3G4SP

Co-crystal structure of tiamulin bound to the large ribosomal subunit
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 42
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2009-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g4sP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3g4sP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3g4sP02
1K9MQ 2QEXP 1YJ9P 3CPWO 1K8AQ 1VQKP 1YJNP 1YI2P 3CCVP 3CC7P 3CCEP 3CC2P 3CCJP 3CMEP 1Q86Q 1VQMP 3G4SP 1QVFO 1QVGO 3CCLP 1VQ6P 3CC4P 1M1KQ 3G6EP 3CCQP 3I56P 1Q81Q 1VQ7P 1VQ9P 1KD1Q 3CCMP 1YJWP 3CXCO 1VQPP 1VQLP 3I55P 3CD6P 2OTLP 3CCSP 1M90Q 1YIJP 3G71P 3CCUP 1W2BO 1KQSO 1VQNP 1VQOP 1JJ2O 1VQ5P 1N8RQ 3CCRP 1YITP 1S72P 1Q82Q 1VQ4P 1VQ8P 1K73Q 2OTJP 1YHQP 1Q7YQ 2QA4P 3OW2O 1KC8Q 1NJIQ 3CMAP
chains in the Genus database with same CATH superfamily
3L72D 2QEXP 2QJYC 2BCCD 2QJPB 3DS0A 1PFIA 2IDBA 3ITKA 3H1IE 1SS1A 1XTCC 1PL5A 1L0ND 1JOCA 3CL3D 4IFMA 1ZRTE 1SQBE 2ZT9B 2IBZE 2CG5B 5HVCA 2Z45A 3AE9C 1X8YA 1CI6A 2FY8A 2PEOA 1N7SB 1PP9J 1M1JC 2AEMA 2BEZF 1AJYA 5APXA 1L4AD 1UIIA 4D6TE 1FZCA 4LGDE 4UB8E 1DD4A 1W2EA 4C7NB 2C0WA 3LW5H 4HH2A 5B5EE 2LKMA 2KORA 4XA4A 4EI2A 1S9KD 2CPBA 4WY4D 4IFDK 2XT1A 1SQQJ 4A7PA 2P10A 1BCCD 2FHSC 5GTIH 2MKVA 2LPKA 1T3JA 5H2FH 2C9NY 1R5SA 2I8DA 1ZMBA 3AE3C 4PD4H 2Q3IA 2KOQA 2P1JA 2FXMA 1DNYA 3HUSC 3AEEC 2LMLA 4H13D 4MRTC 2JU2A 1BXIA 2Y0DA 3I56P 3PHLA 1S5LX 3CX5E 2MVVA 1S5LH 3HE5A 2MJZA 3M0DC 1EDIA 1SFCD 1WT6A 2K37A 1IMPA 2AEFA 2BQ1E 5HGOA 1RF0C 2PGDA 5EW5E 2ZT9D 2GDXA 4PV1B 2HODA 1DEBA 2WMMA 1FZAA 4BRYA 1SP4A 3GF7A 4U0DA 4KHXA 2Y9YA 1ZR2A 1M1JA 2FADA 2WSCJ 1KYOH 3V6IA 1BE3E 2FAEA 2K2QA 5KLVK 1GU5A 3CWBD 2XZ1C 1G1IA 2KNCB 3CLQA 1AVYA 1BGYJ 3HD7A 2Z46A 2LOLA 4JYBA 1M6NA 2H88C 3V5BA 2QVAA 3HE4A 1NTKE 1NTME 3P7KA 2ZXXA 3V2NA 1Y8AA 3GKLC 1H8AA 4H2YC 1F80D 4WB4A 1PGPA 1AF8A 2IYPA 3HUSA 3VP9A 4RO0A 3EQ2A 4JQ0D 2OYHC 3RK2B 1JJ2O 3DPHA 3OW2O 3IFMA 3DS4A 3L74E 2LKIA 3M0DA 2E1MA 3PTZA 2GDWA 4YPCA 1NH4A 3SFDC 3TGUJ 1DX7A 2GZJA 2ZXEB 2E43A 1J1EC 1OIPA 3BVHA 1JY3O 2W83C 1L4AC 2AXCA 3D70A 4GKGA 4Y99C 1SQPD 3L72J 2BCCJ 1DIPA 2CPSA 1K30A 2JO1A 1L0NJ 1CW5A 4WY4C 3D6ZA 3H1KG 3CCSP 1YIJP 3VP8A 1KQSO 2ITAA 3P8CE 1OFCX 3VTPC 1FAVA 4DZOA 2CQ8A 1VDFA 2VLNA 3CMAP 5KLVD 1OW8A 1PV3A 2L9FA 1SQXE 1VQMP 1QVGO 4Z1MH 1FJKA 3RBXA 3JCUH 4H13C 3ZDMA 3AEBC 3CCRP 1VQ4P 4HJGH 1NU1D 2FYUK 2HG5D 2E75D 2OYHA 1UJZA 3L73E 2VLOA 4ZKUA 1SFCC 2K9JB 4R4MA 2Q6QA 1GK4A 1BCCJ 2A45G 4N78E 1RF1C 2ZT9C 2B87A 1M90Q 1RNIA 1LTJB 3L4FA 3WMM0 1S72P 1LT9B 2WPSA 2A45H 4EDFA 5APUA 3VRLC 1ZP0C 3L70D 3NTNA 1L4AA 1T2KD 3U59A 1IZNB 1JTHA 5APSA 1SQBK 2BHVA 5APYA 1DEEG 2LXCB 1E0HA 5TJHA 2YKOA 1OZHA 1QRJA 2QRXA 1KC8Q 1NJIQ 1JY3P 4WY4A 2PNGA 1SVFA 3RK3D 2Z5HA 4L73A 1AVOA 3CXHE 2OTLP 3A0HE 3SWYA 3A0HH 2KR5A 2N1TB 3WUTA 2PFXA 2WPRA 1KB9I 3CWBJ 4BWNA 1G1JA 3AE4C 2MF4A 3O6QA 3H1JG 1SFCA 1VQNP 2YO2A 2ZFCA 4YXDC 1RF1A 2R3CA 1JY2N 2JYLA 3BRTB 3H1JE 1KQGB 4DG9A 1P84E 4DOJA 1P84H 2GUSA 2AFEA 3P8MC 1VQ9P 1N7SA 4GDOA 3L71G 2YMYA 5AVSB 2W27A 5BS2A 1RHZB 5CCGA 3KYQA 3M0AA 3MD0A 2P67A 1NVOA 3Q5SA 3CCEP 3KXDA 2K92A 1LWUB 1QEXA 1A43A 1PGQA 2WWWA 2WPQA 3H1LG 2NPSB 5KAIE 5KAIH 1T3UA 1SQPJ 2WSEH 3GHGC 3H1HG 4I7ZB 5AW1B 1IFNA 2Z44A 1EZVI 2V7QJ 1BAJA 2E75C 4IOIH 1YJWP 2M0BA 4LLHA 4PD4I 1LTSC 1RQVA 1HJBA 3A5TA 3HD7D 1M8OB 4GOFA 2K0XA 1VQ8P 1NTKK 2WSFH 1NTMK 4O9BA 2H43A 5KLVJ 2KS1B 2K0DX 5E79H 1HGVA 3DS2A 5B66E 4CA3A 3MTUE 2JWDA 1IK9A 5B66H 4BPHA 3AE5C 2PP6A 2KW2A 1T2KC 3D6YA 4PD4D 1NU1J 1PPJG 2KG8A 2CNRA 2PEIA 3EJDA 3KZIH 3RBZA 3U43A 2KSEA 1JNMA 3H32A 1VQKP 2KZIA 1PPJE 4NPEA 2WPTA 3RL0g 1MUUA 3GLMA 1M56D 3RK3C 2KNCA 4H44D 1HY8A 3CI9A 2N6ZA 1YYCA 2E76B 2IYOA 1JCDA 1GXGA 1KILE 1Y47A 2XNXA 2R5DA 3L70J 3H6PA 2R44A 2CK3H 2WZ7A 3GHGA 3V4QA 2M8PA 4N3YB 1SQVE 5KKZB 2KK7A 2FYUG 1OXZA 1OVVA 2B9BA 1Z56A 1KYOD 1J1DB 2D2CB 2E74D 3Q5RA 3R2PA 5CCHA 1GL2B 2G3AA 1FZEA 5APQA 5CBNA 3BCCE 1SQXK 1CSBA 1TU3F 2LR2A 4BPFA 4I6MC 4XFYA 1M74A 2KSJA 1ZN5A 2JDIH 1MZ8A 4NEOA 1T8KA 3N7NA 1VQOP 4COPA 2AXTH 3H1IG 4U0BA 4H0LB 2OYIB 4AUWA 2L0QA 4DCKA 3B4SA 3V4WA 3GW6A 1KB9E 4RKUJ 1SQBG 3OA7A 2IBZG 1PP9E 2GM4A 3MHVA 5AW3B 3E1RA 2YIUB 3H25A 4JF7A 3H4EA 2GDYA 2YMKA 3M1MA 2IPPA 1HQBA 1KN7A 2N5HA 3O8ZA 1USDA 4D6TG 2KGEA 1PEMA 1H0TA 2VRSA 1E5WA 5EJDA 2E76D 3AE7C 1SQQE 3AEGC 3L37A 3SWKA 4GOEA 3OJAB 4OH8B 2N50A 1PEUA 4UB8H 2WSSH 2FYNC 1L0LE 5B5EH 1LTGC 1ZR4A 3HD7C 1KTMA 1YJNP 1QVFO 2GA1A 2D2CD 1EDLA 3F89A 1UIXA 3H0DA 2Q1KA 3R4YA 3T97B 4HKGA 3ABVC 2K9YA 1ZW0A 1Q82Q 3P8CD 2BEQD 2QA4P 1JM0A 1PGJA 3RG6C 1H89A 1LTJA 3USSA 3H1KD 2WTYA 3FWLA 5KLIB 2A06E 3CCVP 4WWIA 2GZFA 1EZVE 2VLPA 2QNWA 1NAYA 2AF8A 3VMZA 3WU2E 3Q1MA 3LW5J 3CCUP 3CX5H 4I1LA 2IFMA 2QM7A 3CE7A 3TNUA 4H44C 1W2BO 3WUVA 1FR2A 4JYCA 1LWUC 1IFPA 3JC22 3HTKB 2XXMA 2ZVOB 1BE3G 3MUDC 1BGYE 5AW5B 3K5BA 1VQPP 3I55P 2XZRA 2I1JA 3BRVB 1ZV8A 1N7SD 1W5CE 1WRGA 5F2NA 3UIAA 3NFQA 5CCGD 5AW2B 2EG5A 3KQGA 1IO4A 2E74C 3TDKA 1Q86Q 4U7JA 2XV5A 1NTKG 2V4HA 1NTMG 4BPGA 2Q5UA 5KP7B 2WVRA 2FFDB 1KV4A 1LP1A 1EIAA 1NGMB 1JMMA 2EHSA 1NO4A 1AQTA 1X9VA 1U7MA 5GTHE 1NHLA 5GTHH 4AQRD 2KGCA 3LIEA 2HLOA 2OGUA 3L74G 1HBWA 1URQB 4HKZH 3FX0A 3TGUE 1AYIA 3V2RA 2R5BA 3L72E 2BCCE 2LL8A 4NPFX 1FZFA 3RL0B 2XV6A 4R0MA 2E5TA 4ZKPA 1N73C 2PAJA 3EJBA 1GW4A 5CHXA 1L0NE 1LWUA 5EFWB 1ZMEC 1M57D 2Z4EA 2E76C 1ZNVA 2OQQA 3TYYA 3MUDA 4PV1D 2M5AB 3PRJA 2N5IA 3AE8C 5BS1A 2VLQA 1GZLA 1AUMA 3H1JD 1GDTA 3FGAD 2QG4A 1FJPA 1P84D 1HVVA 2ZYGA 2JYGA 1L2PA 3P05A 2ONTA 2D2CC 1EDKA 3LMOA 1SQXG 4XFXA 1K9MQ 3L71D 1USEA 2L22A 1SQVK 2DW3A 2KS1A 2W90A 2H89C 1LGHB 1BCCE 1KILB 3L73G 1BDDA 1CI6B 5JPAA 2GYKA 4IZ6A 1NTZE 3B5NB 2G8YA 3H1LD 2QJPC 1VF5B 1PEQA 2N98A 4IL6E 1WMKA 1Q90D 4IPYA 4PXHB 1IFMA 5CCHD 1FZCB 2HYNA 3RK2D 1ZXGA 2NO8A 2WITA 5DJUB 1K05A 3H1HD 1IC2A 2XDJA 3AEDC 2ERHA 1JO5A 1N73A 2PEMA 4BXLA 2XKMA 1HH0A 3H1KJ 1M7LA 2FBWC 2K93A 1N7SC 3NTEA 1R8EA 1K04A 5CCGC 3VMYA 4PWVB 3W68A 1FOSF 3IN6A 2POHA 4C7RA 1RO2A 1N2DC 2JKVA 2QJYB 3CWBE 2L91A 1FC2C 1PPJD 1GW3A 1SQQK 1JUNA 1XTGB 1M6EX 2OYOA 3CXHH 4UB6E 3QH9A 4UB6H 2YKPA 2KZJA 3L75G 4KT0J 1L0LK 4PJ0E 5KLIC 1DV5A 1GPJA 2M8RA 1S3JA 3B5IA 4BRYB 2OYIA 1DD3A 3L75E 1M1JB 3U1CA 5AW8B 3MGEA 2KOGA 3B5ND 2AEJA 1VF5D 2QM8A 2ZAEB 4C46A 1YITP 1UNKA 1FS0E 4EIJA 2O3JA 2FVFA 2FYUD 3EFGA 2QSIA 4PV1C 2K5XA 4GR6A 3HE4B 4OGQB 3Q2YA 2IBZI 4I2LC 1BSNA 2R3SA 1SQPE 2FXPA 3WUUA 2LIWA 4C7NA 1X79B 3HUSB 3G1GA 2LF4A 3H1ID 2P7JA 3II6A 2FFDC 3L35A 1OR5A 1OWAA 1ZRTD 1SQBD 4HB1A 5AVXB 2IBZD 2JWAA 3EJEA 3H1JJ 1IFDA 4GIFA 5HGLA 4U0CA 1LJ2A 2FQ0A 1OW6A 1VQ7P 1LNQA 3GZLA 2XZ0D 1AA0A 2N1TD 4D6TD 5CCHC 4R4LA 3G0VA 3RK2C 2GZEA 3AECC 5AVUB 1NU1E 3L36A 1GD2E 3L71J 2VSQA 1OVUA 2KODA 3Q5PA 1OMIA 1RY3A 5AVVB 1JEKA 5AVZB 1KQFB 2K3RA 2O01H 1GTWA 1QLED 3GJNA 1VQLP 2JB0A 3HTKA 3C1LA 2WSEJ 5KAFE 1KQLA 3KDPB 3H1LJ 4OGQD 3S1KA 4U3FG 2M8LA 3CC2P 3CCJP 3L70E 5AW7B 3CC4P 1L0NK 2N6YA 1HGZA 3H1HJ 4RESB 3CX5D 2GUVA 2WSFJ 1KYOI 1T6AA 4U3FE 2KOOA 2OYHB 4U0AA 5HGNA 3EFFK 2FFDA 1SQVG 1DH3A 3NY7B 2W6BA 4GODA 2P58A 1A02J 3SWFA 3RK3E 4TLFA 2NPSD 2M5RA 2RKLA 2KGDA 2MR7A 1VKUA 3AEFC 1RQUA 3CCMP 3EWKA 5C39A 2FVAA 3BCCG 1D7MA 3A0BE 2H8PD 2PRRA 1BE3D 3B5NC 1VF5C 4Y99B 1LTAC 1JTHB 2WT7B 2MR8A 2M3BA 2NRGA 3M9HA 3G6EP 3Q20A 1R5LA 3CD6P 1JY2O 1SLQA 4WY4B 1LTJC 3MZWB 2H7HA 1LT9C 1NTZK 3M9BA 1EXJA 1PP9G 1JB0J 1NTKD 1NTMD 2XNDH 3AE1C 2WQYC 2M5AA 1KB9H 5M1BA 1RE4C 2QE7H 2L4BA 1NYHA 4DT0A 3CXCO 4H13B 1RO0A 5AVQB 1RE3C 3GG2A 1K73Q 3GF3A 3Q3DA 1OVRA 4WYMA 2FYUJ 3L74D 3E2DA 1SQQG 2JP3A 3O6QB 5AVWB 1G2CB 1SFCB 1NOHA 1YTZT 2L6EA 1L0LG 4JPZB 3IF4A 1RF1B 3BATA 3G21A 2KUBA 4KJMA 3LRYA 1KILA 3S9OA 2JGPA 4XFJA 3DTJA 4YXWH 2N1TC 4B86A 4QMAA 2K0YA 3H1IJ 1JY3N 3B5NA 3AEAC 1M1KQ 1HWTC 3G29A 1GL2D 1SQBJ 2K9JA 2L5GB 1GMJA 2A06G 1IUQA 1EZVG 2DNWA 5AW0B 1LT9A 3E1IA 5BU8B 5CMZA 1SQXD 4OGQC 3VMXA 5GTIE 4L76A 1KD1Q 4H0LD 5H2FE 4D6TJ 1PGOA 2DGYA 1GK6A 4PD4E 3WU2H 1JY2P 1RE4A 2GZGA 7CEIA 1VHNA 2JAZA 1JMBA 2B89A 1NTZD 2A45I 1L0LJ 4L74A 1LTBC 1A8OA 2WSCH 1BGYG 3L73D 1RE3A 2Q9IA 1YI2P 2JQ4A 2BUOA 4UHPB 2KP8A 1EOQA 3CCQP 3MIWA 4K3AA 2PEKA 2AVAA 2KOSA 1KLPA 1S5LE 2Q7CA 1S2EA 4WBAA 3TF5A 4N78D 2K94A 2NPSC 2HFED 2K1AA 3GMAA 2QIWA 1SQPK 3M91A 4XE5B 3DS5A 4H2XC 1EQ7A 4I7ZC 2LIUA 4U0EA 3M9QA 3IAOA 4JBZA 1LT1A 2KG6A 2KWLA 2N1TA 3CXHI 2JEEA 1EMVA 4M0IA 3C9IA 2HR3A 2ROQA 1KYOE 1FU1A 3H32B 3VMAA 1S1CX 1KZUB 5AW9B 1MKMA 1E6JP 3IR9A 1L0HA 2O01N 2YNYA 4XFZA 3DS1A 1KFNA 1QGKB 3B8EB 1FDIA 3D71A 3TGUG 2CGQA 2J5UA 3CXHD 3L72G 4EOTA 1FZBA 1U7JA 2MY5A 2B88A 2BCCG 1NU1K 3G28A 2LXBA 1BE3J 2J59M 2KI7B 3GHGB 3SSUA 2HPCB 1L0NG 4YTPC 1OX3A 1P84I 3G3ZA 3NXSA 3TSIA 2W8ZA 3L75D 2RMZA 4ASVA 5AW6B 2E75B 5DJTB 3FXEA 3JSVC 3DS3A 1NTKJ 1H88A 1NTMJ 4PH1A 1AQ5A 2EFJA 2NPSA 5AVRB 2RN0A 2O1KA 1BDCA 5KKZC 3HYBA 2JBGA 5CJ4A 1RF0A 2Q3EA 2QJKB 1J1DC 1X22A 1GL2C 3L74J 1ZOYC 1BCCG 2ZJSE 2BASA 5CZDB 2IZ0A 2J58A 1S9KE 5KJ7D 1AFOA 1LTIC 1NTZG 1IFJA 1PEOA 3B71A 3RK3B 1HUCA 5F2OA 3HRNA 1CZQA 4N6JA 1Q2NA 2SPZA 1PZQA 5APVA 3VYIA 4H0LC 2OYIC 1H0TB 3H1KE 1KORA 4IL6X 3CC7P 1URQD 1X3OA 2CWOA 3A3YB 4RJTA 2C9LY 1EXIA 4IL6H 3G4SP 4NPDA 4AYCA 1E79H 5L8RJ 3JCUE 2YIUC 2EIAA 1GXHA 2E5YA 4ASWA 3G71P 1GU4A 3VN0A 3RL0D 3A7OA 2YXRB 4H2WC 3C8VA 1FE6A 4W7YA 1SQXJ 4ZNCA 2OTKE 3E7KA 1OW7A 5I4TG 3CWBG 2IFNA 1NTZJ 2FXOA 5AW4B 3L73J 5AVYB 4OVNF 4XRQA 3G9RA 2JU1A 3A2AA 2Y9ZA 3G1IA 2N9YB 1AV1A 1GL2A 1QL1A 3HE5B 1IK7A 2WT7A 3TNUB 2KYVA 1YQ3C 4U3FD 1VQ5P 4HYTB 3WBHA 1ACPA 2HODB 3M06A 4PJ0H 1KILD 1IMQA 3HZQA 3H47A 4GT1A 4ZMDA 3CCLP 1VQ6P 2KB7P 1SQVD 2KXPB 1QX8A 1FDOA 1A02F 4WVZA 4QNBA 4CPGA 2FYNB 5F2KA 1YJ9P 3BCCD 2KGAA 3V2PA 3HD7B 1HTLC 4W7ZA 4OWFA 5HV8A 2PEQA 1L0IA 3RGUA 1KFMA 1LP1B 5KP8B 2O1JA 2ZYDA 3G26A 1SQPG 4XROA 2I1KA 1G2CA 5APWA 2JR8A 1J2JB 5APTA 2Y0CA 1PIXA 3AE6C 2XU6A 1MFZA 1JCCA 5AVTB 2KOPA 2OARA 1VL2A 2WPVB 1Y9BA 1KB9D 2UWJE 2MD9A 3PH0A 4F37A 3CMEP 3L75J 1PP9D 2Z5IA 2KLUA 3PJSK 2MVUA 2V7QH 5KJ7C 5KLVG 1FDMA 1NQ4A 1MV8A 3QWOC 3VOPA 2RH0A 1IJDB 2Y0EA 5CJ0A 1LTTC 3W67A 3T97A 3L71E 3FXDA 1EDJA 4H44B 3RG2A 1X0TA 4PH0A 3KPEA 5KLVE 1NKZB 1QL2A 2ZVNB 1FOSE 1NU1G 2P2UA 2GZIA 1S4XA 1BSHA 1SQQD 2FVEA 5HGMA 1URQC 3AE2C 2YKQA 2OTJP 2EHTA 1Q7YQ 3GZMA 2IX7C 2IZ1A 1FZGA 2C0XA 3H1LE 1L0LD 4DJGA 2PENA 3RL0C 2P9XA 2E74B 2K88A 3TK1A 3CX5I 4EYYQ 3H1HE 4LC1A 4Y28J 4COCA 5KTBA 1Z6MA 3L70G 1YHQP 3MP7B 1RH5B 3LIDA 5KAFH 5E79E 1T8ZA 2AFDA 2JO0A 1EC5A 1HJ0A 2A06D 2W6JH 1YBKA 1MZ9A 4GR2A 1EZVD 3N4XA 2QJKC 1MFTA 3KZIE 2R32A 1U57A 2KG9A 3P32A 3BASA 2FQ1A 4W80A 5TISE 5KJ7A 3F5HA 5TISH 1VPCA 2KLVA 1ZLLA 1FBMA 2O01J 2B87B 3NMDA 1Q81Q 1N73B 1KILC 1BGYD 5KP6B 4IFFA 2YXQB 3S4RA 1YTZI 5DCKA 1IFIA 3V2QA 2FKWB 1KMIZ 2FYZA 3A0BH 2ZYAA 2M3EA 1J1EB 1URQA 4M3LA 1L4AB 3CPWO 4U0FA 1FZCC 2N9BA 2KIKA 5BVZA 3B4QA 1HF9A 2HPCA 3U1AA 4MN4C 1NWQA 1N7LA 2JJLA 1NAFA 2LTEA 4U3FJ 3MGNA 3PP5A 4L75A 1NKNA 2FQ2A 3I5CA 1N8RQ 1CEIA 2PY8A 1N86A 2NZ2A 2W6AA 2FYUE 4K35A 2X2BA 1K8AQ 3PLNA 1D1DA 5BU5A 3SFEC 4QKOA 1SQVJ 2FACA 4TT3H 2M8NA 2E42A 2YO3A 5CBOA 3FWNA 3OAKA 2AXTE 1YQ4C 5K5GB 3KHUA 3TGUD 2PEJA 3BCCJ
chains in the Genus database with same CATH topology
5HGOA 5F2KA 2QEXP 1YJ9P 2JO0A 4XFZA 3DS1A 3NTEA 3CCVP 3CC7P 2XV6A 2Z44A 2CWOA 3DS0A 2PEQA 3G4SP 3G1GA 2LF4A 1K30A 1BAJA 1M1KQ 3G26A 4GR2A 4XFYA 1M74A 2EIAA 3CCMP 4XROA 3G29A 1YJWP 2OTLP 4U0DA 3CCSP 1YIJP 3G71P 3CCUP 1KQSO 1VQOP 3G28A 4COPA 1VQ8P 2Z45A 1IUQA 4U0BA 3CMAP 1W2BO 1RO2A 2PEOA 5BS1A 2OARA 1AUMA 5HGLA 4U0CA 3DS2A 3CMEP 1VQMP 1QVGO 2XXMA 3G6EP 1Q81Q 1VQ7P 3Q20A 2Z46A 2JYGA 1KD1Q 1VQPP 2DGYA 3I55P 3CD6P 3P05A 5I4TG 3G0VA 1M6EX 3H4EA 2ONTA 1VQNP 5DCKA 1M6NA 3CCRP 1VQ4P 2PEIA 3DS3A 3M1MA 4XFXA 4PH1A 2EFJA 5F2NA 1A8OA 1K9MQ 2JYLA 1VQKP 3CPWO 4XRQA 4PH0A 2KODA 2EG5A 3G1IA 3B5IA 1YI2P 1PEMA 4U0FA 2BUOA 1Q86Q 2XT1A 1EOQA 3CCQP 3HYBA 2PEKA 3MGEA 1VQ9P 5HGMA 1VQLP 3CXCO 1M90Q 1RNIA 1RO0A 5JPAA 1EIAA 1JJ2O 1VQ5P 1N8RQ 5BS2A 1YITP 1ZMBA 3DPHA 1S72P 2OTJP 1K73Q 1PEUA 3WBHA 1Q7YQ 3OW2O 3DS4A 4WYMA 2PY8A 3DS5A 3E2DA 2PENA 1K8AQ 1PEQA 3VRLC 4U0EA 3HZQA 1YJNP 3H47A 2M8LA 1D1DA 2E1MA 2P9XA 4IPYA 3CCJP 3CC2P 3CCEP 1QVFO 2M8PA 1A43A 3CC4P 3CCLP 1VQ6P 3I56P 4GR6A 2M8NA 2BHVA 4M0IA 3H0DA 2L6EA 1PEOA 4COCA 5F2OA 4U0AA 5HGNA 3G21A 1Q82Q 2PEMA 3LRYA 1QRJA 4QNBA 3DTJA 1YHQP 1E6JP 2QA4P 3RG6C 2PEJA 1KC8Q 1NJIQ 2BQ1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M Q;  2QEX P;  1YJ9 P;  3CPW O;  1K8A Q;  1VQK P;  1YJN P;  1YI2 P;  3CCV P;  3CC7 P;  3CCE P;  3CC2 P;  3CCJ P;  3CME P;  1Q86 Q;  1VQM P;  3G4S P;  1QVF O;  1QVG O;  3CCL P;  1VQ6 P;  3CC4 P;  1M1K Q;  3G6E P;  3CCQ P;  3I56 P;  1Q81 Q;  1VQ7 P;  1VQ9 P;  1KD1 Q;  3CCM P;  1YJW P;  3CXC O;  1VQP P;  1VQL P;  3I55 P;  3CD6 P;  2OTL P;  3CCS P;  1M90 Q;  1YIJ P;  3G71 P;  3CCU P;  1W2B O;  1KQS O;  1VQN P;  1VQO P;  1JJ2 O;  1VQ5 P;  1N8R Q;  3CCR P;  1YIT P;  1S72 P;  1Q82 Q;  1VQ4 P;  1VQ8 P;  1K73 Q;  2OTJ P;  1YHQ P;  1Q7Y Q;  2QA4 P;  3OW2 O;  1KC8 Q;  1NJI Q;  3CMA P; 
#chains in the Genus database with same CATH topology
 3L72 D;  2QEX P;  2QJY C;  2BCC D;  2QJP B;  3DS0 A;  1PFI A;  2IDB A;  3ITK A;  3H1I E;  1SS1 A;  1XTC C;  1PL5 A;  1L0N D;  1JOC A;  3CL3 D;  4IFM A;  1ZRT E;  1SQB E;  2ZT9 B;  2IBZ E;  2CG5 B;  5HVC A;  2Z45 A;  3AE9 C;  1X8Y A;  1CI6 A;  2FY8 A;  2PEO A;  1N7S B;  1PP9 J;  1M1J C;  2AEM A;  2BEZ F;  1AJY A;  5APX A;  1L4A D;  1UII A;  4D6T E;  1FZC A;  4LGD E;  4UB8 E;  1DD4 A;  1W2E A;  4C7N B;  2C0W A;  3LW5 H;  4HH2 A;  5B5E E;  2LKM A;  2KOR A;  4XA4 A;  4EI2 A;  1S9K D;  2CPB A;  4WY4 D;  4IFD K;  2XT1 A;  1SQQ J;  4A7P A;  2P10 A;  1BCC D;  2FHS C;  5GTI H;  2MKV A;  2LPK A;  1T3J A;  5H2F H;  2C9N Y;  1R5S A;  2I8D A;  1ZMB A;  3AE3 C;  4PD4 H;  2Q3I A;  2KOQ A;  2P1J A;  2FXM A;  1DNY A;  3HUS C;  3AEE C;  2LML A;  4H13 D;  4MRT C;  2JU2 A;  1BXI A;  2Y0D A;  3I56 P;  3PHL A;  1S5L X;  3CX5 E;  2MVV A;  1S5L H;  3HE5 A;  2MJZ A;  3M0D C;  1EDI A;  1SFC D;  1WT6 A;  2K37 A;  1IMP A;  2AEF A;  2BQ1 E;  5HGO A;  1RF0 C;  2PGD A;  5EW5 E;  2ZT9 D;  2GDX A;  4PV1 B;  2HOD A;  1DEB A;  2WMM A;  1FZA A;  4BRY A;  1SP4 A;  3GF7 A;  4U0D A;  4KHX A;  2Y9Y A;  1ZR2 A;  1M1J A;  2FAD A;  2WSC J;  1KYO H;  3V6I A;  1BE3 E;  2FAE A;  2K2Q A;  5KLV K;  1GU5 A;  3CWB D;  2XZ1 C;  1G1I A;  2KNC B;  3CLQ A;  1AVY A;  1BGY J;  3HD7 A;  2Z46 A;  2LOL A;  4JYB A;  1M6N A;  2H88 C;  3V5B A;  2QVA A;  3HE4 A;  1NTK E;  1NTM E;  3P7K A;  2ZXX A;  3V2N A;  1Y8A A;  3GKL C;  1H8A A;  4H2Y C;  1F80 D;  4WB4 A;  1PGP A;  1AF8 A;  2IYP A;  3HUS A;  3VP9 A;  4RO0 A;  3EQ2 A;  4JQ0 D;  2OYH C;  3RK2 B;  1JJ2 O;  3DPH A;  3OW2 O;  3IFM A;  3DS4 A;  3L74 E;  2LKI A;  3M0D A;  2E1M A;  3PTZ A;  2GDW A;  4YPC A;  1NH4 A;  3SFD C;  3TGU J;  1DX7 A;  2GZJ A;  2ZXE B;  2E43 A;  1J1E C;  1OIP A;  3BVH A;  1JY3 O;  2W83 C;  1L4A C;  2AXC A;  3D70 A;  4GKG A;  4Y99 C;  1SQP D;  3L72 J;  2BCC J;  1DIP A;  2CPS A;  1K30 A;  2JO1 A;  1L0N J;  1CW5 A;  4WY4 C;  3D6Z A;  3H1K G;  3CCS P;  1YIJ P;  3VP8 A;  1KQS O;  2ITA A;  3P8C E;  1OFC X;  3VTP C;  1FAV A;  4DZO A;  2CQ8 A;  1VDF A;  2VLN A;  3CMA P;  5KLV D;  1OW8 A;  1PV3 A;  2L9F A;  1SQX E;  1VQM P;  1QVG O;  4Z1M H;  1FJK A;  3RBX A;  3JCU H;  4H13 C;  3ZDM A;  3AEB C;  3CCR P;  1VQ4 P;  4HJG H;  1NU1 D;  2FYU K;  2HG5 D;  2E75 D;  2OYH A;  1UJZ A;  3L73 E;  2VLO A;  4ZKU A;  1SFC C;  2K9J B;  4R4M A;  2Q6Q A;  1GK4 A;  1BCC J;  2A45 G;  4N78 E;  1RF1 C;  2ZT9 C;  2B87 A;  1M90 Q;  1RNI A;  1LTJ B;  3L4F A;  3WMM 0;  1S72 P;  1LT9 B;  2WPS A;  2A45 H;  4EDF A;  5APU A;  3VRL C;  1ZP0 C;  3L70 D;  3NTN A;  1L4A A;  1T2K D;  3U59 A;  1IZN B;  1JTH A;  5APS A;  1SQB K;  2BHV A;  5APY A;  1DEE G;  2LXC B;  1E0H A;  5TJH A;  2YKO A;  1OZH A;  1QRJ A;  2QRX A;  1KC8 Q;  1NJI Q;  1JY3 P;  4WY4 A;  2PNG A;  1SVF A;  3RK3 D;  2Z5H A;  4L73 A;  1AVO A;  3CXH E;  2OTL P;  3A0H E;  3SWY A;  3A0H H;  2KR5 A;  2N1T B;  3WUT A;  2PFX A;  2WPR A;  1KB9 I;  3CWB J;  4BWN A;  1G1J A;  3AE4 C;  2MF4 A;  3O6Q A;  3H1J G;  1SFC A;  1VQN P;  2YO2 A;  2ZFC A;  4YXD C;  1RF1 A;  2R3C A;  1JY2 N;  2JYL A;  3BRT B;  3H1J E;  1KQG B;  4DG9 A;  1P84 E;  4DOJ A;  1P84 H;  2GUS A;  2AFE A;  3P8M C;  1VQ9 P;  1N7S A;  4GDO A;  3L71 G;  2YMY A;  5AVS B;  2W27 A;  5BS2 A;  1RHZ B;  5CCG A;  3KYQ A;  3M0A A;  3MD0 A;  2P67 A;  1NVO A;  3Q5S A;  3CCE P;  3KXD A;  2K92 A;  1LWU B;  1QEX A;  1A43 A;  1PGQ A;  2WWW A;  2WPQ A;  3H1L G;  2NPS B;  5KAI E;  5KAI H;  1T3U A;  1SQP J;  2WSE H;  3GHG C;  3H1H G;  4I7Z B;  5AW1 B;  1IFN A;  2Z44 A;  1EZV I;  2V7Q J;  1BAJ A;  2E75 C;  4IOI H;  1YJW P;  2M0B A;  4LLH A;  4PD4 I;  1LTS C;  1RQV A;  1HJB A;  3A5T A;  3HD7 D;  1M8O B;  4GOF A;  2K0X A;  1VQ8 P;  1NTK K;  2WSF H;  1NTM K;  4O9B A;  2H43 A;  5KLV J;  2KS1 B;  2K0D X;  5E79 H;  1HGV A;  3DS2 A;  5B66 E;  4CA3 A;  3MTU E;  2JWD A;  1IK9 A;  5B66 H;  4BPH A;  3AE5 C;  2PP6 A;  2KW2 A;  1T2K C;  3D6Y A;  4PD4 D;  1NU1 J;  1PPJ G;  2KG8 A;  2CNR A;  2PEI A;  3EJD A;  3KZI H;  3RBZ A;  3U43 A;  2KSE A;  1JNM A;  3H32 A;  1VQK P;  2KZI A;  1PPJ E;  4NPE A;  2WPT A;  3RL0 g;  1MUU A;  3GLM A;  1M56 D;  3RK3 C;  2KNC A;  4H44 D;  1HY8 A;  3CI9 A;  2N6Z A;  1YYC A;  2E76 B;  2IYO A;  1JCD A;  1GXG A;  1KIL E;  1Y47 A;  2XNX A;  2R5D A;  3L70 J;  3H6P A;  2R44 A;  2CK3 H;  2WZ7 A;  3GHG A;  3V4Q A;  2M8P A;  4N3Y B;  1SQV E;  5KKZ B;  2KK7 A;  2FYU G;  1OXZ A;  1OVV A;  2B9B A;  1Z56 A;  1KYO D;  1J1D B;  2D2C B;  2E74 D;  3Q5R A;  3R2P A;  5CCH A;  1GL2 B;  2G3A A;  1FZE A;  5APQ A;  5CBN A;  3BCC E;  1SQX K;  1CSB A;  1TU3 F;  2LR2 A;  4BPF A;  4I6M C;  4XFY A;  1M74 A;  2KSJ A;  1ZN5 A;  2JDI H;  1MZ8 A;  4NEO A;  1T8K A;  3N7N A;  1VQO P;  4COP A;  2AXT H;  3H1I G;  4U0B A;  4H0L B;  2OYI B;  4AUW A;  2L0Q A;  4DCK A;  3B4S A;  3V4W A;  3GW6 A;  1KB9 E;  4RKU J;  1SQB G;  3OA7 A;  2IBZ G;  1PP9 E;  2GM4 A;  3MHV A;  5AW3 B;  3E1R A;  2YIU B;  3H25 A;  4JF7 A;  3H4E A;  2GDY A;  2YMK A;  3M1M A;  2IPP A;  1HQB A;  1KN7 A;  2N5H A;  3O8Z A;  1USD A;  4D6T G;  2KGE A;  1PEM A;  1H0T A;  2VRS A;  1E5W A;  5EJD A;  2E76 D;  3AE7 C;  1SQQ E;  3AEG C;  3L37 A;  3SWK A;  4GOE A;  3OJA B;  4OH8 B;  2N50 A;  1PEU A;  4UB8 H;  2WSS H;  2FYN C;  1L0L E;  5B5E H;  1LTG C;  1ZR4 A;  3HD7 C;  1KTM A;  1YJN P;  1QVF O;  2GA1 A;  2D2C D;  1EDL A;  3F89 A;  1UIX A;  3H0D A;  2Q1K A;  3R4Y A;  3T97 B;  4HKG A;  3ABV C;  2K9Y A;  1ZW0 A;  1Q82 Q;  3P8C D;  2BEQ D;  2QA4 P;  1JM0 A;  1PGJ A;  3RG6 C;  1H89 A;  1LTJ A;  3USS A;  3H1K D;  2WTY A;  3FWL A;  5KLI B;  2A06 E;  3CCV P;  4WWI A;  2GZF A;  1EZV E;  2VLP A;  2QNW A;  1NAY A;  2AF8 A;  3VMZ A;  3WU2 E;  3Q1M A;  3LW5 J;  3CCU P;  3CX5 H;  4I1L A;  2IFM A;  2QM7 A;  3CE7 A;  3TNU A;  4H44 C;  1W2B O;  3WUV A;  1FR2 A;  4JYC A;  1LWU C;  1IFP A;  3JC2 2;  3HTK B;  2XXM A;  2ZVO B;  1BE3 G;  3MUD C;  1BGY E;  5AW5 B;  3K5B A;  1VQP P;  3I55 P;  2XZR A;  2I1J A;  3BRV B;  1ZV8 A;  1N7S D;  1W5C E;  1WRG A;  5F2N A;  3UIA A;  3NFQ A;  5CCG D;  5AW2 B;  2EG5 A;  3KQG A;  1IO4 A;  2E74 C;  3TDK A;  1Q86 Q;  4U7J A;  2XV5 A;  1NTK G;  2V4H A;  1NTM G;  4BPG A;  2Q5U A;  5KP7 B;  2WVR A;  2FFD B;  1KV4 A;  1LP1 A;  1EIA A;  1NGM B;  1JMM A;  2EHS A;  1NO4 A;  1AQT A;  1X9V A;  1U7M A;  5GTH E;  1NHL A;  5GTH H;  4AQR D;  2KGC A;  3LIE A;  2HLO A;  2OGU A;  3L74 G;  1HBW A;  1URQ B;  4HKZ H;  3FX0 A;  3TGU E;  1AYI A;  3V2R A;  2R5B A;  3L72 E;  2BCC E;  2LL8 A;  4NPF X;  1FZF A;  3RL0 B;  2XV6 A;  4R0M A;  2E5T A;  4ZKP A;  1N73 C;  2PAJ A;  3EJB A;  1GW4 A;  5CHX A;  1L0N E;  1LWU A;  5EFW B;  1ZME C;  1M57 D;  2Z4E A;  2E76 C;  1ZNV A;  2OQQ A;  3TYY A;  3MUD A;  4PV1 D;  2M5A B;  3PRJ A;  2N5I A;  3AE8 C;  5BS1 A;  2VLQ A;  1GZL A;  1AUM A;  3H1J D;  1GDT A;  3FGA D;  2QG4 A;  1FJP A;  1P84 D;  1HVV A;  2ZYG A;  2JYG A;  1L2P A;  3P05 A;  2ONT A;  2D2C C;  1EDK A;  3LMO A;  1SQX G;  4XFX A;  1K9M Q;  3L71 D;  1USE A;  2L22 A;  1SQV K;  2DW3 A;  2KS1 A;  2W90 A;  2H89 C;  1LGH B;  1BCC E;  1KIL B;  3L73 G;  1BDD A;  1CI6 B;  5JPA A;  2GYK A;  4IZ6 A;  1NTZ E;  3B5N B;  2G8Y A;  3H1L D;  2QJP C;  1VF5 B;  1PEQ A;  2N98 A;  4IL6 E;  1WMK A;  1Q90 D;  4IPY A;  4PXH B;  1IFM A;  5CCH D;  1FZC B;  2HYN A;  3RK2 D;  1ZXG A;  2NO8 A;  2WIT A;  5DJU B;  1K05 A;  3H1H D;  1IC2 A;  2XDJ A;  3AED C;  2ERH A;  1JO5 A;  1N73 A;  2PEM A;  4BXL A;  2XKM A;  1HH0 A;  3H1K J;  1M7L A;  2FBW C;  2K93 A;  1N7S C;  3NTE A;  1R8E A;  1K04 A;  5CCG C;  3VMY A;  4PWV B;  3W68 A;  1FOS F;  3IN6 A;  2POH A;  4C7R A;  1RO2 A;  1N2D C;  2JKV A;  2QJY B;  3CWB E;  2L91 A;  1FC2 C;  1PPJ D;  1GW3 A;  1SQQ K;  1JUN A;  1XTG B;  1M6E X;  2OYO A;  3CXH H;  4UB6 E;  3QH9 A;  4UB6 H;  2YKP A;  2KZJ A;  3L75 G;  4KT0 J;  1L0L K;  4PJ0 E;  5KLI C;  1DV5 A;  1GPJ A;  2M8R A;  1S3J A;  3B5I A;  4BRY B;  2OYI A;  1DD3 A;  3L75 E;  1M1J B;  3U1C A;  5AW8 B;  3MGE A;  2KOG A;  3B5N D;  2AEJ A;  1VF5 D;  2QM8 A;  2ZAE B;  4C46 A;  1YIT P;  1UNK A;  1FS0 E;  4EIJ A;  2O3J A;  2FVF A;  2FYU D;  3EFG A;  2QSI A;  4PV1 C;  2K5X A;  4GR6 A;  3HE4 B;  4OGQ B;  3Q2Y A;  2IBZ I;  4I2L C;  1BSN A;  2R3S A;  1SQP E;  2FXP A;  3WUU A;  2LIW A;  4C7N A;  1X79 B;  3HUS B;  3G1G A;  2LF4 A;  3H1I D;  2P7J A;  3II6 A;  2FFD C;  3L35 A;  1OR5 A;  1OWA A;  1ZRT D;  1SQB D;  4HB1 A;  5AVX B;  2IBZ D;  2JWA A;  3EJE A;  3H1J J;  1IFD A;  4GIF A;  5HGL A;  4U0C A;  1LJ2 A;  2FQ0 A;  1OW6 A;  1VQ7 P;  1LNQ A;  3GZL A;  2XZ0 D;  1AA0 A;  2N1T D;  4D6T D;  5CCH C;  4R4L A;  3G0V A;  3RK2 C;  2GZE A;  3AEC C;  5AVU B;  1NU1 E;  3L36 A;  1GD2 E;  3L71 J;  2VSQ A;  1OVU A;  2KOD A;  3Q5P A;  1OMI A;  1RY3 A;  5AVV B;  1JEK A;  5AVZ B;  1KQF B;  2K3R A;  2O01 H;  1GTW A;  1QLE D;  3GJN A;  1VQL P;  2JB0 A;  3HTK A;  3C1L A;  2WSE J;  5KAF E;  1KQL A;  3KDP B;  3H1L J;  4OGQ D;  3S1K A;  4U3F G;  2M8L A;  3CC2 P;  3CCJ P;  3L70 E;  5AW7 B;  3CC4 P;  1L0N K;  2N6Y A;  1HGZ A;  3H1H J;  4RES B;  3CX5 D;  2GUV A;  2WSF J;  1KYO I;  1T6A A;  4U3F E;  2KOO A;  2OYH B;  4U0A A;  5HGN A;  3EFF K;  2FFD A;  1SQV G;  1DH3 A;  3NY7 B;  2W6B A;  4GOD A;  2P58 A;  1A02 J;  3SWF A;  3RK3 E;  4TLF A;  2NPS D;  2M5R A;  2RKL A;  2KGD A;  2MR7 A;  1VKU A;  3AEF C;  1RQU A;  3CCM P;  3EWK A;  5C39 A;  2FVA A;  3BCC G;  1D7M A;  3A0B E;  2H8P D;  2PRR A;  1BE3 D;  3B5N C;  1VF5 C;  4Y99 B;  1LTA C;  1JTH B;  2WT7 B;  2MR8 A;  2M3B A;  2NRG A;  3M9H A;  3G6E P;  3Q20 A;  1R5L A;  3CD6 P;  1JY2 O;  1SLQ A;  4WY4 B;  1LTJ C;  3MZW B;  2H7H A;  1LT9 C;  1NTZ K;  3M9B A;  1EXJ A;  1PP9 G;  1JB0 J;  1NTK D;  1NTM D;  2XND H;  3AE1 C;  2WQY C;  2M5A A;  1KB9 H;  5M1B A;  1RE4 C;  2QE7 H;  2L4B A;  1NYH A;  4DT0 A;  3CXC O;  4H13 B;  1RO0 A;  5AVQ B;  1RE3 C;  3GG2 A;  1K73 Q;  3GF3 A;  3Q3D A;  1OVR A;  4WYM A;  2FYU J;  3L74 D;  3E2D A;  1SQQ G;  2JP3 A;  3O6Q B;  5AVW B;  1G2C B;  1SFC B;  1NOH A;  1YTZ T;  2L6E A;  1L0L G;  4JPZ B;  3IF4 A;  1RF1 B;  3BAT A;  3G21 A;  2KUB A;  4KJM A;  3LRY A;  1KIL A;  3S9O A;  2JGP A;  4XFJ A;  3DTJ A;  4YXW H;  2N1T C;  4B86 A;  4QMA A;  2K0Y A;  3H1I J;  1JY3 N;  3B5N A;  3AEA C;  1M1K Q;  1HWT C;  3G29 A;  1GL2 D;  1SQB J;  2K9J A;  2L5G B;  1GMJ A;  2A06 G;  1IUQ A;  1EZV G;  2DNW A;  5AW0 B;  1LT9 A;  3E1I A;  5BU8 B;  5CMZ A;  1SQX D;  4OGQ C;  3VMX A;  5GTI E;  4L76 A;  1KD1 Q;  4H0L D;  5H2F E;  4D6T J;  1PGO A;  2DGY A;  1GK6 A;  4PD4 E;  3WU2 H;  1JY2 P;  1RE4 A;  2GZG A;  7CEI A;  1VHN A;  2JAZ A;  1JMB A;  2B89 A;  1NTZ D;  2A45 I;  1L0L J;  4L74 A;  1LTB C;  1A8O A;  2WSC H;  1BGY G;  3L73 D;  1RE3 A;  2Q9I A;  1YI2 P;  2JQ4 A;  2BUO A;  4UHP B;  2KP8 A;  1EOQ A;  3CCQ P;  3MIW A;  4K3A A;  2PEK A;  2AVA A;  2KOS A;  1KLP A;  1S5L E;  2Q7C A;  1S2E A;  4WBA A;  3TF5 A;  4N78 D;  2K94 A;  2NPS C;  2HFE D;  2K1A A;  3GMA A;  2QIW A;  1SQP K;  3M91 A;  4XE5 B;  3DS5 A;  4H2X C;  1EQ7 A;  4I7Z C;  2LIU A;  4U0E A;  3M9Q A;  3IAO A;  4JBZ A;  1LT1 A;  2KG6 A;  2KWL A;  2N1T A;  3CXH I;  2JEE A;  1EMV A;  4M0I A;  3C9I A;  2HR3 A;  2ROQ A;  1KYO E;  1FU1 A;  3H32 B;  3VMA A;  1S1C X;  1KZU B;  5AW9 B;  1MKM A;  1E6J P;  3IR9 A;  1L0H A;  2O01 N;  2YNY A;  4XFZ A;  3DS1 A;  1KFN A;  1QGK B;  3B8E B;  1FDI A;  3D71 A;  3TGU G;  2CGQ A;  2J5U A;  3CXH D;  3L72 G;  4EOT A;  1FZB A;  1U7J A;  2MY5 A;  2B88 A;  2BCC G;  1NU1 K;  3G28 A;  2LXB A;  1BE3 J;  2J59 M;  2KI7 B;  3GHG B;  3SSU A;  2HPC B;  1L0N G;  4YTP C;  1OX3 A;  1P84 I;  3G3Z A;  3NXS A;  3TSI A;  2W8Z A;  3L75 D;  2RMZ A;  4ASV A;  5AW6 B;  2E75 B;  5DJT B;  3FXE A;  3JSV C;  3DS3 A;  1NTK J;  1H88 A;  1NTM J;  4PH1 A;  1AQ5 A;  2EFJ A;  2NPS A;  5AVR B;  2RN0 A;  2O1K A;  1BDC A;  5KKZ C;  3HYB A;  2JBG A;  5CJ4 A;  1RF0 A;  2Q3E A;  2QJK B;  1J1D C;  1X22 A;  1GL2 C;  3L74 J;  1ZOY C;  1BCC G;  2ZJS E;  2BAS A;  5CZD B;  2IZ0 A;  2J58 A;  1S9K E;  5KJ7 D;  1AFO A;  1LTI C;  1NTZ G;  1IFJ A;  1PEO A;  3B71 A;  3RK3 B;  1HUC A;  5F2O A;  3HRN A;  1CZQ A;  4N6J A;  1Q2N A;  2SPZ A;  1PZQ A;  5APV A;  3VYI A;  4H0L C;  2OYI C;  1H0T B;  3H1K E;  1KOR A;  4IL6 X;  3CC7 P;  1URQ D;  1X3O A;  2CWO A;  3A3Y B;  4RJT A;  2C9L Y;  1EXI A;  4IL6 H;  3G4S P;  4NPD A;  4AYC A;  1E79 H;  5L8R J;  3JCU E;  2YIU C;  2EIA A;  1GXH A;  2E5Y A;  4ASW A;  3G71 P;  1GU4 A;  3VN0 A;  3RL0 D;  3A7O A;  2YXR B;  4H2W C;  3C8V A;  1FE6 A;  4W7Y A;  1SQX J;  4ZNC A;  2OTK E;  3E7K A;  1OW7 A;  5I4T G;  3CWB G;  2IFN A;  1NTZ J;  2FXO A;  5AW4 B;  3L73 J;  5AVY B;  4OVN F;  4XRQ A;  3G9R A;  2JU1 A;  3A2A A;  2Y9Z A;  3G1I A;  2N9Y B;  1AV1 A;  1GL2 A;  1QL1 A;  3HE5 B;  1IK7 A;  2WT7 A;  3TNU B;  2KYV A;  1YQ3 C;  4U3F D;  1VQ5 P;  4HYT B;  3WBH A;  1ACP A;  2HOD B;  3M06 A;  4PJ0 H;  1KIL D;  1IMQ A;  3HZQ A;  3H47 A;  4GT1 A;  4ZMD A;  3CCL P;  1VQ6 P;  2KB7 P;  1SQV D;  2KXP B;  1QX8 A;  1FDO A;  1A02 F;  4WVZ A;  4QNB A;  4CPG A;  2FYN B;  5F2K A;  1YJ9 P;  3BCC D;  2KGA A;  3V2P A;  3HD7 B;  1HTL C;  4W7Z A;  4OWF A;  5HV8 A;  2PEQ A;  1L0I A;  3RGU A;  1KFM A;  1LP1 B;  5KP8 B;  2O1J A;  2ZYD A;  3G26 A;  1SQP G;  4XRO A;  2I1K A;  1G2C A;  5APW A;  2JR8 A;  1J2J B;  5APT A;  2Y0C A;  1PIX A;  3AE6 C;  2XU6 A;  1MFZ A;  1JCC A;  5AVT B;  2KOP A;  2OAR A;  1VL2 A;  2WPV B;  1Y9B A;  1KB9 D;  2UWJ E;  2MD9 A;  3PH0 A;  4F37 A;  3CME P;  3L75 J;  1PP9 D;  2Z5I A;  2KLU A;  3PJS K;  2MVU A;  2V7Q H;  5KJ7 C;  5KLV G;  1FDM A;  1NQ4 A;  1MV8 A;  3QWO C;  3VOP A;  2RH0 A;  1IJD B;  2Y0E A;  5CJ0 A;  1LTT C;  3W67 A;  3T97 A;  3L71 E;  3FXD A;  1EDJ A;  4H44 B;  3RG2 A;  1X0T A;  4PH0 A;  3KPE A;  5KLV E;  1NKZ B;  1QL2 A;  2ZVN B;  1FOS E;  1NU1 G;  2P2U A;  2GZI A;  1S4X A;  1BSH A;  1SQQ D;  2FVE A;  5HGM A;  1URQ C;  3AE2 C;  2YKQ A;  2OTJ P;  2EHT A;  1Q7Y Q;  3GZM A;  2IX7 C;  2IZ1 A;  1FZG A;  2C0X A;  3H1L E;  1L0L D;  4DJG A;  2PEN A;  3RL0 C;  2P9X A;  2E74 B;  2K88 A;  3TK1 A;  3CX5 I;  4EYY Q;  3H1H E;  4LC1 A;  4Y28 J;  4COC A;  5KTB A;  1Z6M A;  3L70 G;  1YHQ P;  3MP7 B;  1RH5 B;  3LID A;  5KAF H;  5E79 E;  1T8Z A;  2AFD A;  2JO0 A;  1EC5 A;  1HJ0 A;  2A06 D;  2W6J H;  1YBK A;  1MZ9 A;  4GR2 A;  1EZV D;  3N4X A;  2QJK C;  1MFT A;  3KZI E;  2R32 A;  1U57 A;  2KG9 A;  3P32 A;  3BAS A;  2FQ1 A;  4W80 A;  5TIS E;  5KJ7 A;  3F5H A;  5TIS H;  1VPC A;  2KLV A;  1ZLL A;  1FBM A;  2O01 J;  2B87 B;  3NMD A;  1Q81 Q;  1N73 B;  1KIL C;  1BGY D;  5KP6 B;  4IFF A;  2YXQ B;  3S4R A;  1YTZ I;  5DCK A;  1IFI A;  3V2Q A;  2FKW B;  1KMI Z;  2FYZ A;  3A0B H;  2ZYA A;  2M3E A;  1J1E B;  1URQ A;  4M3L A;  1L4A B;  3CPW O;  4U0F A;  1FZC C;  2N9B A;  2KIK A;  5BVZ A;  3B4Q A;  1HF9 A;  2HPC A;  3U1A A;  4MN4 C;  1NWQ A;  1N7L A;  2JJL A;  1NAF A;  2LTE A;  4U3F J;  3MGN A;  3PP5 A;  4L75 A;  1NKN A;  2FQ2 A;  3I5C A;  1N8R Q;  1CEI A;  2PY8 A;  1N86 A;  2NZ2 A;  2W6A A;  2FYU E;  4K35 A;  2X2B A;  1K8A Q;  3PLN A;  1D1D A;  5BU5 A;  3SFE C;  4QKO A;  1SQV J;  2FAC A;  4TT3 H;  2M8N A;  2E42 A;  2YO3 A;  5CBO A;  3FWN A;  3OAK A;  2AXT E;  1YQ4 C;  5K5G B;  3KHU A;  3TGU D;  2PEJ A;  3BCC J; 
#chains in the Genus database with same CATH homology
 5HGO A;  5F2K A;  2QEX P;  1YJ9 P;  2JO0 A;  4XFZ A;  3DS1 A;  3NTE A;  3CCV P;  3CC7 P;  2XV6 A;  2Z44 A;  2CWO A;  3DS0 A;  2PEQ A;  3G4S P;  3G1G A;  2LF4 A;  1K30 A;  1BAJ A;  1M1K Q;  3G26 A;  4GR2 A;  4XFY A;  1M74 A;  2EIA A;  3CCM P;  4XRO A;  3G29 A;  1YJW P;  2OTL P;  4U0D A;  3CCS P;  1YIJ P;  3G71 P;  3CCU P;  1KQS O;  1VQO P;  3G28 A;  4COP A;  1VQ8 P;  2Z45 A;  1IUQ A;  4U0B A;  3CMA P;  1W2B O;  1RO2 A;  2PEO A;  5BS1 A;  2OAR A;  1AUM A;  5HGL A;  4U0C A;  3DS2 A;  3CME P;  1VQM P;  1QVG O;  2XXM A;  3G6E P;  1Q81 Q;  1VQ7 P;  3Q20 A;  2Z46 A;  2JYG A;  1KD1 Q;  1VQP P;  2DGY A;  3I55 P;  3CD6 P;  3P05 A;  5I4T G;  3G0V A;  1M6E X;  3H4E A;  2ONT A;  1VQN P;  5DCK A;  1M6N A;  3CCR P;  1VQ4 P;  2PEI A;  3DS3 A;  3M1M A;  4XFX A;  4PH1 A;  2EFJ A;  5F2N A;  1A8O A;  1K9M Q;  2JYL A;  1VQK P;  3CPW O;  4XRQ A;  4PH0 A;  2KOD A;  2EG5 A;  3G1I A;  3B5I A;  1YI2 P;  1PEM A;  4U0F A;  2BUO A;  1Q86 Q;  2XT1 A;  1EOQ A;  3CCQ P;  3HYB A;  2PEK A;  3MGE A;  1VQ9 P;  5HGM A;  1VQL P;  3CXC O;  1M90 Q;  1RNI A;  1RO0 A;  5JPA A;  1EIA A;  1JJ2 O;  1VQ5 P;  1N8R Q;  5BS2 A;  1YIT P;  1ZMB A;  3DPH A;  1S72 P;  2OTJ P;  1K73 Q;  1PEU A;  3WBH A;  1Q7Y Q;  3OW2 O;  3DS4 A;  4WYM A;  2PY8 A;  3DS5 A;  3E2D A;  2PEN A;  1K8A Q;  1PEQ A;  3VRL C;  4U0E A;  3HZQ A;  1YJN P;  3H47 A;  2M8L A;  1D1D A;  2E1M A;  2P9X A;  4IPY A;  3CCJ P;  3CC2 P;  3CCE P;  1QVF O;  2M8P A;  1A43 A;  3CC4 P;  3CCL P;  1VQ6 P;  3I56 P;  4GR6 A;  2M8N A;  2BHV A;  4M0I A;  3H0D A;  2L6E A;  1PEO A;  4COC A;  5F2O A;  4U0A A;  5HGN A;  3G21 A;  1Q82 Q;  2PEM A;  3LRY A;  1QRJ A;  4QNB A;  3DTJ A;  1YHQ P;  1E6J P;  2QA4 P;  3RG6 C;  2PEJ A;  1KC8 Q;  1NJI Q;  2BQ1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...