3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
1VQKP 1VQ8P 1W2BO 1NJIQ 1QVGO 1N8RQ 3CMEP 3CD6P 1VQ5P 3CMAP 3CCEP 3CCRP 1JJ2O 3CXCO 1VQOP 1YITP 3CC4P 1VQ6P 2QEXP 3CCVP 1YHQP 3CCSP 1KQSO 3OW2O 3CPWO 3CCMP 1M1KQ 3G6EP 1YJNP 1VQPP 1VQ4P 3G4SP 1YI2P 3I55P 1Q86Q 2OTLP 1KD1Q 1VQMP 1Q82Q 1KC8Q 1K73Q 1VQ9P 1VQNP 1Q7YQ 3I56P 1K8AQ 1VQLP 3CCLP 3CCUP 2OTJP 2QA4P 1QVFO 3CCJP 3CCQP 3CC2P 3CC7P 1YIJP 1S72P 1K9MQ 1Q81Q 1M90Q 1VQ7P 3G71P 1YJ9P 1YJWP
chains in the Genus database with same CATH superfamily
2BCCE 2WSEJ 3HTKB 3L72J 3RK2C 1NU1E 3VMAA 3L70E 2HYNA 3TNUA 3SSUA 5CBNA 3H1IE 2QEXP 4IFFA 1PGPA 3SWYA 1EC5A 3M9QA 3L71G 2KG9A 3NMDA 1PPJG 3CWBG 4D6TJ 1XTGB 4D6TD 3L75D 2W6JH 1NTKD 3CMAP 5DJTB 1AVOA 3DS1A 2PP6A 1BCCJ 1A02J 2MR8A 2K0XA 3GKLC 2IFNA 5KLVG 3BVHA 4R4LA 2LXBA 3A0BE 1P84H 1DV5A 1PL5A 5GTHE 1SQQE 3E2DA 2GA1A 2QNWA 3KZIH 4H2YC 2P10A 5JPAA 1PP9J 3L73G 2JYLA 2BCCD 3TGUD 2H8PD 4Y99B 1DNYA 3WBHA 1NU1K 2AEFA 2GYKA 3NTEA 4HH2A 4C7RA 5TJHA 1KILA 5CCHD 2ZJSE 2K92A 3VTPC 3FXEA 3GF3A 5EW5E 1SQXJ 1JY3N 1Z56A 4IPYA 1OWAA 4ASVA 1RF1A 1L0HA 2QJPB 1IFDA 1CI6B 1Y9BA 2JAZA 2M8LA 1BE3J 2WPRA 2Y0CA 1YHQP 1LT9C 2BUOA 5CCHC 1KTMA 1SVFA 2JEEA 2ZT9B 5KLVD 3L70G 1VQMP 1URQD 1VQLP 3MZWB 1M8OB 1VQKP 3GG2A 1AVYA 1R5LA 2O3JA 2FYZA 3VP8A 5B66E 3NTNA 1QEXA 3L75E 1JTHA 2P67A 1AJYA 4DOJA 1VQNP 3H1HD 3LIDA 4DZOA 1DX7A 3S9OA 1YIJP 3P7KA 2P7JA 1KMIZ 2RKLA 1PZQA 4PD4H 3RG2A 1LT1A 1LTSC 2KIKA 3LMOA 1IZNB 4UB8H 1BDDA 2MY5A 2LIUA 2LF4A 3TNUB 1Z6MA 2K93A 1N73B 4IFDK 4M3LA 1SQQD 4BWNA 4EYYQ 2FFDC 3II6A 5KLVJ 3FGAD 2YNYA 3RGUA 1RF0A 1MV8A 1PP9G 3L73J 2LKIA 5GTHH 3G29A 1L0LD 2R32A 3A5TA 3U59A 1HTLC 1KYOE 2QM7A 1RE4A 4PV1B 2PAJA 3H1IG 1DD4A 5GTIH 2D2CC 1HY8A 1ZMBA 4Y99C 4Y28J 2KUBA 2N5IA 2C0XA 3MGNA 1L4AB 1R8EA 1SQQK 1FZCB 4NEOA 1HWTC 1IK7A 1G2CB 4KT0J 2XNDH 4I7ZC 3G1GA 4U3FE 2E1MA 1JNMA 2POHA 1EDLA 4W7ZA 3QH9A 3HD7B 1CSBA 3R2PA 1K04A 2NPSB 3BCCJ 4JBZA 4XROA 3LRYA 1BGYE 2FADA 2OARA 5HGNA 2Y0EA 2M3EA 5E79H 1AV1A 2M5RA 1KB9E 3CPWO 1HGZA 4AUWA 5AW9B 3N7NA 1SQQG 4NPFX 1SQQJ 1J2JB 2WITA 3HUSC 1QGKB 4N3YB 1S72P 1Q81Q 2KORA 2W90A 5KP6B 3GZLA 4IOIH 3LW5H 4HJGH 3D6ZA 2W27A 3OJAB 4C7NB 1GMJA 1NTMJ 4XFXA 1AQTA 1H0TB 1F80D 3V6IA 2N6YA 2AFDA 2K0YA 1EXIA 1DEEG 1PEOA 3MHVA 1M1JB 3H1JJ 3RK2D 1RNIA 3OAKA 1SQVJ 1RQVA 3D6YA 4BRYB 3I55P 1GU5A 2M8PA 4XFJA 4WY4D 2FXMA 3F5HA 2HODB 4ZKPA 4HB1A 5HGMA 1GL2C 5APVA 2JU2A 4GT1A 2MVVA 4IL6X 2Z5HA 1NQ4A 1P84E 2V7QJ 2R3CA 1KFMA 3I56P 4XFYA 2WZ7A 2D2CB 2P1JA 3L72E 2GDYA 1NTZE 4GDOA 2HPCB 3AE3C 1N7SA 4U3FG 1OZHA 1RO0A 2FYUJ 2Q5UA 2N1TB 2X2BA 2AXCA 5KP8B 2Q1KA 3M0DC 1FOSE 1GW4A 3AE4C 2O01J 3V2QA 4B86A 3CCLP 3HD7A 2HG5D 2LR2A 3BASA 2SPZA 1W2BO 1W5CE 1URQB 5AVVB 2R3SA 3CLQA 1KORA 2K0DX 1S9KD 1GDTA 1FJKA 3WU2E 1ACPA 1BCCE 1LTTC 2QJKC 1PP9D 2W6AA 1JY2P 2PRRA 3H6PA 1S2EA 2QA4P 3D71A 1ZXGA 4OVNF 3H32A 2ERHA 3HRNA 2LIWA 3E1RA 1SQBJ 1KLPA 2MJZA 1AFOA 2KWLA 5F2NA 2V7QH 1NTZJ 3M0AA 1M7LA 2KS1A 1RE3A 2LOLA 1DEBA 4CPGA 2FYNC 4WY4A 1WT6A 3SWKA 2R5DA 3CXHE 1NGMB 1VDFA 3HUSA 3TDKA 1ZN5A 4OWFA 4L73A 4Z1MH 2HR3A 4JYCA 4RKUJ 1LTGC 4HKZH 2YXQB 3AE5C 4L75A 1W2EA 2O01H 1QRJA 1K73Q 2QJPC 1GL2B 3A3YB 4ZKUA 4ASWA 4UB8E 3WU2H 3GHGC 5KAIH 1JTHB 5TISE 2R44A 2BCCJ 1S1CX 2YIUC 3TGUJ 2M3BA 3AE1C 3H25A 3L72G 3DS5A 1OVRA 4NPEA 1Q90D 1NTMG 2M0BA 2G8YA 3NY7B 2B87B 5APSA 1ZLLA 4TT3H 3G28A 5KAFH 3CC2P 3EJBA 3PHLA 3GMAA 3HD7C 3G26A 3WMM0 1KYOH 5APXA 2H89C 1MZ9A 4W7YA 2GUSA 2GZEA 4U0CA 4JF7A 1EQ7A 1N2DC 3EJDA 3K5BA 3GZMA 1BCCG 2E76D 4HKGA 2ITAA 1PGOA 4JPZB 3RG6C 4BRYA 2MVUA 1QLED 2ZAEB 1PEMA 1CZQA 1SQPG 2KSEA 2JU1A 3HYBA 4PD4E 3CL3D 5AW3B 2IFMA 2K94A 1IK9A 5AW4B 2GZFA 5K5GB 2FYNB 1A8OA 5AVXB 1VHNA 3AEBC 4JQ0D 2KLUA 3RBXA 4PD4I 4LGDE 3VN0A 1PEQA 3CWBJ 1KQGB 3AECC 1T3JA 2CG5B 4COPA 5CMZA 1OVUA 2QG4A 1FR2A 1WRGA 1SQBG 1NYHA 1JCCA 4IZ6A 1LTAC 3A2AA 4NPDA 3L74E 3CCRP 2KS1B 4R0MA 2JO0A 4GOFA 3Q20A 1AYIA 3SFEC 2WSFJ 3ABVC 2KW2A 3H32B 2QSIA 1T8KA 2QRXA 2D2CD 3CX5H 4JYBA 1SFCC 3AEGC 2E74B 2FAEA 5CZDB 2PY8A 1OW8A 4A7PA 1IMPA 3CX5I 1S5LH 5HGOA 3Q5SA 3M9HA 1XTCC 3H1HJ 2LTEA 4UB6H 1L4AA 1DH3A 3B4QA 3HTKA 3RK2B 4GKGA 2IBZI 3G9RA 2K9YA 1Q7YQ 2C9LY 1NO4A 3CCQP 1OX3A 1BDCA 2L91A 1K9MQ 3EQ2A 3G71P 4WY4B 2OYHB 1SQXG 1LJ2A 1WMKA 2ZT9C 2KOOA 2P9XA 4H0LC 5KAFE 4I6MC 1SQVE 3KHUA 1K8AQ 3L74J 1LWUC 2M5AB 3H1LG 2PEKA 1BE3D 3NXSA 2UWJE 1GL2D 1KB9D 1X3OA 1UIXA 2BASA 5DCKA 2KOGA 3OW2O 1GK6A 2XNXA 2BCCG 4C46A 3QWOC 4COCA 2JJLA 5AW5B 4AQRD 2L22A 1EZVD 2I1KA 1OVVA 2Z45A 1VF5C 4UB6E 1VQ8P 1L0LE 1JY3O 2N1TA 3P8CE 2KNCA 1X79B 1RE3C 2Q3EA 1KC8Q 5KJ7D 2H88C 3L74D 2YO3A 2N9YB 2RN0A 1TU3F 1FOSF 1M74A 2EHSA 2EG5A 1ZR2A 2L6EA 2PNGA 1SQPJ 3DPHA 5KLVK 1SLQA 2OTLP 2B88A 1AA0A 4EDFA 2EHTA 3U43A 3H1KE 4YXDC 2B87A 1N7SC 2KZJA 2WPVB 2H7HA 5CBOA 1L0ND 1NU1D 1GPJA 2WTYA 3CCMP 4H44C 2FXOA 3H1IJ 1EZVG 3RK3D 1U57A 3AE7C 3H1HG 5EFWB 2OTJP 1VPCA 4QKOA 2PENA 3M1MA 1HH0A 1T2KD 4K3AA 2CNRA 1GL2A 1N8RQ 1SQBE 1GD2E 1OIPA 4D6TE 3G0VA 3RL0D 2N1TC 1K05A 4YPCA 3A7OA 1U7MA 3LW5J 2JB0A 3OA7A 3VRLC 3FXDA 5HGLA 3ITKA 2WPQA 3G1IA 3P8MC 1YI2P 2N9BA 2AEJA 3L74G 2OYHC 1LP1B 3T97B 4KHXA 2LPKA 5APWA 1G1IA 2QJYB 1LTJB 2E75D 2IBZG 4MN4C 2WSCH 1LGHB 4IL6H 2Y9YA 5AW8B 2WVRA 2PEMA 4BPGA 2B9BA 2QJKB 5KLVE 4GOEA 3V4QA 3IR9A 3E7KA 1L0LG 2OYIA 1N7LA 5CCGD 4U0BA 3H1ID 2E75B 2AEMA 1NTMK 3PRJA 2KG6A 1FDIA 1CW5A 2CWOA 1N73A 2KK7A 3Q1MA 1L0NG 3CXCO 4EI2A 3M91A 1HF9A 2OTKE 4L76A 2JP3A 4DG9A 4OGQD 2IX7C 5TISH 1Q86Q 3G21A 2FYUG 2OQQA 2FFDB 4YTPC 3CCUP 3WUVA 2FBWC 2XT1A 2FKWB 2YO2A 2OGUA 5BS2A 1HBWA 2Q7CA 2DNWA 2LL8A 1BGYJ 1NAFA 2W83C 1X8YA 4RO0A 5CHXA 4RJTA 4GIFA 5AVWB 2IBZD 3S4RA 1QVFO 3I5CA 5KLIB 3HE4A 2YXRB 2FFDA 2O01N 1NVOA 5BVZA 4GR6A 2E42A 1DD3A 2ZT9D 1EDIA 4U0AA 1NWQA 2QIWA 5BS1A 2R5BA 3CWBD 4D6TG 1PGJA 1CI6A 2MKVA 2ROQA 1FZBA 4L74A 3FX0A 4LLHA 2A45I 1KN7A 1HUCA 3AE2C 4PH0A 2KGAA 1NTKG 1OW6A 2IZ1A 3USSA 2MD9A 5F2OA 2GZJA 5B5EE 1FDOA 3JSVC 2IZ0A 1KILD 1Q2NA 3N4XA 2N50A 2CPSA 2JDIH 2ZYAA 1NKNA 3MIWA 1GTWA 3IN6A 2A06E 3L73D 4BPHA 2ZFCA 2K37A 3L4FA 5AVQB 1LNQA 3H4EA 3EWKA 2YIUB 3H1KJ 5AVTB 2BEQD 1L0LK 2E74C 2E5YA 3E1IA 2VRSA 4U0FA 1FZGA 3KXDA 2XKMA 2KP8A 2RMZA 4WVZA 5C39A 3H1HE 1J1DB 1PIXA 2NPSD 5AW7B 2KGDA 1GXGA 1PFIA 3H47A 2FXPA 1P84I 3C9IA 1BAJA 5E79E 4K35A 3H1LJ 1ZR4A 4F37A 1RF1C 3CMEP 1KILE 4H44B 1SS1A 3C8VA 1K30A 1FZCA 1IFMA 2IBZE 1RO2A 1NAYA 3B71A 1JO5A 1BGYG 1D7MA 2ZXXA 1FZEA 2KOPA 1S5LX 2HODA 3L70J 3L70D 4H13B 1RQUA 1NJIQ 2K9JA 3L71E 2ZYDA 3RL0C 2J5UA 1X9VA 3CC4P 2YKQA 3B5NC 1HVVA 3CWBE 4N6JA 1E5WA 1HQBA 1Y47A 3AEAC 3SFDC 2FYUD 1RE4C 3Q3DA 1QL1A 2WSCJ 1JUNA 3CCJP 1H88A 4H13C 1JEKA 3UIAA 2M8NA 3CE7A 1YITP 4HYTB 1N7SD 3AEFC 2C0WA 1BSHA 1KD1Q 2EIAA 2NPSC 3HE4B 2V4HA 2RH0A 5APTA 2GZIA 1EDJA 2A06D 3L73E 2H43A 2KLVA 3KQGA 4I7ZB 3CD6P 4WBAA 1VQOP 1YQ4C 2CK3H 4GR2A 2XV5A 3TGUE 2FQ0A 1LT9B 2Y9ZA 3CXHI 3DS0A 4IL6E 2JGPA 2N5HA 3TYYA 2KG8A 5KJ7A 1LTJA 4GODA 3A0HH 5AW0B 5BU8B 1BSNA 2J58A 3BRTB 1LP1A 1PGQA 3KYQA 1YQ3C 1PPJE 2FVAA 3JCUH 4U0DA 2FVEA 4ZMDA 1UNKA 1NTKJ 1NOHA 2FACA 1N73C 3CI9A 2A45G 3U1CA 4H0LB 1L4AC 1LTBC 1SQBK 1FC2C 1YTZT 2A06G 1SFCA 1P84D 2M8RA 1YJ9P 1NTME 1J1EB 1L0LJ 4H0LD 3IF4A 3TSIA 2WWWA 2KI7B 3TK1A 4TLFA 1FS0E 1PV3A 4OH8B 1KB9I 2WT7A 1RF1B 3MGEA 1QX8A 2PEOA 3P8CD 3MD0A 2QVAA 2E74D 4QMAA 2JKVA 5H2FH 2XZRA 4M0IA 2WSFH 2Q9IA 1VL2A 2IYPA 5KAIE 1MFZA 4OGQC 4I1LA 2E5TA 1BGYD 3WUTA 2MF4A 1OFCX 4IFMA 3CC7P 2ZVOB 5HV8A 3T97A 5DJUB 3RK3C 2AF8A 1USEA 1H89A 2HFED 3B5ND 4YXWH 1YBKA 4C7NA 1JM0A 2PFXA 1IUQA 1KYOD 2I1JA 2CQ8A 1DIPA 3EFFK 3B5IA 2O1KA 1E6JP 5KKZB 3AEEC 1HJBA 1IMQA 2Q3IA 1N86A 3VMYA 2E75C 4WB4A 1HJ0A 1ZNVA 2QM8A 1M57D 1OW7A 2NRGA 3RBZA 3VMZA 2GZGA 3CXHH 2P2UA 4WYMA 2NPSA 2QJYC 2BQ1E 2K3RA 1LTJC 3H1JD 3TF5A 5KJ7C 2G3AA 3IFMA 4H13D 2XZ1C 1AUMA 1QVGO 2AXTE 2Q6QA 3GF7A 2XDJA 2JBGA 3AE9C 3JC22 5CJ0A 2GM4A 3L35A 2ZVNB 1AF8A 3KDPB 3PTZA 3HUSB 3GHGA 1NU1J 1YYCA 2KNCB 5AVSB 1LT9A 5CCHA 2QE7H 3AE6C 1KQSO 2JWAA 2WSSH 5APYA 1NKZB 1UJZA 4R4MA 5AW6B 1IFIA 2NO8A 2XXMA 2KGCA 2JO1A 1SQXK 1X22A 3F89A 1IJDB 1GW3A 2JQ4A 1SQVD 1T6AA 2L4BA 2AFEA 2IYOA 3CX5E 1M1KQ 1EMVA 2L5GB 3H1JG 3AE8C 2AXTH 3M06A 2O1JA 1J1EC 5KLIC 1LTIC 4W80A 2LMLA 2BHVA 1YTZI 2OYIB 3HE5A 4PJ0E 3LIEA 3CCEP 2N98A 2N6ZA 1NTMD 3CCSP 4U0EA 3R4YA 3Q2YA 3G6EP 4PH1A 2K9JB 3L72D 2N1TD 3W68A 4XRQA 2HPCA 1JMMA 4N78E 3PP5A 3ZDMA 1GZLA 7CEIA 5AVYB 1VKUA 2OYOA 3CCVP 4XA4A 1NH4A 4PWVB 3L37A 1VF5D 1M6NA 1KYOI 1SQXE 2FHSC 2K5XA 2KOQA 3D70A 2WPTA 4H2XC 1ZMEC 3AEDC 1SQVG 3V2RA 5B66H 1FAVA 4I2LC 1BE3E 2Y0DA 3G3ZA 3M9BA 2NZ2A 2IDBA 1KILB 2Z5IA 1EZVI 3M0DA 1M1JC 3H1KD 1SQPD 3V2NA 3P05A 3Q5PA 3VOPA 3S1KA 1VQ7P 2KSJA 5B5EH 2XZ0D 4EOTA 1EZVE 2Z46A 3NFQA 4XE5B 1JY3P 1IFPA 2VLQA 2IPPA 2FVFA 3EJEA 1L4AD 3Q5RA 2LKMA 1NTZG 1RF0C 2E43A 5BU5A 3WUUA 1IC2A 1ZP0C 1NHLA 4MRTC 1SQBD 1M6EX 2YMYA 1YJWP 3DTJA 1BXIA 5AVRB 2ZYGA 3H1JE 2KGEA 3CX5D 2Z4EA 3KPEA 1JY2O 4LC1A 2YKOA 3A0HE 1T2KC 2WMMA 3B5NA 4U7JA 3BCCG 3HD7D 5CJ4A 2VLOA 2XV6A 1SP4A 3MUDC 2CPBA 1X0TA 4PD4D 1EXJA 1KZUB 2JWDA 1NTKK 1MZ8A 1G2CA 1FZCC 1S3JA 3H1KG 1E79H 4DJGA 1GU4A 4N78D 1VQ4P 3RL0B 1L0NE 1PEUA 1MFTA 1S4XA 1URQA 3MTUE 2OYIC 1L0IA 2M5AA 4QNBA 2YKPA 1L0NK 1EDKA 2K88A 2C9NY 4PXHB 1AQ5A 2FYUE 1FE6A 1VQ5P 4U3FD 3CXHD 1ZRTD 3VMXA 3GW6A 1SQXD 3EFGA 5HVCA 1OMIA 1RY3A 3B5NB 1EIAA 1KQFB 2K2QA 1BE3G 2OYHA 1FJPA 2FY8A 2PEJA 3B8EB 3O6QB 1KQLA 4AYCA 3H1LD 2KB7P 3BCCD 1KILC 2KODA 1FBMA 3C1LA 4CA3A 3P32A 5KTBA 3G4SP 3VP9A 1VQ9P 3PH0A 4BXLA 1E0HA 1LWUB 1R5SA 2VLNA 4PV1C 1D1DA 5KP7B 1CEIA 1IFJA 1HGVA 1JB0J 3FWLA 4UHPB 3H0DA 2FYUK 3HZQA 1L2PA 1RHZB 1M1JA 1JCDA 1OXZA 3GHGB 1ZRTE 1NTKE 1PPJD 3BATA 2WPSA 2XU6A 3L36A 3DS3A 2KOSA 1KV4A 1RH5B 2PGDA 4ZNCA 4WWIA 3GJNA 1H0TA 1VQ6P 2GDWA 3PJSK 1IO4A 5GTIE 1YJNP 1QL2A 1SQPK 5I4TG 1Y8AA 2KR5A 2KYVA 4BPFA 2MR7A 1SQPE 3V2PA 2E76C 3JCUE 2JR8A 2A45H 2PEQA 4DCKA 3DS4A 3L71J 1T3UA 3GLMA 4EIJA 5AVZB 1MKMA 5APUA 1N7SB 1NTZD 1NU1G 1G1JA 1NTZK 2W6BA 3HE5B 1S5LE 2BEZF 1VF5B 2YMKA 4U3FJ 3FWNA 2EFJA 2B89A 3DS2A 1A43A 3B4SA 1KFNA 1U7JA 2WT7B 1FDMA 4OGQB 1T8ZA 1FU1A 2HLOA 1A02F 5CCGC 3A0BH 5EJDA 2DW3A 5APQA 2JYGA 3U1AA 2ZXEB 1M56D 1IFNA 4RESB 3IAOA 1URQC 5AW1B 1S9KE 2FQ2A 2KXPB 3O8ZA 1BCCD 1ZV8A 3BCCE 1H8AA 2WQYC 1EOQA 3SWFA 2L9FA 5F2KA 2LXCB 2GDXA 3PLNA 2VLPA 1FZAA 2Z44A 2FQ1A 4O9BA 3V4WA 3W67A 3V5BA 1LWUA 1ZOYC 2I8DA 3L71D 5H2FE 5M1BA 3L75J 1JOCA 1SFCD 1SQVK 1GK4A 3L75G 2VSQA 5AW2B 3RK3E 5AVUB 1JJ2O 1L0NJ 1ZW0A 3MP7B 5L8RJ 2P58A 4XFZA 1J1DC 4H44D 4PJ0H 2DGYA 2ONTA 1MUUA 4PV1D 1Q82Q 1GXHA 3O6QA 1SFCB 2GUVA 1USDA 2L0QA 1KB9H 1M90Q 5KKZC 3BRVB 1UIIA 1JMBA 3RL0g 1FZFA 1JY2N 5CCGA 2K1AA 2AVAA 2CGQA 3H1LE 4KJMA 2WSEH 1OR5A 1VQPP 3VYIA 2W8ZA 2PEIA 4WY4C 2E76B 3KZIE 3MUDA 2KZIA 3TGUG 3RK3B 4DT0A 2J59M 1PP9E 4H2WC
chains in the Genus database with same CATH topology
1N8RQ 1ZMBA 3CMEP 2Z46A 3G0VA 5DCKA 4GR6A 2M8LA 1PEQA 2QEXP 1YHQP 2BUOA 1K30A 1IUQA 4COPA 3OW2O 2KODA 4U0AA 1M1KQ 3VRLC 5BS1A 5HGLA 2JYGA 1RO2A 3G1IA 3G4SP 1YI2P 3G1GA 4U0DA 1VQMP 1QRJA 2E1MA 1VQ9P 1K73Q 3I56P 4COCA 3B5IA 4XFYA 1VQLP 1E6JP 2BHVA 2Z45A 1M6EX 1YJWP 3DTJA 1VQKP 4XROA 1VQ8P 1NJIQ 3LRYA 4PH0A 1EOQA 1D1DA 3CMAP 2OARA 5F2KA 5HGNA 3CCRP 3CCEP 2PEMA 3CC4P 2JO0A 1RO0A 3CCSP 3Q20A 3DS1A 3DS5A 3CPWO 5F2OA 4U0EA 3H0DA 4WYMA 2Z44A 3G6EP 3HZQA 4PH1A 1KC8Q 4U0BA 1VQNP 2BQ1E 2XV6A 3G28A 4XRQA 3CCLP 3CCJP 3CC2P 3DS3A 1YIJP 1S72P 1Q81Q 1YJ9P 3G26A 2CWOA 1AUMA 1W2BO 1QVGO 2PY8A 3E2DA 1M74A 2EG5A 2M8NA 1JJ2O 3CXCO 1YITP 1VQ6P 2L6EA 5HGOA 3CCVP 4XFZA 5JPAA 1M6NA 4XFXA 3H4EA 2LF4A 3DPHA 2JYLA 1YJNP 1VQ4P 1Q86Q 2DGYA 2OTLP 2ONTA 3G21A 5I4TG 2EIAA 1KD1Q 1Q82Q 1PEUA 4U0CA 3MGEA 1Q7YQ 2PEOA 3WBHA 4U0FA 3CCUP 2QA4P 3CCQP 2XT1A 4QNBA 1K9MQ 1M90Q 3G71P 1PEOA 3NTEA 5BS2A 3CD6P 2PEQA 1VQ5P 3DS4A 2P9XA 3RG6C 1VQOP 4GR2A 1PEMA 4M0IA 1KQSO 1RNIA 3CCMP 1EIAA 3HYBA 5F2NA 1A43A 1VQPP 3G29A 3DS0A 3I55P 2M8PA 2PEIA 3H47A 1K8AQ 3P05A 2XXMA 2OTJP 1QVFO 5HGMA 1BAJA 2PEJA 3CC7P 1A8OA 2PEKA 4IPYA 2PENA 2EFJA 3DS2A 1VQ7P 3M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK P;  1VQ8 P;  1W2B O;  1NJI Q;  1QVG O;  1N8R Q;  3CME P;  3CD6 P;  1VQ5 P;  3CMA P;  3CCE P;  3CCR P;  1JJ2 O;  3CXC O;  1VQO P;  1YIT P;  3CC4 P;  1VQ6 P;  2QEX P;  3CCV P;  1YHQ P;  3CCS P;  1KQS O;  3OW2 O;  3CPW O;  3CCM P;  1M1K Q;  3G6E P;  1YJN P;  1VQP P;  1VQ4 P;  3G4S P;  1YI2 P;  3I55 P;  1Q86 Q;  2OTL P;  1KD1 Q;  1VQM P;  1Q82 Q;  1KC8 Q;  1K73 Q;  1VQ9 P;  1VQN P;  1Q7Y Q;  3I56 P;  1K8A Q;  1VQL P;  3CCL P;  3CCU P;  2OTJ P;  2QA4 P;  1QVF O;  3CCJ P;  3CCQ P;  3CC2 P;  3CC7 P;  1YIJ P;  1S72 P;  1K9M Q;  1Q81 Q;  1M90 Q;  1VQ7 P;  3G71 P;  1YJ9 P;  1YJW P; 
#chains in the Genus database with same CATH topology
 2BCC E;  2WSE J;  3HTK B;  3L72 J;  3RK2 C;  1NU1 E;  3VMA A;  3L70 E;  2HYN A;  3TNU A;  3SSU A;  5CBN A;  3H1I E;  2QEX P;  4IFF A;  1PGP A;  3SWY A;  1EC5 A;  3M9Q A;  3L71 G;  2KG9 A;  3NMD A;  1PPJ G;  3CWB G;  4D6T J;  1XTG B;  4D6T D;  3L75 D;  2W6J H;  1NTK D;  3CMA P;  5DJT B;  1AVO A;  3DS1 A;  2PP6 A;  1BCC J;  1A02 J;  2MR8 A;  2K0X A;  3GKL C;  2IFN A;  5KLV G;  3BVH A;  4R4L A;  2LXB A;  3A0B E;  1P84 H;  1DV5 A;  1PL5 A;  5GTH E;  1SQQ E;  3E2D A;  2GA1 A;  2QNW A;  3KZI H;  4H2Y C;  2P10 A;  5JPA A;  1PP9 J;  3L73 G;  2JYL A;  2BCC D;  3TGU D;  2H8P D;  4Y99 B;  1DNY A;  3WBH A;  1NU1 K;  2AEF A;  2GYK A;  3NTE A;  4HH2 A;  4C7R A;  5TJH A;  1KIL A;  5CCH D;  2ZJS E;  2K92 A;  3VTP C;  3FXE A;  3GF3 A;  5EW5 E;  1SQX J;  1JY3 N;  1Z56 A;  4IPY A;  1OWA A;  4ASV A;  1RF1 A;  1L0H A;  2QJP B;  1IFD A;  1CI6 B;  1Y9B A;  2JAZ A;  2M8L A;  1BE3 J;  2WPR A;  2Y0C A;  1YHQ P;  1LT9 C;  2BUO A;  5CCH C;  1KTM A;  1SVF A;  2JEE A;  2ZT9 B;  5KLV D;  3L70 G;  1VQM P;  1URQ D;  1VQL P;  3MZW B;  1M8O B;  1VQK P;  3GG2 A;  1AVY A;  1R5L A;  2O3J A;  2FYZ A;  3VP8 A;  5B66 E;  3NTN A;  1QEX A;  3L75 E;  1JTH A;  2P67 A;  1AJY A;  4DOJ A;  1VQN P;  3H1H D;  3LID A;  4DZO A;  1DX7 A;  3S9O A;  1YIJ P;  3P7K A;  2P7J A;  1KMI Z;  2RKL A;  1PZQ A;  4PD4 H;  3RG2 A;  1LT1 A;  1LTS C;  2KIK A;  3LMO A;  1IZN B;  4UB8 H;  1BDD A;  2MY5 A;  2LIU A;  2LF4 A;  3TNU B;  1Z6M A;  2K93 A;  1N73 B;  4IFD K;  4M3L A;  1SQQ D;  4BWN A;  4EYY Q;  2FFD C;  3II6 A;  5KLV J;  3FGA D;  2YNY A;  3RGU A;  1RF0 A;  1MV8 A;  1PP9 G;  3L73 J;  2LKI A;  5GTH H;  3G29 A;  1L0L D;  2R32 A;  3A5T A;  3U59 A;  1HTL C;  1KYO E;  2QM7 A;  1RE4 A;  4PV1 B;  2PAJ A;  3H1I G;  1DD4 A;  5GTI H;  2D2C C;  1HY8 A;  1ZMB A;  4Y99 C;  4Y28 J;  2KUB A;  2N5I A;  2C0X A;  3MGN A;  1L4A B;  1R8E A;  1SQQ K;  1FZC B;  4NEO A;  1HWT C;  1IK7 A;  1G2C B;  4KT0 J;  2XND H;  4I7Z C;  3G1G A;  4U3F E;  2E1M A;  1JNM A;  2POH A;  1EDL A;  4W7Z A;  3QH9 A;  3HD7 B;  1CSB A;  3R2P A;  1K04 A;  2NPS B;  3BCC J;  4JBZ A;  4XRO A;  3LRY A;  1BGY E;  2FAD A;  2OAR A;  5HGN A;  2Y0E A;  2M3E A;  5E79 H;  1AV1 A;  2M5R A;  1KB9 E;  3CPW O;  1HGZ A;  4AUW A;  5AW9 B;  3N7N A;  1SQQ G;  4NPF X;  1SQQ J;  1J2J B;  2WIT A;  3HUS C;  1QGK B;  4N3Y B;  1S72 P;  1Q81 Q;  2KOR A;  2W90 A;  5KP6 B;  3GZL A;  4IOI H;  3LW5 H;  4HJG H;  3D6Z A;  2W27 A;  3OJA B;  4C7N B;  1GMJ A;  1NTM J;  4XFX A;  1AQT A;  1H0T B;  1F80 D;  3V6I A;  2N6Y A;  2AFD A;  2K0Y A;  1EXI A;  1DEE G;  1PEO A;  3MHV A;  1M1J B;  3H1J J;  3RK2 D;  1RNI A;  3OAK A;  1SQV J;  1RQV A;  3D6Y A;  4BRY B;  3I55 P;  1GU5 A;  2M8P A;  4XFJ A;  4WY4 D;  2FXM A;  3F5H A;  2HOD B;  4ZKP A;  4HB1 A;  5HGM A;  1GL2 C;  5APV A;  2JU2 A;  4GT1 A;  2MVV A;  4IL6 X;  2Z5H A;  1NQ4 A;  1P84 E;  2V7Q J;  2R3C A;  1KFM A;  3I56 P;  4XFY A;  2WZ7 A;  2D2C B;  2P1J A;  3L72 E;  2GDY A;  1NTZ E;  4GDO A;  2HPC B;  3AE3 C;  1N7S A;  4U3F G;  1OZH A;  1RO0 A;  2FYU J;  2Q5U A;  2N1T B;  2X2B A;  2AXC A;  5KP8 B;  2Q1K A;  3M0D C;  1FOS E;  1GW4 A;  3AE4 C;  2O01 J;  3V2Q A;  4B86 A;  3CCL P;  3HD7 A;  2HG5 D;  2LR2 A;  3BAS A;  2SPZ A;  1W2B O;  1W5C E;  1URQ B;  5AVV B;  2R3S A;  3CLQ A;  1KOR A;  2K0D X;  1S9K D;  1GDT A;  1FJK A;  3WU2 E;  1ACP A;  1BCC E;  1LTT C;  2QJK C;  1PP9 D;  2W6A A;  1JY2 P;  2PRR A;  3H6P A;  1S2E A;  2QA4 P;  3D71 A;  1ZXG A;  4OVN F;  3H32 A;  2ERH A;  3HRN A;  2LIW A;  3E1R A;  1SQB J;  1KLP A;  2MJZ A;  1AFO A;  2KWL A;  5F2N A;  2V7Q H;  1NTZ J;  3M0A A;  1M7L A;  2KS1 A;  1RE3 A;  2LOL A;  1DEB A;  4CPG A;  2FYN C;  4WY4 A;  1WT6 A;  3SWK A;  2R5D A;  3CXH E;  1NGM B;  1VDF A;  3HUS A;  3TDK A;  1ZN5 A;  4OWF A;  4L73 A;  4Z1M H;  2HR3 A;  4JYC A;  4RKU J;  1LTG C;  4HKZ H;  2YXQ B;  3AE5 C;  4L75 A;  1W2E A;  2O01 H;  1QRJ A;  1K73 Q;  2QJP C;  1GL2 B;  3A3Y B;  4ZKU A;  4ASW A;  4UB8 E;  3WU2 H;  3GHG C;  5KAI H;  1JTH B;  5TIS E;  2R44 A;  2BCC J;  1S1C X;  2YIU C;  3TGU J;  2M3B A;  3AE1 C;  3H25 A;  3L72 G;  3DS5 A;  1OVR A;  4NPE A;  1Q90 D;  1NTM G;  2M0B A;  2G8Y A;  3NY7 B;  2B87 B;  5APS A;  1ZLL A;  4TT3 H;  3G28 A;  5KAF H;  3CC2 P;  3EJB A;  3PHL A;  3GMA A;  3HD7 C;  3G26 A;  3WMM 0;  1KYO H;  5APX A;  2H89 C;  1MZ9 A;  4W7Y A;  2GUS A;  2GZE A;  4U0C A;  4JF7 A;  1EQ7 A;  1N2D C;  3EJD A;  3K5B A;  3GZM A;  1BCC G;  2E76 D;  4HKG A;  2ITA A;  1PGO A;  4JPZ B;  3RG6 C;  4BRY A;  2MVU A;  1QLE D;  2ZAE B;  1PEM A;  1CZQ A;  1SQP G;  2KSE A;  2JU1 A;  3HYB A;  4PD4 E;  3CL3 D;  5AW3 B;  2IFM A;  2K94 A;  1IK9 A;  5AW4 B;  2GZF A;  5K5G B;  2FYN B;  1A8O A;  5AVX B;  1VHN A;  3AEB C;  4JQ0 D;  2KLU A;  3RBX A;  4PD4 I;  4LGD E;  3VN0 A;  1PEQ A;  3CWB J;  1KQG B;  3AEC C;  1T3J A;  2CG5 B;  4COP A;  5CMZ A;  1OVU A;  2QG4 A;  1FR2 A;  1WRG A;  1SQB G;  1NYH A;  1JCC A;  4IZ6 A;  1LTA C;  3A2A A;  4NPD A;  3L74 E;  3CCR P;  2KS1 B;  4R0M A;  2JO0 A;  4GOF A;  3Q20 A;  1AYI A;  3SFE C;  2WSF J;  3ABV C;  2KW2 A;  3H32 B;  2QSI A;  1T8K A;  2QRX A;  2D2C D;  3CX5 H;  4JYB A;  1SFC C;  3AEG C;  2E74 B;  2FAE A;  5CZD B;  2PY8 A;  1OW8 A;  4A7P A;  1IMP A;  3CX5 I;  1S5L H;  5HGO A;  3Q5S A;  3M9H A;  1XTC C;  3H1H J;  2LTE A;  4UB6 H;  1L4A A;  1DH3 A;  3B4Q A;  3HTK A;  3RK2 B;  4GKG A;  2IBZ I;  3G9R A;  2K9Y A;  1Q7Y Q;  2C9L Y;  1NO4 A;  3CCQ P;  1OX3 A;  1BDC A;  2L91 A;  1K9M Q;  3EQ2 A;  3G71 P;  4WY4 B;  2OYH B;  1SQX G;  1LJ2 A;  1WMK A;  2ZT9 C;  2KOO A;  2P9X A;  4H0L C;  5KAF E;  4I6M C;  1SQV E;  3KHU A;  1K8A Q;  3L74 J;  1LWU C;  2M5A B;  3H1L G;  2PEK A;  1BE3 D;  3NXS A;  2UWJ E;  1GL2 D;  1KB9 D;  1X3O A;  1UIX A;  2BAS A;  5DCK A;  2KOG A;  3OW2 O;  1GK6 A;  2XNX A;  2BCC G;  4C46 A;  3QWO C;  4COC A;  2JJL A;  5AW5 B;  4AQR D;  2L22 A;  1EZV D;  2I1K A;  1OVV A;  2Z45 A;  1VF5 C;  4UB6 E;  1VQ8 P;  1L0L E;  1JY3 O;  2N1T A;  3P8C E;  2KNC A;  1X79 B;  1RE3 C;  2Q3E A;  1KC8 Q;  5KJ7 D;  2H88 C;  3L74 D;  2YO3 A;  2N9Y B;  2RN0 A;  1TU3 F;  1FOS F;  1M74 A;  2EHS A;  2EG5 A;  1ZR2 A;  2L6E A;  2PNG A;  1SQP J;  3DPH A;  5KLV K;  1SLQ A;  2OTL P;  2B88 A;  1AA0 A;  4EDF A;  2EHT A;  3U43 A;  3H1K E;  4YXD C;  2B87 A;  1N7S C;  2KZJ A;  2WPV B;  2H7H A;  5CBO A;  1L0N D;  1NU1 D;  1GPJ A;  2WTY A;  3CCM P;  4H44 C;  2FXO A;  3H1I J;  1EZV G;  3RK3 D;  1U57 A;  3AE7 C;  3H1H G;  5EFW B;  2OTJ P;  1VPC A;  4QKO A;  2PEN A;  3M1M A;  1HH0 A;  1T2K D;  4K3A A;  2CNR A;  1GL2 A;  1N8R Q;  1SQB E;  1GD2 E;  1OIP A;  4D6T E;  3G0V A;  3RL0 D;  2N1T C;  1K05 A;  4YPC A;  3A7O A;  1U7M A;  3LW5 J;  2JB0 A;  3OA7 A;  3VRL C;  3FXD A;  5HGL A;  3ITK A;  2WPQ A;  3G1I A;  3P8M C;  1YI2 P;  2N9B A;  2AEJ A;  3L74 G;  2OYH C;  1LP1 B;  3T97 B;  4KHX A;  2LPK A;  5APW A;  1G1I A;  2QJY B;  1LTJ B;  2E75 D;  2IBZ G;  4MN4 C;  2WSC H;  1LGH B;  4IL6 H;  2Y9Y A;  5AW8 B;  2WVR A;  2PEM A;  4BPG A;  2B9B A;  2QJK B;  5KLV E;  4GOE A;  3V4Q A;  3IR9 A;  3E7K A;  1L0L G;  2OYI A;  1N7L A;  5CCG D;  4U0B A;  3H1I D;  2E75 B;  2AEM A;  1NTM K;  3PRJ A;  2KG6 A;  1FDI A;  1CW5 A;  2CWO A;  1N73 A;  2KK7 A;  3Q1M A;  1L0N G;  3CXC O;  4EI2 A;  3M91 A;  1HF9 A;  2OTK E;  4L76 A;  2JP3 A;  4DG9 A;  4OGQ D;  2IX7 C;  5TIS H;  1Q86 Q;  3G21 A;  2FYU G;  2OQQ A;  2FFD B;  4YTP C;  3CCU P;  3WUV A;  2FBW C;  2XT1 A;  2FKW B;  2YO2 A;  2OGU A;  5BS2 A;  1HBW A;  2Q7C A;  2DNW A;  2LL8 A;  1BGY J;  1NAF A;  2W83 C;  1X8Y A;  4RO0 A;  5CHX A;  4RJT A;  4GIF A;  5AVW B;  2IBZ D;  3S4R A;  1QVF O;  3I5C A;  5KLI B;  3HE4 A;  2YXR B;  2FFD A;  2O01 N;  1NVO A;  5BVZ A;  4GR6 A;  2E42 A;  1DD3 A;  2ZT9 D;  1EDI A;  4U0A A;  1NWQ A;  2QIW A;  5BS1 A;  2R5B A;  3CWB D;  4D6T G;  1PGJ A;  1CI6 A;  2MKV A;  2ROQ A;  1FZB A;  4L74 A;  3FX0 A;  4LLH A;  2A45 I;  1KN7 A;  1HUC A;  3AE2 C;  4PH0 A;  2KGA A;  1NTK G;  1OW6 A;  2IZ1 A;  3USS A;  2MD9 A;  5F2O A;  2GZJ A;  5B5E E;  1FDO A;  3JSV C;  2IZ0 A;  1KIL D;  1Q2N A;  3N4X A;  2N50 A;  2CPS A;  2JDI H;  2ZYA A;  1NKN A;  3MIW A;  1GTW A;  3IN6 A;  2A06 E;  3L73 D;  4BPH A;  2ZFC A;  2K37 A;  3L4F A;  5AVQ B;  1LNQ A;  3H4E A;  3EWK A;  2YIU B;  3H1K J;  5AVT B;  2BEQ D;  1L0L K;  2E74 C;  2E5Y A;  3E1I A;  2VRS A;  4U0F A;  1FZG A;  3KXD A;  2XKM A;  2KP8 A;  2RMZ A;  4WVZ A;  5C39 A;  3H1H E;  1J1D B;  1PIX A;  2NPS D;  5AW7 B;  2KGD A;  1GXG A;  1PFI A;  3H47 A;  2FXP A;  1P84 I;  3C9I A;  1BAJ A;  5E79 E;  4K35 A;  3H1L J;  1ZR4 A;  4F37 A;  1RF1 C;  3CME P;  1KIL E;  4H44 B;  1SS1 A;  3C8V A;  1K30 A;  1FZC A;  1IFM A;  2IBZ E;  1RO2 A;  1NAY A;  3B71 A;  1JO5 A;  1BGY G;  1D7M A;  2ZXX A;  1FZE A;  2KOP A;  1S5L X;  2HOD A;  3L70 J;  3L70 D;  4H13 B;  1RQU A;  1NJI Q;  2K9J A;  3L71 E;  2ZYD A;  3RL0 C;  2J5U A;  1X9V A;  3CC4 P;  2YKQ A;  3B5N C;  1HVV A;  3CWB E;  4N6J A;  1E5W A;  1HQB A;  1Y47 A;  3AEA C;  3SFD C;  2FYU D;  1RE4 C;  3Q3D A;  1QL1 A;  2WSC J;  1JUN A;  3CCJ P;  1H88 A;  4H13 C;  1JEK A;  3UIA A;  2M8N A;  3CE7 A;  1YIT P;  4HYT B;  1N7S D;  3AEF C;  2C0W A;  1BSH A;  1KD1 Q;  2EIA A;  2NPS C;  3HE4 B;  2V4H A;  2RH0 A;  5APT A;  2GZI A;  1EDJ A;  2A06 D;  3L73 E;  2H43 A;  2KLV A;  3KQG A;  4I7Z B;  3CD6 P;  4WBA A;  1VQO P;  1YQ4 C;  2CK3 H;  4GR2 A;  2XV5 A;  3TGU E;  2FQ0 A;  1LT9 B;  2Y9Z A;  3CXH I;  3DS0 A;  4IL6 E;  2JGP A;  2N5H A;  3TYY A;  2KG8 A;  5KJ7 A;  1LTJ A;  4GOD A;  3A0H H;  5AW0 B;  5BU8 B;  1BSN A;  2J58 A;  3BRT B;  1LP1 A;  1PGQ A;  3KYQ A;  1YQ3 C;  1PPJ E;  2FVA A;  3JCU H;  4U0D A;  2FVE A;  4ZMD A;  1UNK A;  1NTK J;  1NOH A;  2FAC A;  1N73 C;  3CI9 A;  2A45 G;  3U1C A;  4H0L B;  1L4A C;  1LTB C;  1SQB K;  1FC2 C;  1YTZ T;  2A06 G;  1SFC A;  1P84 D;  2M8R A;  1YJ9 P;  1NTM E;  1J1E B;  1L0L J;  4H0L D;  3IF4 A;  3TSI A;  2WWW A;  2KI7 B;  3TK1 A;  4TLF A;  1FS0 E;  1PV3 A;  4OH8 B;  1KB9 I;  2WT7 A;  1RF1 B;  3MGE A;  1QX8 A;  2PEO A;  3P8C D;  3MD0 A;  2QVA A;  2E74 D;  4QMA A;  2JKV A;  5H2F H;  2XZR A;  4M0I A;  2WSF H;  2Q9I A;  1VL2 A;  2IYP A;  5KAI E;  1MFZ A;  4OGQ C;  4I1L A;  2E5T A;  1BGY D;  3WUT A;  2MF4 A;  1OFC X;  4IFM A;  3CC7 P;  2ZVO B;  5HV8 A;  3T97 A;  5DJU B;  3RK3 C;  2AF8 A;  1USE A;  1H89 A;  2HFE D;  3B5N D;  4YXW H;  1YBK A;  4C7N A;  1JM0 A;  2PFX A;  1IUQ A;  1KYO D;  2I1J A;  2CQ8 A;  1DIP A;  3EFF K;  3B5I A;  2O1K A;  1E6J P;  5KKZ B;  3AEE C;  1HJB A;  1IMQ A;  2Q3I A;  1N86 A;  3VMY A;  2E75 C;  4WB4 A;  1HJ0 A;  1ZNV A;  2QM8 A;  1M57 D;  1OW7 A;  2NRG A;  3RBZ A;  3VMZ A;  2GZG A;  3CXH H;  2P2U A;  4WYM A;  2NPS A;  2QJY C;  2BQ1 E;  2K3R A;  1LTJ C;  3H1J D;  3TF5 A;  5KJ7 C;  2G3A A;  3IFM A;  4H13 D;  2XZ1 C;  1AUM A;  1QVG O;  2AXT E;  2Q6Q A;  3GF7 A;  2XDJ A;  2JBG A;  3AE9 C;  3JC2 2;  5CJ0 A;  2GM4 A;  3L35 A;  2ZVN B;  1AF8 A;  3KDP B;  3PTZ A;  3HUS B;  3GHG A;  1NU1 J;  1YYC A;  2KNC B;  5AVS B;  1LT9 A;  5CCH A;  2QE7 H;  3AE6 C;  1KQS O;  2JWA A;  2WSS H;  5APY A;  1NKZ B;  1UJZ A;  4R4M A;  5AW6 B;  1IFI A;  2NO8 A;  2XXM A;  2KGC A;  2JO1 A;  1SQX K;  1X22 A;  3F89 A;  1IJD B;  1GW3 A;  2JQ4 A;  1SQV D;  1T6A A;  2L4B A;  2AFE A;  2IYO A;  3CX5 E;  1M1K Q;  1EMV A;  2L5G B;  3H1J G;  3AE8 C;  2AXT H;  3M06 A;  2O1J A;  1J1E C;  5KLI C;  1LTI C;  4W80 A;  2LML A;  2BHV A;  1YTZ I;  2OYI B;  3HE5 A;  4PJ0 E;  3LIE A;  3CCE P;  2N98 A;  2N6Z A;  1NTM D;  3CCS P;  4U0E A;  3R4Y A;  3Q2Y A;  3G6E P;  4PH1 A;  2K9J B;  3L72 D;  2N1T D;  3W68 A;  4XRQ A;  2HPC A;  1JMM A;  4N78 E;  3PP5 A;  3ZDM A;  1GZL A;  7CEI A;  5AVY B;  1VKU A;  2OYO A;  3CCV P;  4XA4 A;  1NH4 A;  4PWV B;  3L37 A;  1VF5 D;  1M6N A;  1KYO I;  1SQX E;  2FHS C;  2K5X A;  2KOQ A;  3D70 A;  2WPT A;  4H2X C;  1ZME C;  3AED C;  1SQV G;  3V2R A;  5B66 H;  1FAV A;  4I2L C;  1BE3 E;  2Y0D A;  3G3Z A;  3M9B A;  2NZ2 A;  2IDB A;  1KIL B;  2Z5I A;  1EZV I;  3M0D A;  1M1J C;  3H1K D;  1SQP D;  3V2N A;  3P05 A;  3Q5P A;  3VOP A;  3S1K A;  1VQ7 P;  2KSJ A;  5B5E H;  2XZ0 D;  4EOT A;  1EZV E;  2Z46 A;  3NFQ A;  4XE5 B;  1JY3 P;  1IFP A;  2VLQ A;  2IPP A;  2FVF A;  3EJE A;  1L4A D;  3Q5R A;  2LKM A;  1NTZ G;  1RF0 C;  2E43 A;  5BU5 A;  3WUU A;  1IC2 A;  1ZP0 C;  1NHL A;  4MRT C;  1SQB D;  1M6E X;  2YMY A;  1YJW P;  3DTJ A;  1BXI A;  5AVR B;  2ZYG A;  3H1J E;  2KGE A;  3CX5 D;  2Z4E A;  3KPE A;  1JY2 O;  4LC1 A;  2YKO A;  3A0H E;  1T2K C;  2WMM A;  3B5N A;  4U7J A;  3BCC G;  3HD7 D;  5CJ4 A;  2VLO A;  2XV6 A;  1SP4 A;  3MUD C;  2CPB A;  1X0T A;  4PD4 D;  1EXJ A;  1KZU B;  2JWD A;  1NTK K;  1MZ8 A;  1G2C A;  1FZC C;  1S3J A;  3H1K G;  1E79 H;  4DJG A;  1GU4 A;  4N78 D;  1VQ4 P;  3RL0 B;  1L0N E;  1PEU A;  1MFT A;  1S4X A;  1URQ A;  3MTU E;  2OYI C;  1L0I A;  2M5A A;  4QNB A;  2YKP A;  1L0N K;  1EDK A;  2K88 A;  2C9N Y;  4PXH B;  1AQ5 A;  2FYU E;  1FE6 A;  1VQ5 P;  4U3F D;  3CXH D;  1ZRT D;  3VMX A;  3GW6 A;  1SQX D;  3EFG A;  5HVC A;  1OMI A;  1RY3 A;  3B5N B;  1EIA A;  1KQF B;  2K2Q A;  1BE3 G;  2OYH A;  1FJP A;  2FY8 A;  2PEJ A;  3B8E B;  3O6Q B;  1KQL A;  4AYC A;  3H1L D;  2KB7 P;  3BCC D;  1KIL C;  2KOD A;  1FBM A;  3C1L A;  4CA3 A;  3P32 A;  5KTB A;  3G4S P;  3VP9 A;  1VQ9 P;  3PH0 A;  4BXL A;  1E0H A;  1LWU B;  1R5S A;  2VLN A;  4PV1 C;  1D1D A;  5KP7 B;  1CEI A;  1IFJ A;  1HGV A;  1JB0 J;  3FWL A;  4UHP B;  3H0D A;  2FYU K;  3HZQ A;  1L2P A;  1RHZ B;  1M1J A;  1JCD A;  1OXZ A;  3GHG B;  1ZRT E;  1NTK E;  1PPJ D;  3BAT A;  2WPS A;  2XU6 A;  3L36 A;  3DS3 A;  2KOS A;  1KV4 A;  1RH5 B;  2PGD A;  4ZNC A;  4WWI A;  3GJN A;  1H0T A;  1VQ6 P;  2GDW A;  3PJS K;  1IO4 A;  5GTI E;  1YJN P;  1QL2 A;  1SQP K;  5I4T G;  1Y8A A;  2KR5 A;  2KYV A;  4BPF A;  2MR7 A;  1SQP E;  3V2P A;  2E76 C;  3JCU E;  2JR8 A;  2A45 H;  2PEQ A;  4DCK A;  3DS4 A;  3L71 J;  1T3U A;  3GLM A;  4EIJ A;  5AVZ B;  1MKM A;  5APU A;  1N7S B;  1NTZ D;  1NU1 G;  1G1J A;  1NTZ K;  2W6B A;  3HE5 B;  1S5L E;  2BEZ F;  1VF5 B;  2YMK A;  4U3F J;  3FWN A;  2EFJ A;  2B89 A;  3DS2 A;  1A43 A;  3B4S A;  1KFN A;  1U7J A;  2WT7 B;  1FDM A;  4OGQ B;  1T8Z A;  1FU1 A;  2HLO A;  1A02 F;  5CCG C;  3A0B H;  5EJD A;  2DW3 A;  5APQ A;  2JYG A;  3U1A A;  2ZXE B;  1M56 D;  1IFN A;  4RES B;  3IAO A;  1URQ C;  5AW1 B;  1S9K E;  2FQ2 A;  2KXP B;  3O8Z A;  1BCC D;  1ZV8 A;  3BCC E;  1H8A A;  2WQY C;  1EOQ A;  3SWF A;  2L9F A;  5F2K A;  2LXC B;  2GDX A;  3PLN A;  2VLP A;  1FZA A;  2Z44 A;  2FQ1 A;  4O9B A;  3V4W A;  3W67 A;  3V5B A;  1LWU A;  1ZOY C;  2I8D A;  3L71 D;  5H2F E;  5M1B A;  3L75 J;  1JOC A;  1SFC D;  1SQV K;  1GK4 A;  3L75 G;  2VSQ A;  5AW2 B;  3RK3 E;  5AVU B;  1JJ2 O;  1L0N J;  1ZW0 A;  3MP7 B;  5L8R J;  2P58 A;  4XFZ A;  1J1D C;  4H44 D;  4PJ0 H;  2DGY A;  2ONT A;  1MUU A;  4PV1 D;  1Q82 Q;  1GXH A;  3O6Q A;  1SFC B;  2GUV A;  1USD A;  2L0Q A;  1KB9 H;  1M90 Q;  5KKZ C;  3BRV B;  1UII A;  1JMB A;  3RL0 g;  1FZF A;  1JY2 N;  5CCG A;  2K1A A;  2AVA A;  2CGQ A;  3H1L E;  4KJM A;  2WSE H;  1OR5 A;  1VQP P;  3VYI A;  2W8Z A;  2PEI A;  4WY4 C;  2E76 B;  3KZI E;  3MUD A;  2KZI A;  3TGU G;  3RK3 B;  4DT0 A;  2J59 M;  1PP9 E;  4H2W C; 
#chains in the Genus database with same CATH homology
 1N8R Q;  1ZMB A;  3CME P;  2Z46 A;  3G0V A;  5DCK A;  4GR6 A;  2M8L A;  1PEQ A;  2QEX P;  1YHQ P;  2BUO A;  1K30 A;  1IUQ A;  4COP A;  3OW2 O;  2KOD A;  4U0A A;  1M1K Q;  3VRL C;  5BS1 A;  5HGL A;  2JYG A;  1RO2 A;  3G1I A;  3G4S P;  1YI2 P;  3G1G A;  4U0D A;  1VQM P;  1QRJ A;  2E1M A;  1VQ9 P;  1K73 Q;  3I56 P;  4COC A;  3B5I A;  4XFY A;  1VQL P;  1E6J P;  2BHV A;  2Z45 A;  1M6E X;  1YJW P;  3DTJ A;  1VQK P;  4XRO A;  1VQ8 P;  1NJI Q;  3LRY A;  4PH0 A;  1EOQ A;  1D1D A;  3CMA P;  2OAR A;  5F2K A;  5HGN A;  3CCR P;  3CCE P;  2PEM A;  3CC4 P;  2JO0 A;  1RO0 A;  3CCS P;  3Q20 A;  3DS1 A;  3DS5 A;  3CPW O;  5F2O A;  4U0E A;  3H0D A;  4WYM A;  2Z44 A;  3G6E P;  3HZQ A;  4PH1 A;  1KC8 Q;  4U0B A;  1VQN P;  2BQ1 E;  2XV6 A;  3G28 A;  4XRQ A;  3CCL P;  3CCJ P;  3CC2 P;  3DS3 A;  1YIJ P;  1S72 P;  1Q81 Q;  1YJ9 P;  3G26 A;  2CWO A;  1AUM A;  1W2B O;  1QVG O;  2PY8 A;  3E2D A;  1M74 A;  2EG5 A;  2M8N A;  1JJ2 O;  3CXC O;  1YIT P;  1VQ6 P;  2L6E A;  5HGO A;  3CCV P;  4XFZ A;  5JPA A;  1M6N A;  4XFX A;  3H4E A;  2LF4 A;  3DPH A;  2JYL A;  1YJN P;  1VQ4 P;  1Q86 Q;  2DGY A;  2OTL P;  2ONT A;  3G21 A;  5I4T G;  2EIA A;  1KD1 Q;  1Q82 Q;  1PEU A;  4U0C A;  3MGE A;  1Q7Y Q;  2PEO A;  3WBH A;  4U0F A;  3CCU P;  2QA4 P;  3CCQ P;  2XT1 A;  4QNB A;  1K9M Q;  1M90 Q;  3G71 P;  1PEO A;  3NTE A;  5BS2 A;  3CD6 P;  2PEQ A;  1VQ5 P;  3DS4 A;  2P9X A;  3RG6 C;  1VQO P;  4GR2 A;  1PEM A;  4M0I A;  1KQS O;  1RNI A;  3CCM P;  1EIA A;  3HYB A;  5F2N A;  1A43 A;  1VQP P;  3G29 A;  3DS0 A;  3I55 P;  2M8P A;  2PEI A;  3H47 A;  1K8A Q;  3P05 A;  2XXM A;  2OTJ P;  1QVF O;  5HGM A;  1BAJ A;  2PEJ A;  3CC7 P;  1A8O A;  2PEK A;  4IPY A;  2PEN A;  2EFJ A;  3DS2 A;  1VQ7 P;  3M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...