3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
1VQ4P 3CXCO 3CCMP 3CCUP 1VQMP 1Q81Q 3CCSP 1QVGO 3CCVP 1N8RQ 1M1KQ 1VQLP 2OTJP 3G6EP 1YJ9P 1VQ7P 3CPWO 1VQKP 1K9MQ 3CCJP 1YI2P 1VQOP 3CMEP 1M90Q 2QEXP 3CC4P 1QVFO 1VQ5P 3CC2P 3CC7P 3I56P 2OTLP 1VQ9P 2QA4P 3CMAP 1YHQP 1VQPP 1Q82Q 3CD6P 3OW2O 3CCQP 1VQ8P 1Q7YQ 3CCRP 1NJIQ 3G71P 3G4SP 1KQSO 3CCLP 1YITP 1K8AQ 1JJ2O 1YIJP 1VQ6P 1Q86Q 3CCEP 1VQNP 1S72P 1K73Q 1W2BO 1YJWP 1KD1Q 1KC8Q 3I55P 1YJNP
chains in the Genus database with same CATH superfamily
1K04A 5AVVB 3RK3C 5APQA 3V4QA 1IFNA 2DNWA 4QMAA 2GUVA 2MD9A 3CX5E 1W5CE 5KAFH 2GZJA 2K9YA 4MN4C 5E79H 1BGYE 3JCUH 3U59A 4PD4H 1VQNP 1T2KC 1L0ND 4UB8E 1WRGA 1OVRA 3L4FA 5KAIH 3GKLC 1LTJA 1FZCB 5H2FH 3LW5H 4L76A 1MFTA 1KB9I 1R8EA 2V7QH 3AEEC 3CX5H 2LIWA 2VRSA 4OVNF 2OGUA 5AW8B 1L0LJ 3EJEA 2JWDA 1LP1B 1Q81Q 5CCHD 2FYUD 4W7ZA 2OTLP 2LOLA 5APTA 1LTJC 1Q7YQ 3Q5RA 1J1EC 1JY2O 1NTKG 1FOSE 4GKGA 1S1CX 4H44D 1VHNA 3GZLA 4RESB 1OVVA 1CW5A 1SQXK 3CWBE 2BASA 1LTTC 1NTMK 1VQKP 1PGPA 1GW3A 4JBZA 3CLQA 3R4YA 3TSIA 3CWBJ 1BXIA 3CD6P 3BCCG 1NJIQ 1RE4A 3Q1MA 1QL2A 3AE8C 5KAFE 5AW7B 1LWUB 2CNRA 2YO2A 3AEAC 1SQPD 3RL0B 2W6AA 3D6YA 5B5EE 1URQD 1FZFA 3E7KA 5KLVK 1ZN5A 2IYOA 5AW3B 5AVRB 4PXHB 2JKVA 1AUMA 2P9XA 1NTZD 4YPCA 4WY4D 1AA0A 3OJAB 2C9NY 1YBKA 3G1GA 1BSHA 3M0AA 3L74G 3CCQP 2VLNA 3WMM0 4IL6H 4N6JA 3P8MC 1EC5A 2KLUA 4H0LD 1K05A 1HTLC 1KD1Q 3FXEA 2JDIH 1HUCA 1Q2NA 3V4WA 2H43A 1EZVE 3T97B 2BCCE 3B71A 1L0LG 1G2CB 3HRNA 1S9KD 4L75A 1FU1A 2H88C 2W90A 4XFXA 2CG5B 1NVOA 2NZ2A 2XXMA 2A06G 3A5TA 2V7QJ 3MZWB 1Q86Q 5B5EH 1GZLA 3NMDA 3O6QB 1X22A 1YJNP 4N78D 2XZRA 3H1JE 2OYIC 3O8ZA 4DCKA 1HQBA 3R2PA 1LTGC 2IPPA 3AE3C 2N98A 2MJZA 4EDFA 1XTCC 3H1KJ 2J5UA 2KIKA 2JJLA 2LMLA 2FYUJ 1MFZA 1A02J 1FC2C 1FDIA 2K0YA 3H1HJ 3CCMP 4GODA 2JQ4A 2QVAA 2KORA 3H1HE 2PP6A 1VQOP 3L75G 3DS5A 4NEOA 2N6YA 4U3FG 5HGNA 2BEQD 2KYVA 1H89A 3M91A 4RJTA 1EZVD 1VL2A 1BGYG 4BPGA 1OFCX 1DEEG 3VTPC 2LL8A 3D6ZA 2OTKE 2PAJA 1YI2P 2YMKA 3HTKB 2M5RA 3RK2D 4IFDK 1A43A 1RY3A 1M6EX 3HUSA 1T8KA 1BE3J 1VF5B 4PV1C 3G71P 4QNBA 2KG6A 1IJDB 2NO8A 1J1DC 3HD7D 2PY8A 1M57D 2PEJA 2O1KA 1CEIA 3BASA 5TISH 2VSQA 5AVZB 1NH4A 3AEDC 1KV4A 3L70E 1K30A 2OYHA 2AFDA 2WZ7A 2XKMA 1EMVA 3DS4A 3BCCJ 2N1TB 3H1LD 3I55P 2R32A 4W80A 2KI7B 3IR9A 2QJKC 3HD7C 1USDA 1GXHA 3VP8A 1T8ZA 1FOSF 1L0NE 2IBZD 3HUSB 3IN6A 5AW9B 2KZJA 1BGYD 5APUA 2OQQA 4IL6E 3Q5SA 2KNCB 1RNIA 2IBZG 1LTBC 3L72J 2XT1A 3CXCO 4Y28J 1J1DB 3NY7B 1PZQA 3EJDA 2HLOA 1L2PA 2B87B 1SVFA 2QJPB 1YHQP 1KLPA 3Q2YA 2K2QA 1LTSC 3V5BA 2OYOA 2NPSC 4JQ0D 1GK4A 1P84H 1N7SA 3PJSK 1MZ9A 2HG5D 3G3ZA 1PFIA 5CCGD 2M8PA 2IBZE 4L73A 1JCDA 1ZMBA 3GLMA 4BRYA 5F2KA 5GTHE 2ROQA 2P67A 5KJ7A 1JUNA 1GMJA 1MUUA 1NHLA 3CL3D 3RBXA 1KILC 1JJ2O 5HGLA 3S4RA 1SQQK 3G6EP 3NTNA 1YJ9P 2BCCG 3G28A 2GA1A 3GG2A 1IFJA 1G1JA 4PH0A 4C46A 3CXHH 2MVVA 2QJYC 5AVYB 1BGYJ 1NAFA 1L0LK 2ZYAA 3DS1A 3H4EA 3A0BH 5CHXA 1H88A 3M9BA 1URQA 2I8DA 3NTEA 2FYZA 3RBZA 2E76B 4GDOA 4GR2A 3CC2P 4XE5B 1ZRTE 3FX0A 2JYLA 4F37A 1LNQA 2N6ZA 1HF9A 2CPBA 2M3BA 4DT0A 1FR2A 1FZCC 4PD4E 3TGUE 3TYYA 1M74A 1OMIA 1IUQA 4WVZA 4WB4A 3L37A 3GMAA 2C0WA 1QLED 1IFMA 1L4AC 1HJ0A 1MKMA 1NO4A 4UB8H 2YKOA 2KOGA 2OYIA 2FADA 4LC1A 3H1KG 3ITKA 1GTWA 2K94A 2G8YA 2LXCB 1N73A 5M1BA 2Z46A 1NKZB 5CCHA 1E5WA 5C39A 1VPCA 1D1DA 1MZ8A 2K93A 1ZRTD 3CXHI 4AQRD 2QNWA 2Y9YA 1UIXA 1AVOA 2X2BA 1TU3F 2XZ1C 4YTPC 2E1MA 1DD3A 1J1EB 3PP5A 3BCCD 1W2BO 3RK2C 3L71E 4GOEA 1JM0A 2V4HA 2VLPA 3DS0A 3KPEA 3C9IA 5AW1B 1YTZT 2IDBA 4IL6X 4GT1A 4H44B 1SQPG 1S5LE 4KHXA 3H1KD 3C1LA 1FJKA 2IBZI 3AEFC 2PEKA 1JY3N 4PJ0E 2N9BA 1N86A 2YMYA 2J58A 1NQ4A 5KAIE 2PENA 1FJPA 3B5NB 1AQTA 1NU1J 1E0HA 2KGCA 3FWNA 5KP6B 4OGQB 2JP3A 4A7PA 4I6MC 3GF3A 4H2WC 2E5YA 3FXDA 3AE5C 2ZXXA 2E74B 2KXPB 3CX5D 4RKUJ 1RE4C 4HB1A 2POHA 1SQQJ 3WUTA 2GZEA 3TNUA 3RK2B 3CI9A 1IMQA 2QG4A 3L73J 4OGQD 2KGDA 3LW5J 4WWIA 1NTZG 1LWUC 2PFXA 1ZLLA 3H6PA 3SWFA 1MV8A 4JYBA 2ZVNB 4XFZA 3VN0A 1QEXA 5GTIE 2MVUA 3L73E 5KKZC 2KG9A 1S5LX 2NRGA 3QH9A 3M9QA 1EZVI 2E75C 2L9FA 1GU4A 3KHUA 5JPAA 2K1AA 1RF0C 1CZQA 1KQLA 3SWYA 2LKIA 3H1JD 1GL2C 1AYIA 3RK3B 3ZDMA 3PTZA 5KJ7D 2OYHB 1PP9D 1RF1C 4WY4A 4L74A 1JY3P 2C9LY 2WSEH 1NTMG 4M3LA 2EHSA 2L5GB 1NU1K 4H2XC 2N9YB 2L4BA 3G0VA 1GL2D 1BDCA 2QM7A 3L70D 1PGQA 3M0DA 1YQ4C 3HE4B 4PV1D 3AE2C 1IFDA 4C7NB 5HGMA 5EJDA 2HYNA 1U57A 1Q90D 3IAOA 3BCCE 3OW2O 2GDWA 2Z45A 5CBOA 4AUWA 3NXSA 3P7KA 5KLIB 1NOHA 2NPSB 3KQGA 1LP1A 2H89C 1ZR2A 1BDDA 2KR5A 3OA7A 1P84I 1IC2A 1OXZA 1SQXJ 1X79B 2R5DA 3CCVP 3H1LG 3RL0C 5KKZB 1KB9E 4U0CA 1QL1A 1LTJB 4R4LA 2KOSA 1UIIA 1AV1A 5CMZA 3V2QA 5HGOA 3IFMA 1P84D 3H1KE 4XA4A 2NPSD 4K3AA 4Y99B 1BCCJ 1N7SB 1SQBD 2FY8A 4U3FD 4TLFA 2CWOA 3V2PA 2LF4A 2FVFA 2N5HA 2ZJSE 3U1CA 1IO4A 3H1IG 2ZYGA 2KGAA 2WSSH 1KQFB 3AECC 2GM4A 2W8ZA 2AEMA 2XNXA 3S1KA 4H13D 2WSCJ 2FFDC 2JGPA 1JY2N 1KB9H 1VQMP 5CZDB 2JR8A 3FGAD 3CCJP 4NPEA 1L0LE 3L71D 5APSA 1VQ9P 2JO0A 2I1JA 2PGDA 1JMMA 4U0FA 4H0LB 2MR8A 4DZOA 3KXDA 2FYUE 3KZIH 2O01J 2ZYDA 3C8VA 2K0XA 3HTKA 3F5HA 1RO0A 3HE4A 4ASVA 3CCSP 3JSVC 3VRLC 1SQVG 1PP9J 3P05A 2WQYC 2RKLA 1UNKA 2GZIA 2WMMA 3TF5A 2GDXA 4HJGH 2E76C 2AEJA 3F89A 1NTKD 3EQ2A 2QSIA 3SFEC 2LXBA 4R4MA 1L0NK 2GYKA 2KZIA 4KJMA 1DX7A 2FFDB 2OTJP 2E43A 2JYGA 2FXPA 3PLNA 3CMEP 1VDFA 1P84E 1SQBJ 2OARA 1NTZE 4DOJA 1ZOYC 1SFCD 1PIXA 1HGZA 2K9JA 2E75B 3MGEA 2O01N 2KSEA 2JWAA 1GXGA 5K5GB 1DD4A 1HH0A 1SQXD 2GZGA 3A3YB 2PEMA 3RG2A 1N7LA 1PGJA 2KS1A 3B8EB 3L72E 2CGQA 4BWNA 4HYTB 1M1JA 2P10A 3L74E 1AQ5A 2C0XA 1NKNA 5AW2B 3OAKA 3GHGC 2VLQA 2K37A 1EDLA 2RMZA 2HPCA 2CPSA 3DS2A 3A2AA 3CCRP 4K35A 3H1HD 2Q3IA 1PV3A 1YITP 1OZHA 1DV5A 3L70J 1OW7A 1Y47A 1N73B 4IOIH 3L72G 2PNGA 1SQPK 3DPHA 1L0NG 4I2LC 2WTYA 2PEOA 3V2RA 3V2NA 5APYA 1X9VA 4HH2A 2WPQA 3L72D 3L70G 1HY8A 2M8NA 3KZIE 2E74C 2YNYA 1NTMD 2EHTA 2N5IA 1EXJA 1BSNA 3Q5PA 4H2YC 5KLVJ 5B66H 3H1LE 1HBWA 1PPJE 4GOFA 1IFIA 1LT9B 2CQ8A 1SFCC 2IYPA 3B4SA 1W2EA 3U43A 2W6BA 1AVYA 5CJ0A 3CCLP 1KFNA 4C7RA 1M8OB 5AVSB 2PRRA 1SQVK 4OH8B 5DJTB 1A02F 4D6TG 1FDMA 5AVUB 4U0AA 2ZAEB 3MGNA 3H1IJ 5AW5B 5CJ4A 1FAVA 2XU6A 4YXWH 1Y8AA 1PPJG 2LKMA 4H0LC 4UB6E 1EZVG 2EFJA 1M1KQ 5AW4B 3CPWO 5B66E 1NU1E 5BVZA 2E5TA 2Q3EA 1JTHB 1YTZI 3L75J 2P7JA 4U3FJ 2FKWB 4H13C 1T6AA 2BEZF 4B86A 3L75D 2IFNA 3EFFK 2P2UA 2WWWA 1KYOD 2A45H 2VLOA 1LTAC 1PP9G 4LLHA 2MF4A 1U7JA 2MY5A 3A0BE 3WUVA 5F2NA 1PEMA 3LIDA 1CSBA 3Q3DA 4U3FE 1RE3A 3H1IE 4AYCA 1YJWP 5KLVD 4LGDE 1SQVD 2Z44A 1IFPA 4ASWA 2O1JA 3E1RA 1JCCA 5APVA 3MUDA 2H8PD 1S2EA 1KN7A 1T2KD 1AF8A 2M3EA 1CI6A 1L0HA 2MR7A 2CK3H 4QKOA 2WPVB 1KC8Q 2K0DX 3G26A 4I7ZB 1JEKA 1T3UA 2J59M 3BRVB 3L74J 1FDOA 5KLVE 2YXRB 3CX5I 3G1IA 1VQ8P 1S3JA 1JB0J 4WY4B 3GF7A 3HZQA 3H25A 3GHGA 1SP4A 3L71G 2QJKB 4GIFA 1KTMA 1H8AA 2E76D 2HR3A 2PEQA 3GZMA 1GU5A 5BS1A 2RH0A 2GDYA 4EOTA 1VKUA 3VMZA 2FYUK 3AE1C 2Q6QA 1KMIZ 2QIWA 1BCCE 4COCA 3PH0A 4JF7A 7CEIA 2Y9ZA 2WVRA 3G21A 4OWFA 2N50A 2N1TA 3AE9C 3MIWA 3I5CA 1U7MA 2R44A 3TGUD 2AXTH 4HKZH 3M0DC 1PEOA 2WT7B 5BU5A 4D6TJ 5DCKA 2Z5HA 2BHVA 1ZMEC 1PL5A 3B5ND 4PJ0H 2FBWC 1EOQA 5H2FE 1AJYA 2HFED 1K73Q 1ACPA 1JY2P 1FS0E 3GW6A 2A45G 3MD0A 2KOQA 2QJPC 5TISE 2LTEA 1RF0A 1NGMB 5EFWB 1LT9A 2WPTA 2ZFCA 2FXOA 3B5NC 3B5NA 4D6TE 2AFEA 3VMXA 3L73G 1H0TB 3SFDC 3WU2E 3H32B 1LT9C 3AE4C 3U1AA 4JPZB 4U7JA 1OW6A 1QVFO 1SQQG 2AXTE 1BE3D 2W6JH 2I1KA 4PWVB 1SFCB 3AEBC 3UIAA 3TNUB 1BE3E 4IFMA 1VQ6P 3GJNA 1NTZJ 4I1LA 3BRTB 3CXHE 2LIUA 1RHZB 4D6TD 3WU2H 3LRYA 2WSFH 2HPCB 1JTHA 3QWOC 1KILB 5BU8B 3VYIA 4H13B 2KUBA 1OR5A 4PD4I 1SLQA 1SQPJ 1EDIA 1WMKA 4DG9A 2YO3A 1VF5D 1QVGO 2EIAA 1PP9E 5AVTB 3TGUG 1ZW0A 2SPZA 3AEGC 3L36A 2KS1B 2KP8A 3HYBA 3BVHA 2YIUC 4XFYA 4M0IA 2W27A 1L4AB 2KW2A 2FHSC 5F2OA 2JB0A 1RF1B 2D2CC 2ONTA 2XV6A 5HV8A 3S9OA 2JBGA 5AVQB 1LT1A 3I56P 2FQ0A 1VQPP 1HGVA 1GPJA 3CE7A 3H1HG 1BCCD 1SS1A 2FYNB 3WBHA 2XZ0D 2Y0CA 5TJHA 3TK1A 3KDPB 3MUDC 3M1MA 4H44C 3PHLA 1Z56A 1KORA 3L73D 1HJBA 5EW5E 2O01H 4N3YB 2Q7CA 2L22A 1GK6A 2ZT9B 3B5IA 2JO1A 2R3CA 4WY4C 1RF1A 4N78E 1L4AA 2Q1KA 2EG5A 3A0HE 4KT0J 4O9BA 2WSEJ 2KG8A 3VMYA 1QRJA 5KP8B 2A06E 3H1JJ 2YIUB 2QA4P 1FZCA 5KLVG 5KLIC 2KGEA 1G2CA 4U0BA 1N2DC 2LR2A 2L0QA 2A06D 1URQB 3RGUA 3DTJA 4IPYA 2Y0DA 2D2CB 1NTKE 2A45I 1NTME 2P1JA 1USEA 2B89A 2BCCJ 3MP7B 2E74D 1SQBK 3VOPA 1DH3A 2KK7A 3RL0D 1Y9BA 1NTKK 1Q82Q 2FYNC 1BCCG 2Z4EA 1F80D 1X3OA 1FZEA 2XNDH 2FQ2A 3H32A 1XTGB 1FBMA 4R0MA 1NYHA 2W83C 5I4TG 1SQQD 2KNCA 3D71A 3H1LJ 5L8RJ 2M5AA 2E42A 2IX7C 1SQVE 5HVCA 2FQ1A 3P8CD 5KJ7C 1BAJA 4MRTC 2B87A 1X8YA 4ZMDA 1FZAA 3V6IA 4XRQA 2YKPA 1NTZK 3H47A 2JU2A 1IK7A 1H0TA 2G3AA 2K88A 4Z1MH 3E2DA 2N1TC 1L0LD 5KTBA 3VMAA 1QX8A 2FXMA 3MTUE 1KFMA 1N7SC 2WSCH 2AVAA 2NPSA 2IZ1A 2QE7H 1K9MQ 3L71J 3L35A 1GD2E 4XFJA 2E75D 3CMAP 2WPRA 1ZNVA 1KYOH 2WT7A 1S4XA 5E79E 2N1TD 3USSA 4C7NA 3AE7C 1KYOE 3RK3E 1OIPA 2ERHA 2BQ1E 1ZR4A 2JAZA 2XV5A 3ABVC 3G9RA 1VQ4P 1N7SD 3A7OA 5KP7B 2Z5IA 2QRXA 3JCUE 2R3SA 5CBNA 1SQQE 3HE5B 5BS2A 3K5BA 1LTIC 1S5LH 1A8OA 1PGOA 2QM8A 3CCEP 5CCHC 3FWLA 1RQVA 3NFQA 4JYCA 1CI6B 1N73C 2FYUG 1JMBA 3HE5A 4XROA 1M90Q 2OYHC 3MHVA 3N4XA 2FAEA 4Y99C 2QJYB 1LJ2A 1JO5A 1RO2A 1DIPA 2BUOA 1RE3C 1VF5C 4PV1B 1GDTA 3W67A 3GHGB 1E6JP 2M0BA 3N7NA 1T3JA 2Y0EA 3VP9A 1VQ5P 3E1IA 1IZNB 1NU1D 5AW0B 2UWJE 2H7HA 4ZKUA 1JOCA 1K8AQ 4W7YA 5GTHH 3O6QA 1URQC 2PEIA 1J2JB 5APWA 1N8RQ 1VQLP 5AW6B 2L6EA 3IF4A 2K92A 4YXDC 4BPHA 2KOOA 1ZP0C 3TGUJ 4RO0A 2KB7P 4I7ZC 1KZUB 4CA3A 1GL2B 2Q9IA 1KILA 1M7LA 1ZXGA 2ZXEB 2LPKA 3P8CE 1FZGA 4UHPB 4WYMA 2DW3A 2ZT9C 1S72P 1X0TA 3HD7B 4BPFA 1M1JB 3JC22 4NPDA 2WPSA 1SQXE 1QGKB 2QEXP 1SFCA 2HODB 1DNYA 2AF8A 3M9HA 3RK3D 4UB6H 1HWTC 1OWAA 3B4QA 1L0NJ 4COPA 1HVVA 2IFMA 2YXQB 1UJZA 1VQ7P 3WUUA 1M56D 3EWKA 4U0EA 4OGQC 1FE6A 2JU1A 3AE6C 1PEQA 4BXLA 1DEBA 1EXIA 1GW4A 1M6NA 2MKVA 1L4AD 3HD7A 1R5LA 1IK9A 1EDKA 3KYQA 3H1ID 1RH5B 2FVAA 1NAYA 2KSJA 2KLVA 3RL0g 3CC7P 1KYOI 1ZV8A 1RQUA 2D2CD 4DJGA 2KOPA 1M1JC 2WITA 1Z6MA 4TT3H 2IZ0A 1IMPA 5DJUB 1LGHB 3A0HH 2KWLA 2HODA 1NTMJ 1R5SA 4ZKPA 1NTKJ 3T97A 3HUSC 2K5XA 2ZT9D 3L74D 1KB9D 2M8RA 4IZ6A 2ITAA 3CWBG 1AFOA 4PH1A 5APXA 4EIJA 2Q5UA 1YYCA 1KILD 2GUSA 2AEFA 2WSFJ 2FVEA 1OW8A 3G4SP 3G29A 1JNMA 4NPFX 2ZVOB 2YKQA 1GL2A 1YIJP 4U0DA 1EQ7A 1SQVJ 1JY3O 2FACA 1S9KE 1EDJA 2AXCA 2BCCD 5GTIH 2OYIB 2XDJA 3SSUA 3H1JG 1EIAA 2JEEA 3PRJA 2P58A 2B9BA 3CCUP 4HKGA 1LWUA 1E79H 2K9JB 3EFGA 3H0DA 1KILE 4EYYQ 2B88A 2O3JA 1PEUA 1FZBA 3RG6C 2FFDA 2GZFA 3P32A 3L75E 3BATA 1OX3A 1NU1G 1KQGB 2RN0A 2K3RA 2KODA 1YQ3C 3LIEA 3D70A 3TDKA 2DGYA 1WT6A 3DS3A 3CWBD 3EJBA 4WBAA 1SQBG 5CCGA 1SQPE 2L91A 1PPJD 1KQSO 5AVWB 1BE3G 1NWQA 5AVXB 3M06A 4IFFA 1SQXG 3CXHD 3Q20A 4PD4D 1G1IA 3SWKA 3CC4P 2R5BA 3II6A 4GR6A 3LMOA 4BRYB 3W68A 1D7MA 4EI2A 5CCGC 2M8LA 2M5AB 4ZNCA 1OVUA 4CPGA 1SQBE 1L0IA
chains in the Genus database with same CATH topology
5I4TG 3CXCO 3CCMP 2ONTA 2XV6A 2OTJP 3CCVP 2JYGA 1VQ7P 2Z44A 1VQOP 3CMEP 3DS5A 4U0CA 1VQ5P 2OARA 1BAJA 5HGNA 3I56P 1YHQP 1VQPP 4U0EA 4XRQA 5HGOA 1PEQA 1EIAA 3H47A 3CCLP 3MGEA 3WBHA 1M6NA 1K8AQ 3E2DA 1VQNP 1AUMA 4XFZA 2P9XA 1KC8Q 3G26A 2PEIA 1YI2P 2Z46A 3CCUP 2CWOA 4U0AA 1N8RQ 1VQLP 3M1MA 2PEMA 2LF4A 2L6EA 1K9MQ 1D1DA 3G1GA 1A43A 2M8PA 3H0DA 1QVFO 1M6EX 1ZMBA 3CC7P 3CMAP 3G1IA 3CCQP 5F2KA 1VQ8P 1PEUA 5JPAA 3RG6C 3G71P 4QNBA 2E1MA 3B5IA 3HZQA 1JJ2O 1VQ6P 1W2BO 1KD1Q 2BQ1E 5HGLA 2EFJA 2KODA 2EG5A 2PY8A 1VQ4P 1VQMP 1Q81Q 1M1KQ 2PEJA 3DS0A 2PEQA 3G6EP 1YJ9P 3CPWO 2DGYA 1QRJA 3G28A 5BS1A 3CCJP 3LRYA 3DS3A 4PH0A 2OTLP 1VQ9P 2QA4P 2JO0A 4COCA 3DS2A 4U0FA 4U0BA 1Q7YQ 3CCRP 4XFXA 5BS2A 3G0VA 1K30A 3DS1A 1KQSO 1YITP 2PEKA 3G21A 2XXMA 4WYMA 3DTJA 3H4EA 1A8OA 4IPYA 3DS4A 1RO0A 1Q86Q 3CCEP 1S72P 2PENA 3I55P 1YJNP 3NTEA 3CCSP 1QVGO 2EIAA 3VRLC 5HGMA 1VQKP 3Q20A 3P05A 3DPHA 4PH1A 1PEOA 4XROA 1M90Q 2QEXP 3CC4P 2PEOA 4GR2A 4GR6A 5DCKA 3CC2P 3HYBA 2JYLA 2BHVA 4XFYA 1Q82Q 3OW2O 3CD6P 2Z45A 4M0IA 1NJIQ 1RO2A 5F2NA 3G29A 3G4SP 2M8LA 2BUOA 1PEMA 2M8NA 1EOQA 1M74A 1IUQA 1RNIA 5F2OA 1YIJP 4U0DA 1K73Q 4COPA 1YJWP 1E6JP 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 P;  3CXC O;  3CCM P;  3CCU P;  1VQM P;  1Q81 Q;  3CCS P;  1QVG O;  3CCV P;  1N8R Q;  1M1K Q;  1VQL P;  2OTJ P;  3G6E P;  1YJ9 P;  1VQ7 P;  3CPW O;  1VQK P;  1K9M Q;  3CCJ P;  1YI2 P;  1VQO P;  3CME P;  1M90 Q;  2QEX P;  3CC4 P;  1QVF O;  1VQ5 P;  3CC2 P;  3CC7 P;  3I56 P;  2OTL P;  1VQ9 P;  2QA4 P;  3CMA P;  1YHQ P;  1VQP P;  1Q82 Q;  3CD6 P;  3OW2 O;  3CCQ P;  1VQ8 P;  1Q7Y Q;  3CCR P;  1NJI Q;  3G71 P;  3G4S P;  1KQS O;  3CCL P;  1YIT P;  1K8A Q;  1JJ2 O;  1YIJ P;  1VQ6 P;  1Q86 Q;  3CCE P;  1VQN P;  1S72 P;  1K73 Q;  1W2B O;  1YJW P;  1KD1 Q;  1KC8 Q;  3I55 P;  1YJN P; 
#chains in the Genus database with same CATH topology
 1K04 A;  5AVV B;  3RK3 C;  5APQ A;  3V4Q A;  1IFN A;  2DNW A;  4QMA A;  2GUV A;  2MD9 A;  3CX5 E;  1W5C E;  5KAF H;  2GZJ A;  2K9Y A;  4MN4 C;  5E79 H;  1BGY E;  3JCU H;  3U59 A;  4PD4 H;  1VQN P;  1T2K C;  1L0N D;  4UB8 E;  1WRG A;  1OVR A;  3L4F A;  5KAI H;  3GKL C;  1LTJ A;  1FZC B;  5H2F H;  3LW5 H;  4L76 A;  1MFT A;  1KB9 I;  1R8E A;  2V7Q H;  3AEE C;  3CX5 H;  2LIW A;  2VRS A;  4OVN F;  2OGU A;  5AW8 B;  1L0L J;  3EJE A;  2JWD A;  1LP1 B;  1Q81 Q;  5CCH D;  2FYU D;  4W7Z A;  2OTL P;  2LOL A;  5APT A;  1LTJ C;  1Q7Y Q;  3Q5R A;  1J1E C;  1JY2 O;  1NTK G;  1FOS E;  4GKG A;  1S1C X;  4H44 D;  1VHN A;  3GZL A;  4RES B;  1OVV A;  1CW5 A;  1SQX K;  3CWB E;  2BAS A;  1LTT C;  1NTM K;  1VQK P;  1PGP A;  1GW3 A;  4JBZ A;  3CLQ A;  3R4Y A;  3TSI A;  3CWB J;  1BXI A;  3CD6 P;  3BCC G;  1NJI Q;  1RE4 A;  3Q1M A;  1QL2 A;  3AE8 C;  5KAF E;  5AW7 B;  1LWU B;  2CNR A;  2YO2 A;  3AEA C;  1SQP D;  3RL0 B;  2W6A A;  3D6Y A;  5B5E E;  1URQ D;  1FZF A;  3E7K A;  5KLV K;  1ZN5 A;  2IYO A;  5AW3 B;  5AVR B;  4PXH B;  2JKV A;  1AUM A;  2P9X A;  1NTZ D;  4YPC A;  4WY4 D;  1AA0 A;  3OJA B;  2C9N Y;  1YBK A;  3G1G A;  1BSH A;  3M0A A;  3L74 G;  3CCQ P;  2VLN A;  3WMM 0;  4IL6 H;  4N6J A;  3P8M C;  1EC5 A;  2KLU A;  4H0L D;  1K05 A;  1HTL C;  1KD1 Q;  3FXE A;  2JDI H;  1HUC A;  1Q2N A;  3V4W A;  2H43 A;  1EZV E;  3T97 B;  2BCC E;  3B71 A;  1L0L G;  1G2C B;  3HRN A;  1S9K D;  4L75 A;  1FU1 A;  2H88 C;  2W90 A;  4XFX A;  2CG5 B;  1NVO A;  2NZ2 A;  2XXM A;  2A06 G;  3A5T A;  2V7Q J;  3MZW B;  1Q86 Q;  5B5E H;  1GZL A;  3NMD A;  3O6Q B;  1X22 A;  1YJN P;  4N78 D;  2XZR A;  3H1J E;  2OYI C;  3O8Z A;  4DCK A;  1HQB A;  3R2P A;  1LTG C;  2IPP A;  3AE3 C;  2N98 A;  2MJZ A;  4EDF A;  1XTC C;  3H1K J;  2J5U A;  2KIK A;  2JJL A;  2LML A;  2FYU J;  1MFZ A;  1A02 J;  1FC2 C;  1FDI A;  2K0Y A;  3H1H J;  3CCM P;  4GOD A;  2JQ4 A;  2QVA A;  2KOR A;  3H1H E;  2PP6 A;  1VQO P;  3L75 G;  3DS5 A;  4NEO A;  2N6Y A;  4U3F G;  5HGN A;  2BEQ D;  2KYV A;  1H89 A;  3M91 A;  4RJT A;  1EZV D;  1VL2 A;  1BGY G;  4BPG A;  1OFC X;  1DEE G;  3VTP C;  2LL8 A;  3D6Z A;  2OTK E;  2PAJ A;  1YI2 P;  2YMK A;  3HTK B;  2M5R A;  3RK2 D;  4IFD K;  1A43 A;  1RY3 A;  1M6E X;  3HUS A;  1T8K A;  1BE3 J;  1VF5 B;  4PV1 C;  3G71 P;  4QNB A;  2KG6 A;  1IJD B;  2NO8 A;  1J1D C;  3HD7 D;  2PY8 A;  1M57 D;  2PEJ A;  2O1K A;  1CEI A;  3BAS A;  5TIS H;  2VSQ A;  5AVZ B;  1NH4 A;  3AED C;  1KV4 A;  3L70 E;  1K30 A;  2OYH A;  2AFD A;  2WZ7 A;  2XKM A;  1EMV A;  3DS4 A;  3BCC J;  2N1T B;  3H1L D;  3I55 P;  2R32 A;  4W80 A;  2KI7 B;  3IR9 A;  2QJK C;  3HD7 C;  1USD A;  1GXH A;  3VP8 A;  1T8Z A;  1FOS F;  1L0N E;  2IBZ D;  3HUS B;  3IN6 A;  5AW9 B;  2KZJ A;  1BGY D;  5APU A;  2OQQ A;  4IL6 E;  3Q5S A;  2KNC B;  1RNI A;  2IBZ G;  1LTB C;  3L72 J;  2XT1 A;  3CXC O;  4Y28 J;  1J1D B;  3NY7 B;  1PZQ A;  3EJD A;  2HLO A;  1L2P A;  2B87 B;  1SVF A;  2QJP B;  1YHQ P;  1KLP A;  3Q2Y A;  2K2Q A;  1LTS C;  3V5B A;  2OYO A;  2NPS C;  4JQ0 D;  1GK4 A;  1P84 H;  1N7S A;  3PJS K;  1MZ9 A;  2HG5 D;  3G3Z A;  1PFI A;  5CCG D;  2M8P A;  2IBZ E;  4L73 A;  1JCD A;  1ZMB A;  3GLM A;  4BRY A;  5F2K A;  5GTH E;  2ROQ A;  2P67 A;  5KJ7 A;  1JUN A;  1GMJ A;  1MUU A;  1NHL A;  3CL3 D;  3RBX A;  1KIL C;  1JJ2 O;  5HGL A;  3S4R A;  1SQQ K;  3G6E P;  3NTN A;  1YJ9 P;  2BCC G;  3G28 A;  2GA1 A;  3GG2 A;  1IFJ A;  1G1J A;  4PH0 A;  4C46 A;  3CXH H;  2MVV A;  2QJY C;  5AVY B;  1BGY J;  1NAF A;  1L0L K;  2ZYA A;  3DS1 A;  3H4E A;  3A0B H;  5CHX A;  1H88 A;  3M9B A;  1URQ A;  2I8D A;  3NTE A;  2FYZ A;  3RBZ A;  2E76 B;  4GDO A;  4GR2 A;  3CC2 P;  4XE5 B;  1ZRT E;  3FX0 A;  2JYL A;  4F37 A;  1LNQ A;  2N6Z A;  1HF9 A;  2CPB A;  2M3B A;  4DT0 A;  1FR2 A;  1FZC C;  4PD4 E;  3TGU E;  3TYY A;  1M74 A;  1OMI A;  1IUQ A;  4WVZ A;  4WB4 A;  3L37 A;  3GMA A;  2C0W A;  1QLE D;  1IFM A;  1L4A C;  1HJ0 A;  1MKM A;  1NO4 A;  4UB8 H;  2YKO A;  2KOG A;  2OYI A;  2FAD A;  4LC1 A;  3H1K G;  3ITK A;  1GTW A;  2K94 A;  2G8Y A;  2LXC B;  1N73 A;  5M1B A;  2Z46 A;  1NKZ B;  5CCH A;  1E5W A;  5C39 A;  1VPC A;  1D1D A;  1MZ8 A;  2K93 A;  1ZRT D;  3CXH I;  4AQR D;  2QNW A;  2Y9Y A;  1UIX A;  1AVO A;  2X2B A;  1TU3 F;  2XZ1 C;  4YTP C;  2E1M A;  1DD3 A;  1J1E B;  3PP5 A;  3BCC D;  1W2B O;  3RK2 C;  3L71 E;  4GOE A;  1JM0 A;  2V4H A;  2VLP A;  3DS0 A;  3KPE A;  3C9I A;  5AW1 B;  1YTZ T;  2IDB A;  4IL6 X;  4GT1 A;  4H44 B;  1SQP G;  1S5L E;  4KHX A;  3H1K D;  3C1L A;  1FJK A;  2IBZ I;  3AEF C;  2PEK A;  1JY3 N;  4PJ0 E;  2N9B A;  1N86 A;  2YMY A;  2J58 A;  1NQ4 A;  5KAI E;  2PEN A;  1FJP A;  3B5N B;  1AQT A;  1NU1 J;  1E0H A;  2KGC A;  3FWN A;  5KP6 B;  4OGQ B;  2JP3 A;  4A7P A;  4I6M C;  3GF3 A;  4H2W C;  2E5Y A;  3FXD A;  3AE5 C;  2ZXX A;  2E74 B;  2KXP B;  3CX5 D;  4RKU J;  1RE4 C;  4HB1 A;  2POH A;  1SQQ J;  3WUT A;  2GZE A;  3TNU A;  3RK2 B;  3CI9 A;  1IMQ A;  2QG4 A;  3L73 J;  4OGQ D;  2KGD A;  3LW5 J;  4WWI A;  1NTZ G;  1LWU C;  2PFX A;  1ZLL A;  3H6P A;  3SWF A;  1MV8 A;  4JYB A;  2ZVN B;  4XFZ A;  3VN0 A;  1QEX A;  5GTI E;  2MVU A;  3L73 E;  5KKZ C;  2KG9 A;  1S5L X;  2NRG A;  3QH9 A;  3M9Q A;  1EZV I;  2E75 C;  2L9F A;  1GU4 A;  3KHU A;  5JPA A;  2K1A A;  1RF0 C;  1CZQ A;  1KQL A;  3SWY A;  2LKI A;  3H1J D;  1GL2 C;  1AYI A;  3RK3 B;  3ZDM A;  3PTZ A;  5KJ7 D;  2OYH B;  1PP9 D;  1RF1 C;  4WY4 A;  4L74 A;  1JY3 P;  2C9L Y;  2WSE H;  1NTM G;  4M3L A;  2EHS A;  2L5G B;  1NU1 K;  4H2X C;  2N9Y B;  2L4B A;  3G0V A;  1GL2 D;  1BDC A;  2QM7 A;  3L70 D;  1PGQ A;  3M0D A;  1YQ4 C;  3HE4 B;  4PV1 D;  3AE2 C;  1IFD A;  4C7N B;  5HGM A;  5EJD A;  2HYN A;  1U57 A;  1Q90 D;  3IAO A;  3BCC E;  3OW2 O;  2GDW A;  2Z45 A;  5CBO A;  4AUW A;  3NXS A;  3P7K A;  5KLI B;  1NOH A;  2NPS B;  3KQG A;  1LP1 A;  2H89 C;  1ZR2 A;  1BDD A;  2KR5 A;  3OA7 A;  1P84 I;  1IC2 A;  1OXZ A;  1SQX J;  1X79 B;  2R5D A;  3CCV P;  3H1L G;  3RL0 C;  5KKZ B;  1KB9 E;  4U0C A;  1QL1 A;  1LTJ B;  4R4L A;  2KOS A;  1UII A;  1AV1 A;  5CMZ A;  3V2Q A;  5HGO A;  3IFM A;  1P84 D;  3H1K E;  4XA4 A;  2NPS D;  4K3A A;  4Y99 B;  1BCC J;  1N7S B;  1SQB D;  2FY8 A;  4U3F D;  4TLF A;  2CWO A;  3V2P A;  2LF4 A;  2FVF A;  2N5H A;  2ZJS E;  3U1C A;  1IO4 A;  3H1I G;  2ZYG A;  2KGA A;  2WSS H;  1KQF B;  3AEC C;  2GM4 A;  2W8Z A;  2AEM A;  2XNX A;  3S1K A;  4H13 D;  2WSC J;  2FFD C;  2JGP A;  1JY2 N;  1KB9 H;  1VQM P;  5CZD B;  2JR8 A;  3FGA D;  3CCJ P;  4NPE A;  1L0L E;  3L71 D;  5APS A;  1VQ9 P;  2JO0 A;  2I1J A;  2PGD A;  1JMM A;  4U0F A;  4H0L B;  2MR8 A;  4DZO A;  3KXD A;  2FYU E;  3KZI H;  2O01 J;  2ZYD A;  3C8V A;  2K0X A;  3HTK A;  3F5H A;  1RO0 A;  3HE4 A;  4ASV A;  3CCS P;  3JSV C;  3VRL C;  1SQV G;  1PP9 J;  3P05 A;  2WQY C;  2RKL A;  1UNK A;  2GZI A;  2WMM A;  3TF5 A;  2GDX A;  4HJG H;  2E76 C;  2AEJ A;  3F89 A;  1NTK D;  3EQ2 A;  2QSI A;  3SFE C;  2LXB A;  4R4M A;  1L0N K;  2GYK A;  2KZI A;  4KJM A;  1DX7 A;  2FFD B;  2OTJ P;  2E43 A;  2JYG A;  2FXP A;  3PLN A;  3CME P;  1VDF A;  1P84 E;  1SQB J;  2OAR A;  1NTZ E;  4DOJ A;  1ZOY C;  1SFC D;  1PIX A;  1HGZ A;  2K9J A;  2E75 B;  3MGE A;  2O01 N;  2KSE A;  2JWA A;  1GXG A;  5K5G B;  1DD4 A;  1HH0 A;  1SQX D;  2GZG A;  3A3Y B;  2PEM A;  3RG2 A;  1N7L A;  1PGJ A;  2KS1 A;  3B8E B;  3L72 E;  2CGQ A;  4BWN A;  4HYT B;  1M1J A;  2P10 A;  3L74 E;  1AQ5 A;  2C0X A;  1NKN A;  5AW2 B;  3OAK A;  3GHG C;  2VLQ A;  2K37 A;  1EDL A;  2RMZ A;  2HPC A;  2CPS A;  3DS2 A;  3A2A A;  3CCR P;  4K35 A;  3H1H D;  2Q3I A;  1PV3 A;  1YIT P;  1OZH A;  1DV5 A;  3L70 J;  1OW7 A;  1Y47 A;  1N73 B;  4IOI H;  3L72 G;  2PNG A;  1SQP K;  3DPH A;  1L0N G;  4I2L C;  2WTY A;  2PEO A;  3V2R A;  3V2N A;  5APY A;  1X9V A;  4HH2 A;  2WPQ A;  3L72 D;  3L70 G;  1HY8 A;  2M8N A;  3KZI E;  2E74 C;  2YNY A;  1NTM D;  2EHT A;  2N5I A;  1EXJ A;  1BSN A;  3Q5P A;  4H2Y C;  5KLV J;  5B66 H;  3H1L E;  1HBW A;  1PPJ E;  4GOF A;  1IFI A;  1LT9 B;  2CQ8 A;  1SFC C;  2IYP A;  3B4S A;  1W2E A;  3U43 A;  2W6B A;  1AVY A;  5CJ0 A;  3CCL P;  1KFN A;  4C7R A;  1M8O B;  5AVS B;  2PRR A;  1SQV K;  4OH8 B;  5DJT B;  1A02 F;  4D6T G;  1FDM A;  5AVU B;  4U0A A;  2ZAE B;  3MGN A;  3H1I J;  5AW5 B;  5CJ4 A;  1FAV A;  2XU6 A;  4YXW H;  1Y8A A;  1PPJ G;  2LKM A;  4H0L C;  4UB6 E;  1EZV G;  2EFJ A;  1M1K Q;  5AW4 B;  3CPW O;  5B66 E;  1NU1 E;  5BVZ A;  2E5T A;  2Q3E A;  1JTH B;  1YTZ I;  3L75 J;  2P7J A;  4U3F J;  2FKW B;  4H13 C;  1T6A A;  2BEZ F;  4B86 A;  3L75 D;  2IFN A;  3EFF K;  2P2U A;  2WWW A;  1KYO D;  2A45 H;  2VLO A;  1LTA C;  1PP9 G;  4LLH A;  2MF4 A;  1U7J A;  2MY5 A;  3A0B E;  3WUV A;  5F2N A;  1PEM A;  3LID A;  1CSB A;  3Q3D A;  4U3F E;  1RE3 A;  3H1I E;  4AYC A;  1YJW P;  5KLV D;  4LGD E;  1SQV D;  2Z44 A;  1IFP A;  4ASW A;  2O1J A;  3E1R A;  1JCC A;  5APV A;  3MUD A;  2H8P D;  1S2E A;  1KN7 A;  1T2K D;  1AF8 A;  2M3E A;  1CI6 A;  1L0H A;  2MR7 A;  2CK3 H;  4QKO A;  2WPV B;  1KC8 Q;  2K0D X;  3G26 A;  4I7Z B;  1JEK A;  1T3U A;  2J59 M;  3BRV B;  3L74 J;  1FDO A;  5KLV E;  2YXR B;  3CX5 I;  3G1I A;  1VQ8 P;  1S3J A;  1JB0 J;  4WY4 B;  3GF7 A;  3HZQ A;  3H25 A;  3GHG A;  1SP4 A;  3L71 G;  2QJK B;  4GIF A;  1KTM A;  1H8A A;  2E76 D;  2HR3 A;  2PEQ A;  3GZM A;  1GU5 A;  5BS1 A;  2RH0 A;  2GDY A;  4EOT A;  1VKU A;  3VMZ A;  2FYU K;  3AE1 C;  2Q6Q A;  1KMI Z;  2QIW A;  1BCC E;  4COC A;  3PH0 A;  4JF7 A;  7CEI A;  2Y9Z A;  2WVR A;  3G21 A;  4OWF A;  2N50 A;  2N1T A;  3AE9 C;  3MIW A;  3I5C A;  1U7M A;  2R44 A;  3TGU D;  2AXT H;  4HKZ H;  3M0D C;  1PEO A;  2WT7 B;  5BU5 A;  4D6T J;  5DCK A;  2Z5H A;  2BHV A;  1ZME C;  1PL5 A;  3B5N D;  4PJ0 H;  2FBW C;  1EOQ A;  5H2F E;  1AJY A;  2HFE D;  1K73 Q;  1ACP A;  1JY2 P;  1FS0 E;  3GW6 A;  2A45 G;  3MD0 A;  2KOQ A;  2QJP C;  5TIS E;  2LTE A;  1RF0 A;  1NGM B;  5EFW B;  1LT9 A;  2WPT A;  2ZFC A;  2FXO A;  3B5N C;  3B5N A;  4D6T E;  2AFE A;  3VMX A;  3L73 G;  1H0T B;  3SFD C;  3WU2 E;  3H32 B;  1LT9 C;  3AE4 C;  3U1A A;  4JPZ B;  4U7J A;  1OW6 A;  1QVF O;  1SQQ G;  2AXT E;  1BE3 D;  2W6J H;  2I1K A;  4PWV B;  1SFC B;  3AEB C;  3UIA A;  3TNU B;  1BE3 E;  4IFM A;  1VQ6 P;  3GJN A;  1NTZ J;  4I1L A;  3BRT B;  3CXH E;  2LIU A;  1RHZ B;  4D6T D;  3WU2 H;  3LRY A;  2WSF H;  2HPC B;  1JTH A;  3QWO C;  1KIL B;  5BU8 B;  3VYI A;  4H13 B;  2KUB A;  1OR5 A;  4PD4 I;  1SLQ A;  1SQP J;  1EDI A;  1WMK A;  4DG9 A;  2YO3 A;  1VF5 D;  1QVG O;  2EIA A;  1PP9 E;  5AVT B;  3TGU G;  1ZW0 A;  2SPZ A;  3AEG C;  3L36 A;  2KS1 B;  2KP8 A;  3HYB A;  3BVH A;  2YIU C;  4XFY A;  4M0I A;  2W27 A;  1L4A B;  2KW2 A;  2FHS C;  5F2O A;  2JB0 A;  1RF1 B;  2D2C C;  2ONT A;  2XV6 A;  5HV8 A;  3S9O A;  2JBG A;  5AVQ B;  1LT1 A;  3I56 P;  2FQ0 A;  1VQP P;  1HGV A;  1GPJ A;  3CE7 A;  3H1H G;  1BCC D;  1SS1 A;  2FYN B;  3WBH A;  2XZ0 D;  2Y0C A;  5TJH A;  3TK1 A;  3KDP B;  3MUD C;  3M1M A;  4H44 C;  3PHL A;  1Z56 A;  1KOR A;  3L73 D;  1HJB A;  5EW5 E;  2O01 H;  4N3Y B;  2Q7C A;  2L22 A;  1GK6 A;  2ZT9 B;  3B5I A;  2JO1 A;  2R3C A;  4WY4 C;  1RF1 A;  4N78 E;  1L4A A;  2Q1K A;  2EG5 A;  3A0H E;  4KT0 J;  4O9B A;  2WSE J;  2KG8 A;  3VMY A;  1QRJ A;  5KP8 B;  2A06 E;  3H1J J;  2YIU B;  2QA4 P;  1FZC A;  5KLV G;  5KLI C;  2KGE A;  1G2C A;  4U0B A;  1N2D C;  2LR2 A;  2L0Q A;  2A06 D;  1URQ B;  3RGU A;  3DTJ A;  4IPY A;  2Y0D A;  2D2C B;  1NTK E;  2A45 I;  1NTM E;  2P1J A;  1USE A;  2B89 A;  2BCC J;  3MP7 B;  2E74 D;  1SQB K;  3VOP A;  1DH3 A;  2KK7 A;  3RL0 D;  1Y9B A;  1NTK K;  1Q82 Q;  2FYN C;  1BCC G;  2Z4E A;  1F80 D;  1X3O A;  1FZE A;  2XND H;  2FQ2 A;  3H32 A;  1XTG B;  1FBM A;  4R0M A;  1NYH A;  2W83 C;  5I4T G;  1SQQ D;  2KNC A;  3D71 A;  3H1L J;  5L8R J;  2M5A A;  2E42 A;  2IX7 C;  1SQV E;  5HVC A;  2FQ1 A;  3P8C D;  5KJ7 C;  1BAJ A;  4MRT C;  2B87 A;  1X8Y A;  4ZMD A;  1FZA A;  3V6I A;  4XRQ A;  2YKP A;  1NTZ K;  3H47 A;  2JU2 A;  1IK7 A;  1H0T A;  2G3A A;  2K88 A;  4Z1M H;  3E2D A;  2N1T C;  1L0L D;  5KTB A;  3VMA A;  1QX8 A;  2FXM A;  3MTU E;  1KFM A;  1N7S C;  2WSC H;  2AVA A;  2NPS A;  2IZ1 A;  2QE7 H;  1K9M Q;  3L71 J;  3L35 A;  1GD2 E;  4XFJ A;  2E75 D;  3CMA P;  2WPR A;  1ZNV A;  1KYO H;  2WT7 A;  1S4X A;  5E79 E;  2N1T D;  3USS A;  4C7N A;  3AE7 C;  1KYO E;  3RK3 E;  1OIP A;  2ERH A;  2BQ1 E;  1ZR4 A;  2JAZ A;  2XV5 A;  3ABV C;  3G9R A;  1VQ4 P;  1N7S D;  3A7O A;  5KP7 B;  2Z5I A;  2QRX A;  3JCU E;  2R3S A;  5CBN A;  1SQQ E;  3HE5 B;  5BS2 A;  3K5B A;  1LTI C;  1S5L H;  1A8O A;  1PGO A;  2QM8 A;  3CCE P;  5CCH C;  3FWL A;  1RQV A;  3NFQ A;  4JYC A;  1CI6 B;  1N73 C;  2FYU G;  1JMB A;  3HE5 A;  4XRO A;  1M90 Q;  2OYH C;  3MHV A;  3N4X A;  2FAE A;  4Y99 C;  2QJY B;  1LJ2 A;  1JO5 A;  1RO2 A;  1DIP A;  2BUO A;  1RE3 C;  1VF5 C;  4PV1 B;  1GDT A;  3W67 A;  3GHG B;  1E6J P;  2M0B A;  3N7N A;  1T3J A;  2Y0E A;  3VP9 A;  1VQ5 P;  3E1I A;  1IZN B;  1NU1 D;  5AW0 B;  2UWJ E;  2H7H A;  4ZKU A;  1JOC A;  1K8A Q;  4W7Y A;  5GTH H;  3O6Q A;  1URQ C;  2PEI A;  1J2J B;  5APW A;  1N8R Q;  1VQL P;  5AW6 B;  2L6E A;  3IF4 A;  2K92 A;  4YXD C;  4BPH A;  2KOO A;  1ZP0 C;  3TGU J;  4RO0 A;  2KB7 P;  4I7Z C;  1KZU B;  4CA3 A;  1GL2 B;  2Q9I A;  1KIL A;  1M7L A;  1ZXG A;  2ZXE B;  2LPK A;  3P8C E;  1FZG A;  4UHP B;  4WYM A;  2DW3 A;  2ZT9 C;  1S72 P;  1X0T A;  3HD7 B;  4BPF A;  1M1J B;  3JC2 2;  4NPD A;  2WPS A;  1SQX E;  1QGK B;  2QEX P;  1SFC A;  2HOD B;  1DNY A;  2AF8 A;  3M9H A;  3RK3 D;  4UB6 H;  1HWT C;  1OWA A;  3B4Q A;  1L0N J;  4COP A;  1HVV A;  2IFM A;  2YXQ B;  1UJZ A;  1VQ7 P;  3WUU A;  1M56 D;  3EWK A;  4U0E A;  4OGQ C;  1FE6 A;  2JU1 A;  3AE6 C;  1PEQ A;  4BXL A;  1DEB A;  1EXI A;  1GW4 A;  1M6N A;  2MKV A;  1L4A D;  3HD7 A;  1R5L A;  1IK9 A;  1EDK A;  3KYQ A;  3H1I D;  1RH5 B;  2FVA A;  1NAY A;  2KSJ A;  2KLV A;  3RL0 g;  3CC7 P;  1KYO I;  1ZV8 A;  1RQU A;  2D2C D;  4DJG A;  2KOP A;  1M1J C;  2WIT A;  1Z6M A;  4TT3 H;  2IZ0 A;  1IMP A;  5DJU B;  1LGH B;  3A0H H;  2KWL A;  2HOD A;  1NTM J;  1R5S A;  4ZKP A;  1NTK J;  3T97 A;  3HUS C;  2K5X A;  2ZT9 D;  3L74 D;  1KB9 D;  2M8R A;  4IZ6 A;  2ITA A;  3CWB G;  1AFO A;  4PH1 A;  5APX A;  4EIJ A;  2Q5U A;  1YYC A;  1KIL D;  2GUS A;  2AEF A;  2WSF J;  2FVE A;  1OW8 A;  3G4S P;  3G29 A;  1JNM A;  4NPF X;  2ZVO B;  2YKQ A;  1GL2 A;  1YIJ P;  4U0D A;  1EQ7 A;  1SQV J;  1JY3 O;  2FAC A;  1S9K E;  1EDJ A;  2AXC A;  2BCC D;  5GTI H;  2OYI B;  2XDJ A;  3SSU A;  3H1J G;  1EIA A;  2JEE A;  3PRJ A;  2P58 A;  2B9B A;  3CCU P;  4HKG A;  1LWU A;  1E79 H;  2K9J B;  3EFG A;  3H0D A;  1KIL E;  4EYY Q;  2B88 A;  2O3J A;  1PEU A;  1FZB A;  3RG6 C;  2FFD A;  2GZF A;  3P32 A;  3L75 E;  3BAT A;  1OX3 A;  1NU1 G;  1KQG B;  2RN0 A;  2K3R A;  2KOD A;  1YQ3 C;  3LIE A;  3D70 A;  3TDK A;  2DGY A;  1WT6 A;  3DS3 A;  3CWB D;  3EJB A;  4WBA A;  1SQB G;  5CCG A;  1SQP E;  2L91 A;  1PPJ D;  1KQS O;  5AVW B;  1BE3 G;  1NWQ A;  5AVX B;  3M06 A;  4IFF A;  1SQX G;  3CXH D;  3Q20 A;  4PD4 D;  1G1I A;  3SWK A;  3CC4 P;  2R5B A;  3II6 A;  4GR6 A;  3LMO A;  4BRY B;  3W68 A;  1D7M A;  4EI2 A;  5CCG C;  2M8L A;  2M5A B;  4ZNC A;  1OVU A;  4CPG A;  1SQB E;  1L0I A; 
#chains in the Genus database with same CATH homology
 5I4T G;  3CXC O;  3CCM P;  2ONT A;  2XV6 A;  2OTJ P;  3CCV P;  2JYG A;  1VQ7 P;  2Z44 A;  1VQO P;  3CME P;  3DS5 A;  4U0C A;  1VQ5 P;  2OAR A;  1BAJ A;  5HGN A;  3I56 P;  1YHQ P;  1VQP P;  4U0E A;  4XRQ A;  5HGO A;  1PEQ A;  1EIA A;  3H47 A;  3CCL P;  3MGE A;  3WBH A;  1M6N A;  1K8A Q;  3E2D A;  1VQN P;  1AUM A;  4XFZ A;  2P9X A;  1KC8 Q;  3G26 A;  2PEI A;  1YI2 P;  2Z46 A;  3CCU P;  2CWO A;  4U0A A;  1N8R Q;  1VQL P;  3M1M A;  2PEM A;  2LF4 A;  2L6E A;  1K9M Q;  1D1D A;  3G1G A;  1A43 A;  2M8P A;  3H0D A;  1QVF O;  1M6E X;  1ZMB A;  3CC7 P;  3CMA P;  3G1I A;  3CCQ P;  5F2K A;  1VQ8 P;  1PEU A;  5JPA A;  3RG6 C;  3G71 P;  4QNB A;  2E1M A;  3B5I A;  3HZQ A;  1JJ2 O;  1VQ6 P;  1W2B O;  1KD1 Q;  2BQ1 E;  5HGL A;  2EFJ A;  2KOD A;  2EG5 A;  2PY8 A;  1VQ4 P;  1VQM P;  1Q81 Q;  1M1K Q;  2PEJ A;  3DS0 A;  2PEQ A;  3G6E P;  1YJ9 P;  3CPW O;  2DGY A;  1QRJ A;  3G28 A;  5BS1 A;  3CCJ P;  3LRY A;  3DS3 A;  4PH0 A;  2OTL P;  1VQ9 P;  2QA4 P;  2JO0 A;  4COC A;  3DS2 A;  4U0F A;  4U0B A;  1Q7Y Q;  3CCR P;  4XFX A;  5BS2 A;  3G0V A;  1K30 A;  3DS1 A;  1KQS O;  1YIT P;  2PEK A;  3G21 A;  2XXM A;  4WYM A;  3DTJ A;  3H4E A;  1A8O A;  4IPY A;  3DS4 A;  1RO0 A;  1Q86 Q;  3CCE P;  1S72 P;  2PEN A;  3I55 P;  1YJN P;  3NTE A;  3CCS P;  1QVG O;  2EIA A;  3VRL C;  5HGM A;  1VQK P;  3Q20 A;  3P05 A;  3DPH A;  4PH1 A;  1PEO A;  4XRO A;  1M90 Q;  2QEX P;  3CC4 P;  2PEO A;  4GR2 A;  4GR6 A;  5DCK A;  3CC2 P;  3HYB A;  2JYL A;  2BHV A;  4XFY A;  1Q82 Q;  3OW2 O;  3CD6 P;  2Z45 A;  4M0I A;  1NJI Q;  1RO2 A;  5F2N A;  3G29 A;  3G4S P;  2M8L A;  2BUO A;  1PEM A;  2M8N A;  1EOQ A;  1M74 A;  1IUQ A;  1RNI A;  5F2O A;  1YIJ P;  4U0D A;  1K73 Q;  4COP A;  1YJW P;  1E6J P;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...