3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
1YITP 1VQ6P 1YJNP 1VQLP 1Q86Q 3CXCO 3I55P 1K73Q 3CCRP 1VQPP 1VQ8P 1JJ2O 3OW2O 1YJWP 1VQOP 2OTJP 1M90Q 3CC4P 3G4SP 1M1KQ 3G6EP 1YIJP 1W2BO 1VQ7P 3G71P 1VQ5P 3CCJP 1K9MQ 1VQ9P 1YJ9P 3CC2P 3CCLP 1VQNP 1Q81Q 3CCEP 1YI2P 1QVFO 3CC7P 3CCSP 3CCQP 1QVGO 1KQSO 2QEXP 1Q7YQ 2QA4P 1Q82Q 1VQ4P 1VQMP 3CCUP 1YHQP 1S72P 1KD1Q 3CMEP 3CD6P 3CMAP 1K8AQ 1NJIQ 2OTLP 3I56P 3CCVP 3CCMP 1N8RQ 1VQKP 3CPWO 1KC8Q
chains in the Genus database with same CATH superfamily
4ZKPA 3PTZA 4TT3H 5DJTB 2IBZE 2KI7B 4BRYB 1BDCA 3CX5E 3LIEA 1EDIA 1HBWA 4U0EA 1IFPA 2GDWA 3CCEP 2FADA 1HTLC 3G1GA 2KB7P 3B5IA 2HR3A 1S72P 1LP1B 1RQVA 1EZVE 1KFNA 2RKLA 1FZAA 1VQLP 2KLVA 5BU8B 2H7HA 2IFNA 2B87A 1EDLA 3MIWA 2QJYB 1VQOP 1LTSC 4AUWA 3IF4A 1S9KD 5H2FH 2KWLA 3A2AA 2FYUG 3CX5H 4H0LD 3USSA 3DS3A 1USEA 3HD7C 3VMZA 2Z44A 1JCCA 4U3FG 2ZYAA 1FBMA 4BWNA 1PEUA 3KXDA 1KILC 1IFIA 3F5HA 5APTA 2CPBA 5APXA 4YPCA 1U7MA 2SPZA 3RK3C 3CD6P 1EMVA 1BCCE 1L4AC 1FDMA 1N8RQ 2FXMA 1JM0A 3RBXA 1FOSE 1IFJA 2K1AA 4CPGA 3G21A 3HUSC 1ZR2A 1KYOD 1HGVA 3HUSA 4IL6H 4DOJA 2WZ7A 3R2PA 1KB9I 3E7KA 5CCHA 2AXCA 1KQFB 4U3FE 2MF4A 1LTJB 1SQQJ 4WB4A 2FVFA 1AV1A 2MVUA 1Y47A 1X3OA 1NTZK 1JTHA 2CG5B 2Y0CA 3GF3A 4WY4B 1LTJC 3U1AA 4R4MA 2E5TA 3EJEA 3V2QA 1FZCA 2R32A 4EOTA 2K9JA 4U0FA 1JMMA 4H13C 1K05A 3TYYA 4ZKUA 1EXJA 3CMEP 1AYIA 1GK6A 1L4AB 2K9YA 3OA7A 3VOPA 4WYMA 2E76B 1VF5C 4RO0A 3RK3B 4JYCA 1R5SA 2IYPA 3H1IE 2YIUB 5I4TG 3RG2A 3AE3C 2DW3A 2P58A 1BDDA 5HV8A 3H32A 2HFED 3KQGA 3RK2D 1J1EB 3T97B 4GIFA 5E79H 2PRRA 2R5BA 1FZFA 1YTZI 4L76A 3V6IA 2JAZA 1DD3A 3H6PA 4XFJA 2Q5UA 3H0DA 3VP8A 1BE3G 1VQNP 5BVZA 2BHVA 2FFDB 2JWAA 2YKPA 4NPDA 2XZ0D 2WWWA 1KB9E 1OW7A 1HY8A 5KP8B 2K9JB 4D6TD 1NVOA 1MFTA 3V2RA 3WU2H 1ZMEC 2AXTE 4M3LA 3AE8C 3B5ND 2NPSC 2XT1A 1PIXA 1KILD 1S4XA 2MR8A 1L0LK 1SQPG 4PJ0H 2BEZF 1PEOA 4PV1B 3U1CA 3V2NA 2A06G 1FR2A 5KAIE 1GD2E 4MN4C 5AW0B 3AEGC 3CWBG 5AW7B 3A0HE 2K93A 2L6EA 2IZ1A 2A45H 1E0HA 5KLIB 2QA4P 3H1IG 1LT9A 1G1JA 2P2UA 4MRTC 3AE9C 1VKUA 2E74D 1WT6A 2M8LA 5BS1A 2WT7A 4QKOA 1AVOA 2M8RA 4PD4E 2O1JA 3H1JG 4C7NA 2E76D 2GDXA 1CZQA 3TGUE 4XFXA 1NTZJ 1PGPA 2QJKC 3JSVC 3L74J 2OQQA 1L2PA 4LLHA 2W6AA 1PEMA 1VPCA 3I55P 2OGUA 2IYOA 1RY3A 2O1KA 2JO0A 1BE3J 5K5GB 1L4AA 1SQPE 5AVTB 2Z5HA 3L74E 1YI2P 1FE6A 4H44D 4H44B 1SQVG 3H1KG 2K0XA 1PEQA 1EIAA 1N2DC 3AEAC 2Z5IA 2P10A 3CCMP 1MKMA 2WSFJ 3M0AA 4JBZA 1LTGC 3O8ZA 1N7SA 2K0YA 1KQLA 1A02F 2KSEA 2JYLA 2WPVB 1D7MA 3DS5A 3AEFC 1JTHB 2FYNC 1E79H 5CZDB 3NFQA 2O01H 5AW6B 3BCCJ 4Y28J 3RL0D 3HE4B 2KW2A 2N6ZA 1XTGB 1ZP0C 3L36A 2VLNA 5AW8B 1HQBA 2W83C 2OYHC 1K8AQ 3B71A 2KOOA 2R3CA 1RE4C 3EWKA 1M7LA 3I5CA 3M91A 2N5IA 4YXWH 5KJ7C 2H43A 1L0LG 3NTNA 1S1CX 1SS1A 1L0ND 2QSIA 2AEFA 3CCSP 4H0LB 5APSA 3VP9A 1Q7YQ 2FVAA 1NU1K 1ZN5A 1N86A 1PP9E 2PNGA 4GOFA 1K04A 3C1LA 5CBOA 3TF5A 5F2KA 5B5EE 5AVXB 2IBZG 1BGYE 3N4XA 4BPHA 3DTJA 1M57D 2PFXA 2ZVOB 5AW3B 1Q81Q 2PEQA 1N73C 3WBHA 1GL2C 1PV3A 1BCCD 2C0WA 2CK3H 2FAEA 1FU1A 1LJ2A 1NTMK 5KLVG 1RF1C 1PP9G 1KQGB 3L75J 2EFJA 1N7SD 2O01J 3S9OA 1OFCX 3A0BH 1GXHA 3HUSB 1JEKA 2JBGA 3L72G 1FJKA 2WITA 1JY3O 2V7QJ 1ZXGA 5APVA 2VLPA 1T2KC 4EIJA 3AE5C 2Y0DA 3GZMA 1BSNA 2EHSA 5AW4B 1A8OA 1Q86Q 3QH9A 2C9LY 2KUBA 1KFMA 4CA3A 1JY2O 1RHZB 3G1IA 2GUSA 4GODA 1RNIA 4IPYA 1PP9D 4UB8E 1RF1B 4N78D 3FWLA 2KK7A 2WSSH 3MZWB 1BCCG 3M0DA 2VSQA 4XFYA 2OYOA 2K37A 2L0QA 3L70G 2IBZI 5KAFH 2M3BA 3GMAA 3L71J 3LW5H 2N5HA 2XDJA 1AUMA 1RO0A 2IBZD 1H88A 4XE5B 3TK1A 2E75C 5AW5B 2KR5A 4HKZH 2ZAEB 1VQMP 3H1KE 1NTKG 2YO2A 1GL2D 2N1TB 1OIPA 1L0LD 2M0BA 1ZV8A 1T8ZA 2BASA 1SQXE 3SFDC 2W27A 2KOGA 3EJBA 4BPFA 3L70J 3EQ2A 2ONTA 1S5LH 4ZNCA 1BCCJ 3ABVC 2PEJA 3W68A 3CCQP 1KB9H 1KORA 4KJMA 1XTCC 1JJ2O 1GK4A 4IL6E 4I7ZB 5CCHC 1T3UA 2Y9ZA 3GJNA 3SWKA 1QX8A 1URQC 1HGZA 1H0TB 4BRYA 2YMKA 3L71E 5BU5A 3CXCO 3VRLC 1X22A 3P7KA 1IK7A 1NTMG 4I7ZC 1PPJD 5F2NA 3NMDA 2I8DA 3DS2A 1T6AA 1SP4A 5AVUB 2FFDA 2POHA 2P1JA 3M9HA 1X9VA 2KP8A 1SQVD 2JR8A 3E1RA 1NTKE 1DEBA 2XNXA 5AVYB 3H25A 1DIPA 1A43A 1NTMJ 4GR6A 2XV5A 3PLNA 2OTJP 3HD7A 1SQVJ 1NU1D 1X79B 1JB0J 1PGOA 1Q2NA 3L70E 5CCGC 4U0DA 2QRXA 2Q9IA 3RG6C 5CJ0A 4BPGA 2WVRA 2XNDH 5GTIE 4ZMDA 2ZFCA 5EFWB 1G2CB 2KG8A 3C8VA 2QJPC 1H8AA 1X0TA 3G71P 2R5DA 1NWQA 2XZ1C 1KV4A 2BCCE 3HRNA 1RE3A 3H1ID 4Y99C 2M3EA 1OVVA 4IOIH 3I56P 2JEEA 2PEOA 1ZOYC 1ZLLA 2JU2A 1JY2N 2JWDA 3MHVA 1MZ8A 3FXDA 1SQPK 2P9XA 1FOSF 2KNCA 2M8PA 3PRJA 2FQ1A 2M5AB 1FZBA 3M06A 3M9BA 1NJIQ 1RF0A 1JY3N 2E75D 2FYUJ 1N73B 3V2PA 1LTJA 4OH8B 1IC2A 2I1JA 2CNRA 3CX5D 4NPEA 1OVRA 4NEOA 5KP6B 4H2XC 2WPTA 3CX5I 2KIKA 1T8KA 1UNKA 2WMMA 1L0HA 3JC22 4RESB 3CC4P 4EDFA 1HJ0A 3B5NC 2WT7B 2GZFA 1LWUB 1HUCA 2MR7A 4GOEA 3GZLA 3BCCD 4I6MC 2KSJA 2KG9A 2OYHB 1NTKD 3GHGB 4RKUJ 2G8YA 2VLOA 2Q7CA 1W2EA 1VDFA 3PHLA 1PGQA 2O01N 3RK3E 2WSEJ 2KGDA 2NPSB 2RN0A 2L91A 3Q5PA 2N6YA 1FDIA 1CEIA 3OJAB 1FZCB 1VQ6P 2RMZA 1QRJA 3L72E 2M8NA 1GDTA 4XROA 2Y0EA 1BAJA 3MGNA 1N7SC 1M1KQ 2E5YA 3AEDC 5E79E 2PENA 3Q2YA 2FACA 3BCCE 1KYOE 2G3AA 1NQ4A 2ERHA 1VHNA 4HKGA 1SQVE 2AXTH 3H1JD 2FKWB 2W8ZA 3II6A 4H44C 4OGQC 1IMPA 1TU3F 3H1HD 1EZVG 1YJ9P 5HGMA 3CC7P 2KZJA 3H1LJ 2XZRA 1KC8Q 1SQQK 2KOQA 3U59A 2QVAA 3CL3D 2E75B 4JPZB 4WBAA 2YIUC 4RJTA 1OW8A 2AFEA 1KYOI 1SFCD 1U7JA 4EI2A 1NTZD 3NY7B 1PPJG 4TLFA 2XU6A 4COCA 3N7NA 3H1HJ 1G1IA 2NPSD 2N9BA 1Z6MA 1AF8A 1CSBA 1PFIA 2ZT9D 3B5NA 4UHPB 2H89C 1L0NK 3IN6A 1GL2A 3RGUA 2C9NY 3H47A 1Y8AA 4D6TG 2HPCA 3G26A 4LGDE 2FYUK 1BGYD 1VQ5P 3GG2A 1EDKA 3P32A 2FYNB 2Y9YA 3IAOA 2E74C 1ZW0A 1QEXA 1HWTC 1SQBG 5KAIH 2Q6QA 1VQ8P 1NKZB 2LMLA 5CCHD 2HLOA 4PXHB 1AQTA 5B66E 2VRSA 2JDIH 2N1TC 2W90A 5EW5E 3L4FA 1P84I 2JJLA 4XA4A 2KODA 1NU1J 5KKZB 3HE5A 3V5BA 3L75D 1PZQA 4K3AA 1EDJA 2FYZA 1SFCC 1YHQP 1L0NE 2LTEA 1NH4A 1RH5B 4L74A 2VLQA 1ACPA 3TSIA 2V4HA 1PPJE 2AEMA 3H1KD 1M74A 5HGOA 3KPEA 2EHTA 4PV1C 3RK2C 2HODA 1VF5B 5B5EH 3K5BA 2GZJA 2PEKA 3AE7C 1NAYA 3L72J 2OTKE 1L0LJ 5F2OA 1UIIA 2D2CB 1YJNP 1GPJA 3LRYA 3CWBE 4U3FJ 2FVEA 2BQ1E 5KKZC 1PGJA 1SQXG 3PP5A 1U57A 2NO8A 4AQRD 3L72D 4H13B 3KHUA 3SSUA 3FX0A 5AW9B 3HZQA 2FQ2A 2ROQA 3TGUJ 1EOQA 2WTYA 1NGMB 4KHXA 2A45I 2A45G 4R4LA 4C7RA 5BS2A 2Z4EA 2GDYA 4HYTB 1VQPP 2C0XA 1SQXD 1M90Q 3CWBD 3P05A 1PP9J 1KLPA 2GYKA 3C9IA 2QIWA 3Q5RA 1VL2A 1GW4A 4IFMA 1JNMA 2HPCB 1LGHB 4M0IA 2N1TA 1W5CE 2B88A 4HB1A 2AEJA 1HJBA 3OW2O 3AE6C 1SQBK 2ZT9C 3MTUE 2E42A 3CCJP 1AFOA 2KS1B 2ZXEB 2NRGA 2MY5A 1FZCC 3FXEA 5TISE 2Z45A 3DS1A 4GT1A 1Q82Q 2E76C 3G9RA 4QMAA 3P8MC 1MZ9A 2QJKB 2KG6A 3B4QA 3V4WA 5KJ7A 3G4SP 1BE3D 1P84D 2PEMA 3SWFA 1NYHA 1NTKK 2LKIA 4U7JA 2N98A 2KOSA 3VTPC 3RK2B 5KLVE 1Q90D 5KLIC 1LWUC 2IZ0A 5APWA 1BGYJ 2N1TD 2BCCJ 3RK3D 5KLVJ 1SQBD 3AEBC 4W7YA 1WRGA 1JMBA 1FZEA 2R44A 1R5LA 5APQA 1P84H 4XFZA 1E5WA 2JU1A 1M1JA 2J59M 4U0CA 3DS0A 2KS1A 1F80D 2LKMA 3IFMA 1DNYA 1BGYG 2WPRA 4NPFX 2OARA 3A0HH 5AVVB 2FBWC 2QJYC 2QM8A 5CJ4A 2NPSA 2WSEH 3EFGA 2PY8A 1VQ9P 2FQ0A 1L0LE 2K88A 3L73D 3HTKA 2LIWA 1SQXK 3BRTB 3VMXA 2M5AA 4BXLA 4HH2A 2OYIB 2K2QA 4UB8H 3CPWO 3A0BE 1CI6A 1S2EA 4I1LA 3TDKA 4U0BA 5KAFE 4COPA 4PD4I 3WUUA 4Y99B 1KILE 3NXSA 5CHXA 2H88C 1S5LE 3DS4A 2YXQB 2AVAA 1IO4A 4H13D 3CCRP 2ZXXA 3H1HG 2WSFH 5CCGA 1GXGA 1KB9D 3CMAP 1OWAA 4UB6H 1SQPJ 3M1MA 2ZJSE 2LXCB 3EFFK 3HYBA 2LPKA 3RBZA 2L22A 4IFDK 2WQYC 3DPHA 5AVZB 3MUDC 3AE1C 1KMIZ 1QVFO 5TJHA 2KNCB 4U3FD 1HVVA 3L74G 1YBKA 4H2YC 3R4YA 1K30A 2JGPA 4JYBA 2CGQA 3RL0g 1BSHA 3L75G 3QWOC 4OGQB 3G28A 4A7PA 2BEQD 3TGUD 2KZIA 2FXOA 4C46A 3WU2E 4W80A 1J2JB 1NU1E 2GZEA 5AVQB 3H1IJ 2V7QH 2BUOA 2LF4A 1KZUB 1UIXA 5APYA 2L9FA 3PJSK 3KZIH 3CXHI 3H1LE 1X8YA 3A5TA 2R3SA 1LT9C 5KLVK 1JY2P 1DEEG 1RO2A 2JP3A 3LMOA 1KD1Q 3PH0A 3H32B 2GM4A 1YITP 1H89A 1GMJA 3M0DC 1JO5A 3E2DA 3L71D 1P84E 4JF7A 1KILB 5L8RJ 3MP7B 2HYNA 1YQ4C 2UWJE 3W67A 1N7LA 2KXPB 1JY3P 3B5NB 3GHGC 2W6JH 2YO3A 2YNYA 3FWNA 1S5LX 3Q5SA 4AYCA 1DH3A 3IR9A 3BATA 1LNQA 1HF9A 1BXIA 1EZVI 1AVYA 4YXDC 2KYVA 2QM7A 2K92A 1S9KE 2DNWA 4WY4C 2EIAA 5APUA 2J58A 5DJUB 3TNUB 3KYQA 1LTTC 4D6TJ 2KORA 2LIUA 2O3JA 1MUUA 4GKGA 1GTWA 2Q1KA 2QEXP 3CLQA 2YKQA 1AQ5A 3AE2C 4F37A 3BASA 1OR5A 1ZMBA 4JQ0D 1M1JC 3GF7A 4XRQA 1IK9A 4OWFA 1M6EX 2GZIA 2K3RA 3CCLP 2K94A 2JB0A 1L0IA 3H1LG 1JUNA 1QVGO 3JCUH 5JPAA 5GTIH 2D2CC 5M1BA 3D6ZA 1NTME 3CCVP 2FXPA 3UIAA 3L73J 1Z56A 1NU1G 2E74B 1DX7A 3Q3DA 3RL0C 2YMYA 3T97A 1VQ7P 1L4AD 2B9BA 1L0NJ 5GTHH 4K35A 4PD4H 2PAJA 2K5XA 1MFZA 3TNUA 1VQ4P 3HD7B 1FC2C 1SQQG 3L75E 4B86A 2P67A 2QNWA 1OX3A 1M8OB 4DZOA 1IJDB 1NAFA 1SFCB 5H2FE 3G3ZA 3NTEA 2GUVA 4UB6E 2HODB 3GHGA 4PWVB 3G6EP 5KJ7D 2YXRB 4WWIA 4PJ0E 1CW5A 2X2BA 4GR2A 2JQ4A 3ITKA 4L73A 2IFMA 1L0NG 4O9BA 2YKOA 1UJZA 4N3YB 1OXZA 3FGAD 2ZVNB 3BCCG 2LR2A 1QL1A 3G0VA 1H0TA 2KGAA 2MKVA 4IL6X 2ITAA 3WUTA 1LP1A 4DT0A 2N9YB 3E1IA 2K0DX 3CE7A 3EJDA 2XKMA 3HE4A 3CXHH 1NTKJ 2PGDA 1J1DC 3SFEC 3LIDA 4U0AA 4ASVA 1PL5A 1IFNA 2RH0A 1VF5D 2JYGA 3H1HE 1RF0C 4PV1D 7CEIA 3GW6A 1GL2B 3D70A 2E1MA 3AE4C 4KT0J 1K73Q 1RQUA 2FYUE 3Q1MA 2QJPB 1NTZG 5AVRB 4IFFA 2M5RA 4WY4D 2CPSA 2KGCA 1LTIC 4H0LC 1HH0A 4C7NB 3O6QB 3A3YB 2MVVA 2DGYA 1NHLA 3HD7D 1FS0E 1G2CA 5TISH 2BCCD 3U43A 3H1JE 4PH1A 2LL8A 3G29A 1KYOH 2FHSC 1EZVD 5DCKA 3L37A 5C39A 1KILA 1FJPA 1IZNB 3S4RA 1YYCA 1OZHA 1YQ3C 3H1LD 1LWUA 4Z1MH 1S3JA 2J5UA 3H1KJ 5B66H 3SWYA 1NTZE 3MUDA 2D2CD 2A06E 2QE7H 3M9QA 2MD9A 3CC2P 4I2LC 1N7SB 4OVNF 2BCCG 5KLVD 2AFDA 2Q3EA 3VMYA 5AVWB 1LTAC 3LW5J 2WPSA 1RE3C 1OMIA 1FZGA 1SQBJ 1GZLA 2ZYGA 3H1JJ 3V4QA 2A06D 1N73A 4N78E 2WSCH 3MD0A 1SLQA 1J1DB 4OGQD 3HTKB 2KLUA 1USDA 2Z46A 2JKVA 3WUVA 4YTPC 1GU5A 5KP7B 2L5GB 1DD4A 1URQA 1FAVA 4EYYQ 1QLED 2Q3IA 2KGEA 3L73G 4WVZA 1M1JB 5HGLA 1LT1A 2IDBA 2IPPA 4DJGA 1JOCA 5HGNA 5AW1B 1LTBC 1RE4A 1R8EA 5CMZA 5EJDA 1SVFA 3P8CE 3CCUP 2JO1A 1QL2A 5CBNA 2FFDC 3L35A 3GLMA 2OYHA 2QG4A 3KDPB 3MGEA 1WMKA 3S1KA 1Y9BA 2I1KA 1GW3A 3BRVB 3CXHE 1EQ7A 2W6BA 1MV8A 3RL0B 2MJZA 5CCGD 1ZRTD 2CQ8A 3TGUG 4N6JA 3F89A 1SQQE 4H2WC 2XV6A 1YTZT 4QNBA 1J1EC 1NOHA 3H4EA 1T2KD 5HVCA 3BVHA 1T3JA 2XXMA 1NKNA 3WMM0 1SQXJ 1ZR4A 1OVUA 1IFDA 1CI6B 1IMQA 3AEEC 2OYIA 3B4SA 4WY4A 3ZDMA 2OYIC 2H8PD 3GKLC 1RF1A 4LC1A 3L70D 1KTMA 3L74D 2NZ2A 2OTLP 1QGKB 1SQQD 2L4BA 2ZT9B 1KN7A 4DG9A 1EXIA 4W7ZA 5AVSB 3OAKA 1OW6A 3JCUE 3VN0A 1AJYA 4PH0A 3CXHD 1IFMA 1SQVK 1A02J 2N50A 1E6JP 1ZRTE 1ZNVA 4GDOA 1AA0A 3Q20A 2WPQA 2PEIA 4HJGH 1W2BO 1JCDA 3L73E 1DV5A 2FY8A 1IUQA 3P8CD 1KQSO 1M6NA 3CI9A 1EC5A 3D6YA 5AW2B 5GTHE 2PP6A 3VYIA 3AECC 2P7JA 3KZIE 3D71A 2E43A 3B8EB 1LT9B 1NO4A 1SFCA 1YIJP 1SQPD 2CWOA 1D1DA 2LXBA 3O6QA 1SQBE 2B89A 1K9MQ 4L75A 4ASWA 1NTMD 1BE3E 2AF8A 2GA1A 3A7OA 2IX7C 2KOPA 3CWBJ 2GZGA 1VQKP 1URQD 3VMAA 4D6TE 4DCKA 1URQB 4IZ6A 1FDOA 5KTBA 1GU4A 1YJWP 2B87B 1M56D 2WSCJ 3HE5B 4PD4D 2HG5D 2ZYDA 2FYUD 2EG5A 3L71G 4R0MA 2LOLA
chains in the Genus database with same CATH topology
2PEOA 1VQ6P 1K30A 1QRJA 2M8NA 2OARA 1VQPP 1JJ2O 1VQ8P 4XROA 1BAJA 2EFJA 1M90Q 1ZMBA 1M1KQ 2P9XA 4U0AA 3P05A 2PY8A 4PH0A 4XRQA 1VQ9P 2M8PA 1M6EX 2PENA 3CCLP 4U0EA 2Z46A 3CCEP 3G1GA 2JYLA 2JYGA 3G28A 1QVGO 3B5IA 3DS5A 1E6JP 5JPAA 1S72P 1NJIQ 4M0IA 3CCVP 3CPWO 2XT1A 1VQLP 1A8OA 1Q86Q 3CXCO 2E1MA 3VRLC 3Q20A 1K73Q 2BUOA 4U0FA 2LF4A 3OW2O 2PEIA 5HGLA 1VQOP 1PEOA 2KODA 5F2NA 1W2BO 1VQ7P 3DS2A 3G1IA 5HGNA 4U0BA 3CCJP 1YJ9P 1RNIA 4IPYA 4COPA 5HGMA 2L6EA 3CC7P 1IUQA 2Z45A 1KQSO 1M6NA 3DS1A 1RO2A 2QA4P 1Q82Q 1VQ4P 3CCUP 1YHQP 3CMEP 1KD1Q 1K8AQ 4XFYA 3DS3A 1KC8Q 2M8LA 3DS4A 5BS1A 1YITP 2DGYA 3E2DA 4WYMA 1A43A 2Z44A 3CCRP 3MGEA 3NTEA 4GR6A 1M74A 2OTJP 5HGOA 3CC4P 5I4TG 3G4SP 3G6EP 1YIJP 1AUMA 2PEMA 1RO0A 2CWOA 4PH1A 1D1DA 1PEUA 3G29A 1K9MQ 5DCKA 4COCA 4XFXA 4GR2A 3CCSP 4U0DA 1Q7YQ 3CD6P 1VQMP 2PEKA 3CMAP 3RG6C 2XV6A 3M1MA 4QNBA 1N8RQ 1VQKP 5F2OA 3H4EA 1YJNP 5F2KA 1PEMA 3LRYA 2EIAA 3H47A 3I55P 2XXMA 3HYBA 2BQ1E 1YJWP 3G0VA 3DTJA 3G26A 2JO0A 3G21A 2ONTA 3G71P 3H0DA 1VQ5P 3CC2P 3DPHA 3HZQA 1Q81Q 1VQNP 1YI2P 1QVFO 2PEQA 2PEJA 3WBHA 2BHVA 3CCQP 1EOQA 2QEXP 4XFZA 1PEQA 1EIAA 2EG5A 4U0CA 3DS0A 2OTLP 3I56P 3CCMP 5BS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT P;  1VQ6 P;  1YJN P;  1VQL P;  1Q86 Q;  3CXC O;  3I55 P;  1K73 Q;  3CCR P;  1VQP P;  1VQ8 P;  1JJ2 O;  3OW2 O;  1YJW P;  1VQO P;  2OTJ P;  1M90 Q;  3CC4 P;  3G4S P;  1M1K Q;  3G6E P;  1YIJ P;  1W2B O;  1VQ7 P;  3G71 P;  1VQ5 P;  3CCJ P;  1K9M Q;  1VQ9 P;  1YJ9 P;  3CC2 P;  3CCL P;  1VQN P;  1Q81 Q;  3CCE P;  1YI2 P;  1QVF O;  3CC7 P;  3CCS P;  3CCQ P;  1QVG O;  1KQS O;  2QEX P;  1Q7Y Q;  2QA4 P;  1Q82 Q;  1VQ4 P;  1VQM P;  3CCU P;  1YHQ P;  1S72 P;  1KD1 Q;  3CME P;  3CD6 P;  3CMA P;  1K8A Q;  1NJI Q;  2OTL P;  3I56 P;  3CCV P;  3CCM P;  1N8R Q;  1VQK P;  3CPW O;  1KC8 Q; 
#chains in the Genus database with same CATH topology
 4ZKP A;  3PTZ A;  4TT3 H;  5DJT B;  2IBZ E;  2KI7 B;  4BRY B;  1BDC A;  3CX5 E;  3LIE A;  1EDI A;  1HBW A;  4U0E A;  1IFP A;  2GDW A;  3CCE P;  2FAD A;  1HTL C;  3G1G A;  2KB7 P;  3B5I A;  2HR3 A;  1S72 P;  1LP1 B;  1RQV A;  1EZV E;  1KFN A;  2RKL A;  1FZA A;  1VQL P;  2KLV A;  5BU8 B;  2H7H A;  2IFN A;  2B87 A;  1EDL A;  3MIW A;  2QJY B;  1VQO P;  1LTS C;  4AUW A;  3IF4 A;  1S9K D;  5H2F H;  2KWL A;  3A2A A;  2FYU G;  3CX5 H;  4H0L D;  3USS A;  3DS3 A;  1USE A;  3HD7 C;  3VMZ A;  2Z44 A;  1JCC A;  4U3F G;  2ZYA A;  1FBM A;  4BWN A;  1PEU A;  3KXD A;  1KIL C;  1IFI A;  3F5H A;  5APT A;  2CPB A;  5APX A;  4YPC A;  1U7M A;  2SPZ A;  3RK3 C;  3CD6 P;  1EMV A;  1BCC E;  1L4A C;  1FDM A;  1N8R Q;  2FXM A;  1JM0 A;  3RBX A;  1FOS E;  1IFJ A;  2K1A A;  4CPG A;  3G21 A;  3HUS C;  1ZR2 A;  1KYO D;  1HGV A;  3HUS A;  4IL6 H;  4DOJ A;  2WZ7 A;  3R2P A;  1KB9 I;  3E7K A;  5CCH A;  2AXC A;  1KQF B;  4U3F E;  2MF4 A;  1LTJ B;  1SQQ J;  4WB4 A;  2FVF A;  1AV1 A;  2MVU A;  1Y47 A;  1X3O A;  1NTZ K;  1JTH A;  2CG5 B;  2Y0C A;  3GF3 A;  4WY4 B;  1LTJ C;  3U1A A;  4R4M A;  2E5T A;  3EJE A;  3V2Q A;  1FZC A;  2R32 A;  4EOT A;  2K9J A;  4U0F A;  1JMM A;  4H13 C;  1K05 A;  3TYY A;  4ZKU A;  1EXJ A;  3CME P;  1AYI A;  1GK6 A;  1L4A B;  2K9Y A;  3OA7 A;  3VOP A;  4WYM A;  2E76 B;  1VF5 C;  4RO0 A;  3RK3 B;  4JYC A;  1R5S A;  2IYP A;  3H1I E;  2YIU B;  5I4T G;  3RG2 A;  3AE3 C;  2DW3 A;  2P58 A;  1BDD A;  5HV8 A;  3H32 A;  2HFE D;  3KQG A;  3RK2 D;  1J1E B;  3T97 B;  4GIF A;  5E79 H;  2PRR A;  2R5B A;  1FZF A;  1YTZ I;  4L76 A;  3V6I A;  2JAZ A;  1DD3 A;  3H6P A;  4XFJ A;  2Q5U A;  3H0D A;  3VP8 A;  1BE3 G;  1VQN P;  5BVZ A;  2BHV A;  2FFD B;  2JWA A;  2YKP A;  4NPD A;  2XZ0 D;  2WWW A;  1KB9 E;  1OW7 A;  1HY8 A;  5KP8 B;  2K9J B;  4D6T D;  1NVO A;  1MFT A;  3V2R A;  3WU2 H;  1ZME C;  2AXT E;  4M3L A;  3AE8 C;  3B5N D;  2NPS C;  2XT1 A;  1PIX A;  1KIL D;  1S4X A;  2MR8 A;  1L0L K;  1SQP G;  4PJ0 H;  2BEZ F;  1PEO A;  4PV1 B;  3U1C A;  3V2N A;  2A06 G;  1FR2 A;  5KAI E;  1GD2 E;  4MN4 C;  5AW0 B;  3AEG C;  3CWB G;  5AW7 B;  3A0H E;  2K93 A;  2L6E A;  2IZ1 A;  2A45 H;  1E0H A;  5KLI B;  2QA4 P;  3H1I G;  1LT9 A;  1G1J A;  2P2U A;  4MRT C;  3AE9 C;  1VKU A;  2E74 D;  1WT6 A;  2M8L A;  5BS1 A;  2WT7 A;  4QKO A;  1AVO A;  2M8R A;  4PD4 E;  2O1J A;  3H1J G;  4C7N A;  2E76 D;  2GDX A;  1CZQ A;  3TGU E;  4XFX A;  1NTZ J;  1PGP A;  2QJK C;  3JSV C;  3L74 J;  2OQQ A;  1L2P A;  4LLH A;  2W6A A;  1PEM A;  1VPC A;  3I55 P;  2OGU A;  2IYO A;  1RY3 A;  2O1K A;  2JO0 A;  1BE3 J;  5K5G B;  1L4A A;  1SQP E;  5AVT B;  2Z5H A;  3L74 E;  1YI2 P;  1FE6 A;  4H44 D;  4H44 B;  1SQV G;  3H1K G;  2K0X A;  1PEQ A;  1EIA A;  1N2D C;  3AEA C;  2Z5I A;  2P10 A;  3CCM P;  1MKM A;  2WSF J;  3M0A A;  4JBZ A;  1LTG C;  3O8Z A;  1N7S A;  2K0Y A;  1KQL A;  1A02 F;  2KSE A;  2JYL A;  2WPV B;  1D7M A;  3DS5 A;  3AEF C;  1JTH B;  2FYN C;  1E79 H;  5CZD B;  3NFQ A;  2O01 H;  5AW6 B;  3BCC J;  4Y28 J;  3RL0 D;  3HE4 B;  2KW2 A;  2N6Z A;  1XTG B;  1ZP0 C;  3L36 A;  2VLN A;  5AW8 B;  1HQB A;  2W83 C;  2OYH C;  1K8A Q;  3B71 A;  2KOO A;  2R3C A;  1RE4 C;  3EWK A;  1M7L A;  3I5C A;  3M91 A;  2N5I A;  4YXW H;  5KJ7 C;  2H43 A;  1L0L G;  3NTN A;  1S1C X;  1SS1 A;  1L0N D;  2QSI A;  2AEF A;  3CCS P;  4H0L B;  5APS A;  3VP9 A;  1Q7Y Q;  2FVA A;  1NU1 K;  1ZN5 A;  1N86 A;  1PP9 E;  2PNG A;  4GOF A;  1K04 A;  3C1L A;  5CBO A;  3TF5 A;  5F2K A;  5B5E E;  5AVX B;  2IBZ G;  1BGY E;  3N4X A;  4BPH A;  3DTJ A;  1M57 D;  2PFX A;  2ZVO B;  5AW3 B;  1Q81 Q;  2PEQ A;  1N73 C;  3WBH A;  1GL2 C;  1PV3 A;  1BCC D;  2C0W A;  2CK3 H;  2FAE A;  1FU1 A;  1LJ2 A;  1NTM K;  5KLV G;  1RF1 C;  1PP9 G;  1KQG B;  3L75 J;  2EFJ A;  1N7S D;  2O01 J;  3S9O A;  1OFC X;  3A0B H;  1GXH A;  3HUS B;  1JEK A;  2JBG A;  3L72 G;  1FJK A;  2WIT A;  1JY3 O;  2V7Q J;  1ZXG A;  5APV A;  2VLP A;  1T2K C;  4EIJ A;  3AE5 C;  2Y0D A;  3GZM A;  1BSN A;  2EHS A;  5AW4 B;  1A8O A;  1Q86 Q;  3QH9 A;  2C9L Y;  2KUB A;  1KFM A;  4CA3 A;  1JY2 O;  1RHZ B;  3G1I A;  2GUS A;  4GOD A;  1RNI A;  4IPY A;  1PP9 D;  4UB8 E;  1RF1 B;  4N78 D;  3FWL A;  2KK7 A;  2WSS H;  3MZW B;  1BCC G;  3M0D A;  2VSQ A;  4XFY A;  2OYO A;  2K37 A;  2L0Q A;  3L70 G;  2IBZ I;  5KAF H;  2M3B A;  3GMA A;  3L71 J;  3LW5 H;  2N5H A;  2XDJ A;  1AUM A;  1RO0 A;  2IBZ D;  1H88 A;  4XE5 B;  3TK1 A;  2E75 C;  5AW5 B;  2KR5 A;  4HKZ H;  2ZAE B;  1VQM P;  3H1K E;  1NTK G;  2YO2 A;  1GL2 D;  2N1T B;  1OIP A;  1L0L D;  2M0B A;  1ZV8 A;  1T8Z A;  2BAS A;  1SQX E;  3SFD C;  2W27 A;  2KOG A;  3EJB A;  4BPF A;  3L70 J;  3EQ2 A;  2ONT A;  1S5L H;  4ZNC A;  1BCC J;  3ABV C;  2PEJ A;  3W68 A;  3CCQ P;  1KB9 H;  1KOR A;  4KJM A;  1XTC C;  1JJ2 O;  1GK4 A;  4IL6 E;  4I7Z B;  5CCH C;  1T3U A;  2Y9Z A;  3GJN A;  3SWK A;  1QX8 A;  1URQ C;  1HGZ A;  1H0T B;  4BRY A;  2YMK A;  3L71 E;  5BU5 A;  3CXC O;  3VRL C;  1X22 A;  3P7K A;  1IK7 A;  1NTM G;  4I7Z C;  1PPJ D;  5F2N A;  3NMD A;  2I8D A;  3DS2 A;  1T6A A;  1SP4 A;  5AVU B;  2FFD A;  2POH A;  2P1J A;  3M9H A;  1X9V A;  2KP8 A;  1SQV D;  2JR8 A;  3E1R A;  1NTK E;  1DEB A;  2XNX A;  5AVY B;  3H25 A;  1DIP A;  1A43 A;  1NTM J;  4GR6 A;  2XV5 A;  3PLN A;  2OTJ P;  3HD7 A;  1SQV J;  1NU1 D;  1X79 B;  1JB0 J;  1PGO A;  1Q2N A;  3L70 E;  5CCG C;  4U0D A;  2QRX A;  2Q9I A;  3RG6 C;  5CJ0 A;  4BPG A;  2WVR A;  2XND H;  5GTI E;  4ZMD A;  2ZFC A;  5EFW B;  1G2C B;  2KG8 A;  3C8V A;  2QJP C;  1H8A A;  1X0T A;  3G71 P;  2R5D A;  1NWQ A;  2XZ1 C;  1KV4 A;  2BCC E;  3HRN A;  1RE3 A;  3H1I D;  4Y99 C;  2M3E A;  1OVV A;  4IOI H;  3I56 P;  2JEE A;  2PEO A;  1ZOY C;  1ZLL A;  2JU2 A;  1JY2 N;  2JWD A;  3MHV A;  1MZ8 A;  3FXD A;  1SQP K;  2P9X A;  1FOS F;  2KNC A;  2M8P A;  3PRJ A;  2FQ1 A;  2M5A B;  1FZB A;  3M06 A;  3M9B A;  1NJI Q;  1RF0 A;  1JY3 N;  2E75 D;  2FYU J;  1N73 B;  3V2P A;  1LTJ A;  4OH8 B;  1IC2 A;  2I1J A;  2CNR A;  3CX5 D;  4NPE A;  1OVR A;  4NEO A;  5KP6 B;  4H2X C;  2WPT A;  3CX5 I;  2KIK A;  1T8K A;  1UNK A;  2WMM A;  1L0H A;  3JC2 2;  4RES B;  3CC4 P;  4EDF A;  1HJ0 A;  3B5N C;  2WT7 B;  2GZF A;  1LWU B;  1HUC A;  2MR7 A;  4GOE A;  3GZL A;  3BCC D;  4I6M C;  2KSJ A;  2KG9 A;  2OYH B;  1NTK D;  3GHG B;  4RKU J;  2G8Y A;  2VLO A;  2Q7C A;  1W2E A;  1VDF A;  3PHL A;  1PGQ A;  2O01 N;  3RK3 E;  2WSE J;  2KGD A;  2NPS B;  2RN0 A;  2L91 A;  3Q5P A;  2N6Y A;  1FDI A;  1CEI A;  3OJA B;  1FZC B;  1VQ6 P;  2RMZ A;  1QRJ A;  3L72 E;  2M8N A;  1GDT A;  4XRO A;  2Y0E A;  1BAJ A;  3MGN A;  1N7S C;  1M1K Q;  2E5Y A;  3AED C;  5E79 E;  2PEN A;  3Q2Y A;  2FAC A;  3BCC E;  1KYO E;  2G3A A;  1NQ4 A;  2ERH A;  1VHN A;  4HKG A;  1SQV E;  2AXT H;  3H1J D;  2FKW B;  2W8Z A;  3II6 A;  4H44 C;  4OGQ C;  1IMP A;  1TU3 F;  3H1H D;  1EZV G;  1YJ9 P;  5HGM A;  3CC7 P;  2KZJ A;  3H1L J;  2XZR A;  1KC8 Q;  1SQQ K;  2KOQ A;  3U59 A;  2QVA A;  3CL3 D;  2E75 B;  4JPZ B;  4WBA A;  2YIU C;  4RJT A;  1OW8 A;  2AFE A;  1KYO I;  1SFC D;  1U7J A;  4EI2 A;  1NTZ D;  3NY7 B;  1PPJ G;  4TLF A;  2XU6 A;  4COC A;  3N7N A;  3H1H J;  1G1I A;  2NPS D;  2N9B A;  1Z6M A;  1AF8 A;  1CSB A;  1PFI A;  2ZT9 D;  3B5N A;  4UHP B;  2H89 C;  1L0N K;  3IN6 A;  1GL2 A;  3RGU A;  2C9N Y;  3H47 A;  1Y8A A;  4D6T G;  2HPC A;  3G26 A;  4LGD E;  2FYU K;  1BGY D;  1VQ5 P;  3GG2 A;  1EDK A;  3P32 A;  2FYN B;  2Y9Y A;  3IAO A;  2E74 C;  1ZW0 A;  1QEX A;  1HWT C;  1SQB G;  5KAI H;  2Q6Q A;  1VQ8 P;  1NKZ B;  2LML A;  5CCH D;  2HLO A;  4PXH B;  1AQT A;  5B66 E;  2VRS A;  2JDI H;  2N1T C;  2W90 A;  5EW5 E;  3L4F A;  1P84 I;  2JJL A;  4XA4 A;  2KOD A;  1NU1 J;  5KKZ B;  3HE5 A;  3V5B A;  3L75 D;  1PZQ A;  4K3A A;  1EDJ A;  2FYZ A;  1SFC C;  1YHQ P;  1L0N E;  2LTE A;  1NH4 A;  1RH5 B;  4L74 A;  2VLQ A;  1ACP A;  3TSI A;  2V4H A;  1PPJ E;  2AEM A;  3H1K D;  1M74 A;  5HGO A;  3KPE A;  2EHT A;  4PV1 C;  3RK2 C;  2HOD A;  1VF5 B;  5B5E H;  3K5B A;  2GZJ A;  2PEK A;  3AE7 C;  1NAY A;  3L72 J;  2OTK E;  1L0L J;  5F2O A;  1UII A;  2D2C B;  1YJN P;  1GPJ A;  3LRY A;  3CWB E;  4U3F J;  2FVE A;  2BQ1 E;  5KKZ C;  1PGJ A;  1SQX G;  3PP5 A;  1U57 A;  2NO8 A;  4AQR D;  3L72 D;  4H13 B;  3KHU A;  3SSU A;  3FX0 A;  5AW9 B;  3HZQ A;  2FQ2 A;  2ROQ A;  3TGU J;  1EOQ A;  2WTY A;  1NGM B;  4KHX A;  2A45 I;  2A45 G;  4R4L A;  4C7R A;  5BS2 A;  2Z4E A;  2GDY A;  4HYT B;  1VQP P;  2C0X A;  1SQX D;  1M90 Q;  3CWB D;  3P05 A;  1PP9 J;  1KLP A;  2GYK A;  3C9I A;  2QIW A;  3Q5R A;  1VL2 A;  1GW4 A;  4IFM A;  1JNM A;  2HPC B;  1LGH B;  4M0I A;  2N1T A;  1W5C E;  2B88 A;  4HB1 A;  2AEJ A;  1HJB A;  3OW2 O;  3AE6 C;  1SQB K;  2ZT9 C;  3MTU E;  2E42 A;  3CCJ P;  1AFO A;  2KS1 B;  2ZXE B;  2NRG A;  2MY5 A;  1FZC C;  3FXE A;  5TIS E;  2Z45 A;  3DS1 A;  4GT1 A;  1Q82 Q;  2E76 C;  3G9R A;  4QMA A;  3P8M C;  1MZ9 A;  2QJK B;  2KG6 A;  3B4Q A;  3V4W A;  5KJ7 A;  3G4S P;  1BE3 D;  1P84 D;  2PEM A;  3SWF A;  1NYH A;  1NTK K;  2LKI A;  4U7J A;  2N98 A;  2KOS A;  3VTP C;  3RK2 B;  5KLV E;  1Q90 D;  5KLI C;  1LWU C;  2IZ0 A;  5APW A;  1BGY J;  2N1T D;  2BCC J;  3RK3 D;  5KLV J;  1SQB D;  3AEB C;  4W7Y A;  1WRG A;  1JMB A;  1FZE A;  2R44 A;  1R5L A;  5APQ A;  1P84 H;  4XFZ A;  1E5W A;  2JU1 A;  1M1J A;  2J59 M;  4U0C A;  3DS0 A;  2KS1 A;  1F80 D;  2LKM A;  3IFM A;  1DNY A;  1BGY G;  2WPR A;  4NPF X;  2OAR A;  3A0H H;  5AVV B;  2FBW C;  2QJY C;  2QM8 A;  5CJ4 A;  2NPS A;  2WSE H;  3EFG A;  2PY8 A;  1VQ9 P;  2FQ0 A;  1L0L E;  2K88 A;  3L73 D;  3HTK A;  2LIW A;  1SQX K;  3BRT B;  3VMX A;  2M5A A;  4BXL A;  4HH2 A;  2OYI B;  2K2Q A;  4UB8 H;  3CPW O;  3A0B E;  1CI6 A;  1S2E A;  4I1L A;  3TDK A;  4U0B A;  5KAF E;  4COP A;  4PD4 I;  3WUU A;  4Y99 B;  1KIL E;  3NXS A;  5CHX A;  2H88 C;  1S5L E;  3DS4 A;  2YXQ B;  2AVA A;  1IO4 A;  4H13 D;  3CCR P;  2ZXX A;  3H1H G;  2WSF H;  5CCG A;  1GXG A;  1KB9 D;  3CMA P;  1OWA A;  4UB6 H;  1SQP J;  3M1M A;  2ZJS E;  2LXC B;  3EFF K;  3HYB A;  2LPK A;  3RBZ A;  2L22 A;  4IFD K;  2WQY C;  3DPH A;  5AVZ B;  3MUD C;  3AE1 C;  1KMI Z;  1QVF O;  5TJH A;  2KNC B;  4U3F D;  1HVV A;  3L74 G;  1YBK A;  4H2Y C;  3R4Y A;  1K30 A;  2JGP A;  4JYB A;  2CGQ A;  3RL0 g;  1BSH A;  3L75 G;  3QWO C;  4OGQ B;  3G28 A;  4A7P A;  2BEQ D;  3TGU D;  2KZI A;  2FXO A;  4C46 A;  3WU2 E;  4W80 A;  1J2J B;  1NU1 E;  2GZE A;  5AVQ B;  3H1I J;  2V7Q H;  2BUO A;  2LF4 A;  1KZU B;  1UIX A;  5APY A;  2L9F A;  3PJS K;  3KZI H;  3CXH I;  3H1L E;  1X8Y A;  3A5T A;  2R3S A;  1LT9 C;  5KLV K;  1JY2 P;  1DEE G;  1RO2 A;  2JP3 A;  3LMO A;  1KD1 Q;  3PH0 A;  3H32 B;  2GM4 A;  1YIT P;  1H89 A;  1GMJ A;  3M0D C;  1JO5 A;  3E2D A;  3L71 D;  1P84 E;  4JF7 A;  1KIL B;  5L8R J;  3MP7 B;  2HYN A;  1YQ4 C;  2UWJ E;  3W67 A;  1N7L A;  2KXP B;  1JY3 P;  3B5N B;  3GHG C;  2W6J H;  2YO3 A;  2YNY A;  3FWN A;  1S5L X;  3Q5S A;  4AYC A;  1DH3 A;  3IR9 A;  3BAT A;  1LNQ A;  1HF9 A;  1BXI A;  1EZV I;  1AVY A;  4YXD C;  2KYV A;  2QM7 A;  2K92 A;  1S9K E;  2DNW A;  4WY4 C;  2EIA A;  5APU A;  2J58 A;  5DJU B;  3TNU B;  3KYQ A;  1LTT C;  4D6T J;  2KOR A;  2LIU A;  2O3J A;  1MUU A;  4GKG A;  1GTW A;  2Q1K A;  2QEX P;  3CLQ A;  2YKQ A;  1AQ5 A;  3AE2 C;  4F37 A;  3BAS A;  1OR5 A;  1ZMB A;  4JQ0 D;  1M1J C;  3GF7 A;  4XRQ A;  1IK9 A;  4OWF A;  1M6E X;  2GZI A;  2K3R A;  3CCL P;  2K94 A;  2JB0 A;  1L0I A;  3H1L G;  1JUN A;  1QVG O;  3JCU H;  5JPA A;  5GTI H;  2D2C C;  5M1B A;  3D6Z A;  1NTM E;  3CCV P;  2FXP A;  3UIA A;  3L73 J;  1Z56 A;  1NU1 G;  2E74 B;  1DX7 A;  3Q3D A;  3RL0 C;  2YMY A;  3T97 A;  1VQ7 P;  1L4A D;  2B9B A;  1L0N J;  5GTH H;  4K35 A;  4PD4 H;  2PAJ A;  2K5X A;  1MFZ A;  3TNU A;  1VQ4 P;  3HD7 B;  1FC2 C;  1SQQ G;  3L75 E;  4B86 A;  2P67 A;  2QNW A;  1OX3 A;  1M8O B;  4DZO A;  1IJD B;  1NAF A;  1SFC B;  5H2F E;  3G3Z A;  3NTE A;  2GUV A;  4UB6 E;  2HOD B;  3GHG A;  4PWV B;  3G6E P;  5KJ7 D;  2YXR B;  4WWI A;  4PJ0 E;  1CW5 A;  2X2B A;  4GR2 A;  2JQ4 A;  3ITK A;  4L73 A;  2IFM A;  1L0N G;  4O9B A;  2YKO A;  1UJZ A;  4N3Y B;  1OXZ A;  3FGA D;  2ZVN B;  3BCC G;  2LR2 A;  1QL1 A;  3G0V A;  1H0T A;  2KGA A;  2MKV A;  4IL6 X;  2ITA A;  3WUT A;  1LP1 A;  4DT0 A;  2N9Y B;  3E1I A;  2K0D X;  3CE7 A;  3EJD A;  2XKM A;  3HE4 A;  3CXH H;  1NTK J;  2PGD A;  1J1D C;  3SFE C;  3LID A;  4U0A A;  4ASV A;  1PL5 A;  1IFN A;  2RH0 A;  1VF5 D;  2JYG A;  3H1H E;  1RF0 C;  4PV1 D;  7CEI A;  3GW6 A;  1GL2 B;  3D70 A;  2E1M A;  3AE4 C;  4KT0 J;  1K73 Q;  1RQU A;  2FYU E;  3Q1M A;  2QJP B;  1NTZ G;  5AVR B;  4IFF A;  2M5R A;  4WY4 D;  2CPS A;  2KGC A;  1LTI C;  4H0L C;  1HH0 A;  4C7N B;  3O6Q B;  3A3Y B;  2MVV A;  2DGY A;  1NHL A;  3HD7 D;  1FS0 E;  1G2C A;  5TIS H;  2BCC D;  3U43 A;  3H1J E;  4PH1 A;  2LL8 A;  3G29 A;  1KYO H;  2FHS C;  1EZV D;  5DCK A;  3L37 A;  5C39 A;  1KIL A;  1FJP A;  1IZN B;  3S4R A;  1YYC A;  1OZH A;  1YQ3 C;  3H1L D;  1LWU A;  4Z1M H;  1S3J A;  2J5U A;  3H1K J;  5B66 H;  3SWY A;  1NTZ E;  3MUD A;  2D2C D;  2A06 E;  2QE7 H;  3M9Q A;  2MD9 A;  3CC2 P;  4I2L C;  1N7S B;  4OVN F;  2BCC G;  5KLV D;  2AFD A;  2Q3E A;  3VMY A;  5AVW B;  1LTA C;  3LW5 J;  2WPS A;  1RE3 C;  1OMI A;  1FZG A;  1SQB J;  1GZL A;  2ZYG A;  3H1J J;  3V4Q A;  2A06 D;  1N73 A;  4N78 E;  2WSC H;  3MD0 A;  1SLQ A;  1J1D B;  4OGQ D;  3HTK B;  2KLU A;  1USD A;  2Z46 A;  2JKV A;  3WUV A;  4YTP C;  1GU5 A;  5KP7 B;  2L5G B;  1DD4 A;  1URQ A;  1FAV A;  4EYY Q;  1QLE D;  2Q3I A;  2KGE A;  3L73 G;  4WVZ A;  1M1J B;  5HGL A;  1LT1 A;  2IDB A;  2IPP A;  4DJG A;  1JOC A;  5HGN A;  5AW1 B;  1LTB C;  1RE4 A;  1R8E A;  5CMZ A;  5EJD A;  1SVF A;  3P8C E;  3CCU P;  2JO1 A;  1QL2 A;  5CBN A;  2FFD C;  3L35 A;  3GLM A;  2OYH A;  2QG4 A;  3KDP B;  3MGE A;  1WMK A;  3S1K A;  1Y9B A;  2I1K A;  1GW3 A;  3BRV B;  3CXH E;  1EQ7 A;  2W6B A;  1MV8 A;  3RL0 B;  2MJZ A;  5CCG D;  1ZRT D;  2CQ8 A;  3TGU G;  4N6J A;  3F89 A;  1SQQ E;  4H2W C;  2XV6 A;  1YTZ T;  4QNB A;  1J1E C;  1NOH A;  3H4E A;  1T2K D;  5HVC A;  3BVH A;  1T3J A;  2XXM A;  1NKN A;  3WMM 0;  1SQX J;  1ZR4 A;  1OVU A;  1IFD A;  1CI6 B;  1IMQ A;  3AEE C;  2OYI A;  3B4S A;  4WY4 A;  3ZDM A;  2OYI C;  2H8P D;  3GKL C;  1RF1 A;  4LC1 A;  3L70 D;  1KTM A;  3L74 D;  2NZ2 A;  2OTL P;  1QGK B;  1SQQ D;  2L4B A;  2ZT9 B;  1KN7 A;  4DG9 A;  1EXI A;  4W7Z A;  5AVS B;  3OAK A;  1OW6 A;  3JCU E;  3VN0 A;  1AJY A;  4PH0 A;  3CXH D;  1IFM A;  1SQV K;  1A02 J;  2N50 A;  1E6J P;  1ZRT E;  1ZNV A;  4GDO A;  1AA0 A;  3Q20 A;  2WPQ A;  2PEI A;  4HJG H;  1W2B O;  1JCD A;  3L73 E;  1DV5 A;  2FY8 A;  1IUQ A;  3P8C D;  1KQS O;  1M6N A;  3CI9 A;  1EC5 A;  3D6Y A;  5AW2 B;  5GTH E;  2PP6 A;  3VYI A;  3AEC C;  2P7J A;  3KZI E;  3D71 A;  2E43 A;  3B8E B;  1LT9 B;  1NO4 A;  1SFC A;  1YIJ P;  1SQP D;  2CWO A;  1D1D A;  2LXB A;  3O6Q A;  1SQB E;  2B89 A;  1K9M Q;  4L75 A;  4ASW A;  1NTM D;  1BE3 E;  2AF8 A;  2GA1 A;  3A7O A;  2IX7 C;  2KOP A;  3CWB J;  2GZG A;  1VQK P;  1URQ D;  3VMA A;  4D6T E;  4DCK A;  1URQ B;  4IZ6 A;  1FDO A;  5KTB A;  1GU4 A;  1YJW P;  2B87 B;  1M56 D;  2WSC J;  3HE5 B;  4PD4 D;  2HG5 D;  2ZYD A;  2FYU D;  2EG5 A;  3L71 G;  4R0M A;  2LOL A; 
#chains in the Genus database with same CATH homology
 2PEO A;  1VQ6 P;  1K30 A;  1QRJ A;  2M8N A;  2OAR A;  1VQP P;  1JJ2 O;  1VQ8 P;  4XRO A;  1BAJ A;  2EFJ A;  1M90 Q;  1ZMB A;  1M1K Q;  2P9X A;  4U0A A;  3P05 A;  2PY8 A;  4PH0 A;  4XRQ A;  1VQ9 P;  2M8P A;  1M6E X;  2PEN A;  3CCL P;  4U0E A;  2Z46 A;  3CCE P;  3G1G A;  2JYL A;  2JYG A;  3G28 A;  1QVG O;  3B5I A;  3DS5 A;  1E6J P;  5JPA A;  1S72 P;  1NJI Q;  4M0I A;  3CCV P;  3CPW O;  2XT1 A;  1VQL P;  1A8O A;  1Q86 Q;  3CXC O;  2E1M A;  3VRL C;  3Q20 A;  1K73 Q;  2BUO A;  4U0F A;  2LF4 A;  3OW2 O;  2PEI A;  5HGL A;  1VQO P;  1PEO A;  2KOD A;  5F2N A;  1W2B O;  1VQ7 P;  3DS2 A;  3G1I A;  5HGN A;  4U0B A;  3CCJ P;  1YJ9 P;  1RNI A;  4IPY A;  4COP A;  5HGM A;  2L6E A;  3CC7 P;  1IUQ A;  2Z45 A;  1KQS O;  1M6N A;  3DS1 A;  1RO2 A;  2QA4 P;  1Q82 Q;  1VQ4 P;  3CCU P;  1YHQ P;  3CME P;  1KD1 Q;  1K8A Q;  4XFY A;  3DS3 A;  1KC8 Q;  2M8L A;  3DS4 A;  5BS1 A;  1YIT P;  2DGY A;  3E2D A;  4WYM A;  1A43 A;  2Z44 A;  3CCR P;  3MGE A;  3NTE A;  4GR6 A;  1M74 A;  2OTJ P;  5HGO A;  3CC4 P;  5I4T G;  3G4S P;  3G6E P;  1YIJ P;  1AUM A;  2PEM A;  1RO0 A;  2CWO A;  4PH1 A;  1D1D A;  1PEU A;  3G29 A;  1K9M Q;  5DCK A;  4COC A;  4XFX A;  4GR2 A;  3CCS P;  4U0D A;  1Q7Y Q;  3CD6 P;  1VQM P;  2PEK A;  3CMA P;  3RG6 C;  2XV6 A;  3M1M A;  4QNB A;  1N8R Q;  1VQK P;  5F2O A;  3H4E A;  1YJN P;  5F2K A;  1PEM A;  3LRY A;  2EIA A;  3H47 A;  3I55 P;  2XXM A;  3HYB A;  2BQ1 E;  1YJW P;  3G0V A;  3DTJ A;  3G26 A;  2JO0 A;  3G21 A;  2ONT A;  3G71 P;  3H0D A;  1VQ5 P;  3CC2 P;  3DPH A;  3HZQ A;  1Q81 Q;  1VQN P;  1YI2 P;  1QVF O;  2PEQ A;  2PEJ A;  3WBH A;  2BHV A;  3CCQ P;  1EOQ A;  2QEX P;  4XFZ A;  1PEQ A;  1EIA A;  2EG5 A;  4U0C A;  3DS0 A;  2OTL P;  3I56 P;  3CCM P;  5BS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...