIS H;  1SQQ G;  3G9R A;  2FXO A;  3VN0 A;  1R8E A;  2KGA A;  4YPC A;  2KG8 A;  4H0L C;  2K0X A;  4U0B A;  1KQL A;  3RK3 D;  4GOD A;  4GKG A;  3VMZ A;  2KS1 B;  3FXE A;  1JTH A;  1VDF A;  3L74 E;  2AEJ A;  2FYU D;  4BRY A;  2E42 A;  2ZYA A;  2XXM A;  2KLV A;  3SFE C;  3G3Z A;  1OFC X;  4IOI H;  4JYC A;  2Y0D A;  5HGM A;  3H1K G;  2FAD A;  5EJD A;  1R5S A;  2QG4 A;  3WUV A;  1K73 Q;  2CPB A;  2FFD A;  1NAF A;  1ZV8 A;  2GZI A;  2L4B A;  5APX A;  1SQV G;  2K37 A;  2WPQ A;  2G8Y A;  2CQ8 A;  3V4W A;  4N78 D;  3U43 A;  1OMI A;  3MZW B;  1HJB A;  1AYI A;  1URQ B;  1PP9 E;  2ZVO B;  2IZ1 A;  2W6J H;  2JYL A;  4PH1 A;  4WY4 B;  5AVV B;  4UB8 E;  2IBZ D;  1HQB A;  1JY2 O;  4U3F G;  3H1H G;  2KZJ A;  2JU2 A;  3KYQ A;  5AW1 B;  3T97 B;  1URQ D;  4H13 B;  2OYI C;  1NOH A;  2L6E A;  3B5I A;  4WY4 D;  5KP7 B;  2LTE A;  2XZR A;  1NYH A;  2KYV A;  4XFY A;  1M1J B;  3M0D A;  4H2Y C;  2WSF H;  1T3J A;  1MZ9 A;  2MY5 A;  3LID A;  4H13 D;  2PEM A;  1M1K Q;  1JUN A;  2C0X A;  4NPE A;  2LKI A;  2QJP B;  1SQX D;  1RO0 A;  2KOR A;  3I56 P;  3AE5 C;  3HUS B;  2QJY C;  1IFP A;  2A06 E;  4H44 C;  2WIT A;  2Z4E A;  1NTM G;  3TGU J;  1IJD B;  2E74 B;  1SQV J;  3AEG C;  3L73 G;  3PTZ A;  1LT1 A;  2ONT A;  1BSN A;  2BCC E;  1N73 C;  2PEK A;  2Q9I A;  1S4X A;  2BQ1 E;  4HKZ H;  1YIT P;  1X8Y A;  1JY3 O;  1EZV G;  3M9B A;  2GDW A;  4GR6 A;  1L0N J;  1IFD A;  2NPS D;  2YIU B;  3L72 G;  1VPC A;  2E74 D;  3B4S A;  1S5L X;  4JPZ B;  4D6T D;  2Q3E A;  4DOJ A;  3H1J D;  3RK2 C;  5AW0 B;  3H32 A;  4L73 A;  2AEF A;  5H2F H;  1IFN A;  1L0L D;  4GOF A;  1UNK A;  4IL6 H;  2KR5 A;  1JY3 P;  2L5G B;  1KB9 E;  5CCG A;  3MHV A;  3P8C E;  3TDK A;  3OJA B;  4IZ6 A;  1WT6 A;  2MJZ A;  3F5H A;  2JR8 A;  3BVH A;  5HV8 A;  1PPJ E;  1NTK G;  5CCH C;  1T2K D;  2PAJ A;  1BE3 D;  2K0Y A;  2ZT9 B;  1A02 J;  3GG2 A;  2V7Q J;  4LC1 A;  2MR8 A;  1NKZ B;  5AW3 B;  3ABV C;  2PFX A;  1CI6 B;  3A0B E;  2N6Z A;  4M0I A;  3JSV C;  1A43 A;  3CC4 P;  3F89 A;  3CD6 P;  4HJG H;  2ZT9 D;  1SQQ D;  1L4A B;  1D1D A;  1AQT A;  3V2R A;  1LTJ A;  2GZG A;  4F37 A;  3JC2 2;  3O6Q A;  1PGQ A;  2IFN A;  1A8O A;  2J59 M;  1GL2 A;  3FWN A;  3CLQ A;  1LTG C;  1L4A D;  1PV3 A;  1SQV K;  1Y47 A;  1YJ9 P;  3FGA D;  2FAE A;  1AVO A;  1E6J P;  1NU1 J;  3H1K D;  3DS1 A;  3SWY A;  1JOC A;  2HFE D;  2P9X A;  4ASV A;  1NTK J;  5KJ7 D;  3MUD A;  2FQ1 A;  4W7Y A;  4PWV B;  1HVV A;  4CPG A;  4JBZ A;  1FJP A;  2Q3I A;  3CX5 H;  1BXI A;  5TIS E;  3RK3 E;  4K3A A;  4I7Z B;  3VTP C;  3VMY A;  2FYU E;  2MD9 A;  4N3Y B;  1ZME C;  2M8N A;  3Q1M A;  3CX5 D;  4U3F D;  3H1H D;  2P10 A;  1LWU A;  2P2U A;  1DD4 A;  4W7Z A;  1H0T A;  1VQ5 P;  1CEI A;  2R32 A;  1KYO H;  2EHS A;  2GZE A;  3JCU H;  1GPJ A;  2N9B A;  1NTM K;  1BDD A;  4PXH B;  3CI9 A;  3CCL P;  1KYO D;  1Q2N A;  2HOD A;  2BCC J;  1MFZ A;  2P1J A;  3H6P A;  2A45 I;  2RH0 A;  3CXH I;  2O3J A;  3M9Q A;  2HG5 D;  1MZ8 A;  1FZC B;  1BGY D;  2FVF A;  2BEQ D;  3CC7 P;  2H88 C;  1NTM D;  3A7O A;  1IC2 A;  4HB1 A;  1M56 D;  1LT9 B;  2YKP A;  3L73 D;  2KLU A;  3V2P A;  3AE2 C;  2OYO A;  2KWL A;  5AW6 B;  1M6E X;  2PNG A;  1SQB J;  1IUQ A;  3HE5 A;  1NVO A;  2WTY A;  1EZV D;  3AE4 C;  4EOT A;  4PV1 C;  3L72 D;  1Q86 Q;  2WSS H;  2KZI A;  5L8R J;  2YMK A;  2Z45 A;  1NU1 K;  2EIA A;  1J1D C;  1JTH B;  2KG6 A;  2POH A;  3GLM A;  1SQX E;  4BRY B;  1OR5 A;  2XV6 A;  1NTK K;  5CHX A;  4YXD C;  4COP A;  3D70 A;  2VSQ A;  1ACP A;  2AFD A;  3EJD A;  2L91 A;  5DJU B;  4HYT B;  1LNQ A;  3CWB G;  1PGO A;  1OXZ A;  3LRY A;  1ZP0 C;  2FFD B;  2KNC B;  3G0V A;  2CK3 H;  2QM7 A;  1FDM A;  4ZMD A;  3M06 A;  3L75 D;  2O01 N;  3H1J E;  3RL0 B;  5APS A;  2KGD A;  2CG5 B;  4OVN F;  3KDP B;  1JNM A;  2E5Y A;  3MD0 A;  1RF1 C;  5K5G B;  5AVY B;  1N86 A;  2J5U A;  1LTT C;  4C46 A;  3RL0 D;  5H2F E;  1FZF A;  1KN7 A;  1DD3 A;  1GK4 A;  1RQV A;  4IL6 E;  1NHL A;  1FJK A;  1VF5 C;  5AW8 B;  1SFC C;  2R3C A;  1LP1 A;  1XTG B;  1BE3 E;  4WYM A;  4WBA A;  5AW9 B;  2Q5U A;  5JPA A;  1SQB K;  4NPF X;  2MF4 A;  2OAR A;  1M8O B;  2FYU J;  1OWA A;  5APV A;  3HTK A;  1J1E C;  4R4M A;  2P67 A;  3PRJ A;  1D7M A;  1K05 A;  5APQ A;  5B5E H;  1LTA C;  3PJS K;  3TK1 A;  4H2W C;  3H32 B;  1K04 A;  5C39 A;  3AED C;  3PLN A;  2HPC A;  1BCC G;  5KLI B;  2WWW A;  5CCH A;  3H1K E;  4JF7 A;  1YIJ P;  5DCK A;  1FU1 A;  1HWT C;  2EG5 A;  1XTC C;  3KZI E;  3WUU A;  1YJW P;  3TGU E;  4D6T G;  3RK3 C;  2N5H A;  1SQV E;  3II6 A;  2KG9 A;  5KAF H;  2DW3 A;  1IMP A;  2WSC J;  4MN4 C;  1UII A;  2K5X A;  2R5B A;  2D2C B;  3VMX A;  1SQP G;  1OW7 A;  5CCG D;  1VQL P;  1QVF O;  2LPK A;  1EXJ A;  3B5N A;  1JM0 A;  3Q5S A;  2FYN B;  1LJ2 A;  2W6B A;  2YO2 A;  3CX5 E;  2CPS A;  4U3F E;  3H1H E;  1T3U A;  2QA4 P;  3BCC G;  1NJI Q;  4GR2 A;  1SQX J;  3NTE A;  2Q1K A;  2LXB A;  1MUU A;  1Q90 D;  1E0H A;  3O6Q B;  2JYG A;  2WPT A;  1WRG A;  1PZQ A;  3SSU A;  1GL2 B;  2MKV A;  1X22 A;  3JCU E;  2E75 D;  4OWF A;  1Q7Y Q;  2KOQ A;  3BRV B;  2FYU K;  1URQ C;  2A45 G;  1IK9 A;  1JJ2 O;  1NTM E;  1L0I A;  3BAS A;  3KHU A;  4D6T J;  4WY4 C;  4EI2 A;  3H1J J;  3CWB D;  3L73 E;  1RO2 A;  5CZD B;  1GL2 D;  5GTI H;  2E76 B;  3P7K A;  1E79 H;  1L0L J;  2HR3 A;  3PHL A;  3TF5 A;  1EZV E;  4H13 C;  1VQO P;  2R5D A;  3P8M C;  2ZXX A;  1GZL A;  3L72 E;  4DT0 A;  1W2E A;  3AE9 C;  3V6I A;  2E76 D;  3IN6 A;  2GDY A;  2FBW C;  3CCM P;  2ZVN B;  2QJP C;  1N7S A;  3HUS C;  1ZR4 A;  1H0T B;  1BE3 J;  2IDB A;  1YTZ T;  1NU1 E;  2N6Y A;  4Y28 J;  2WPR A;  4XRO A;  2WSC H;  4A7P A;  3WU2 H;  2M3B A;  3IAO A;  4IL6 X;  3VP9 A;  3H1I G;  4IFM A;  1GTW A;  1NTK E;  1VQ9 P;  1U7M A;  2IYP A;  4IPY A;  1HJ0 A;  2HOD B; 
#chains in the Genus database with same CATH homology
 1D1D A;  1EIA A;  5HGL A;  3CC7 P;  3HYB A;  2QA4 P;  2OTL P;  1RO0 A;  3I56 P;  1NJI Q;  4U0E A;  4GR2 A;  2PY8 A;  3NTE A;  3OW2 O;  3RG6 C;  4QNB A;  1AUM A;  2PEJ A;  4WYM A;  2BUO A;  3M1M A;  1A8O A;  2XT1 A;  2Z44 A;  1KD1 Q;  1M6E X;  4U0B A;  3G71 P;  1IUQ A;  5JPA A;  2JYG A;  2PEO A;  4U0F A;  4U0A A;  2ONT A;  1YJ9 P;  3G1G A;  1RNI A;  2PEK A;  5HGN A;  2BQ1 E;  1E6J P;  2M8P A;  3DS2 A;  1Q86 Q;  2OAR A;  1YIT P;  1YJN P;  3DS1 A;  2KOD A;  2Z45 A;  4GR6 A;  1Q7Y Q;  1M1K Q;  1VQ6 P;  2XXM A;  2EIA A;  2P9X A;  3CCJ P;  3CCE P;  3G6E P;  3CC2 P;  5HGM A;  2BHV A;  3Q20 A;  1M6N A;  1YHQ P;  2E1M A;  1JJ2 O;  1QVG O;  3P05 A;  4XFX A;  3CCR P;  4U0D A;  1VQ8 P;  3MGE A;  2XV6 A;  1RO2 A;  2JO0 A;  1K73 Q;  1QRJ A;  1K8A Q;  1KQS O;  4COP A;  1VQ4 P;  4U0C A;  1VQN P;  3CCV P;  2LF4 A;  2CWO A;  4PH0 A;  1VQP P;  1M74 A;  1PEM A;  3LRY A;  1VQO P;  3H47 A;  3CMA P;  4XRQ A;  3DS0 A;  3CME P;  3G0V A;  3H0D A;  4COC A;  1M90 Q;  1VQ7 P;  3DS5 A;  2M8N A;  3CCS P;  1Q81 Q;  1YIJ P;  1S72 P;  5DCK A;  5I4T G;  1EOQ A;  3WBH A;  2EG5 A;  3H4E A;  2JYL A;  1PEU A;  4PH1 A;  1YJW P;  3G26 A;  3VRL C;  1VQM P;  3I55 P;  1VQ5 P;  1K30 A;  5F2K A;  3DPH A;  3CXC O;  1YI2 P;  3CCM P;  3DS4 A;  2PEQ A;  1W2B O;  4XFZ A;  3G21 A;  1Q82 Q;  2QEX P;  3DS3 A;  2OTJ P;  3DTJ A;  2Z46 A;  2M8L A;  5HGO A;  3G28 A;  1N8R Q;  1BAJ A;  5F2O A;  2L6E A;  1K9M Q;  3B5I A;  3E2D A;  1PEO A;  5BS2 A;  2DGY A;  4XRO A;  1PEQ A;  3CCL P;  3CCQ P;  1VQL P;  3CPW O;  1QVF O;  2PEI A;  2EFJ A;  5F2N A;  3CCU P;  3G29 A;  4M0I A;  1A43 A;  4XFY A;  1ZMB A;  3CC4 P;  3CD6 P;  3G4S P;  1VQ9 P;  3G1I A;  3HZQ A;  5BS1 A;  4IPY A;  1KC8 Q;  2PEM A;  1VQK P;  2PEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...