3CCMP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccmP02
1YJ9P 3CMAP 1KC8Q 3CCMP 1S72P 1VQ5P 2QEXP 3OW2O 3G4SP 2OTLP 2QA4P 1Q81Q 3CC2P 3CPWO 1YHQP 3CCUP 3I55P 1K9MQ 1M90Q 1VQ8P 1VQ9P 1YI2P 1QVGO 3CCLP 1VQ7P 1K8AQ 1KQSO 1Q86Q 1N8RQ 1KD1Q 1YITP 1JJ2O 1YIJP 1VQNP 1VQMP 1Q7YQ 3CCJP 1M1KQ 1VQOP 1W2BO 1K73Q 1VQ4P 3G6EP 3CC4P 3CD6P 3CCRP 1YJNP 3CCSP 3CXCO 3CCQP 1NJIQ 1VQLP 3CMEP 2OTJP 3G71P 3CCEP 1Q82Q 3CCVP 3I56P 1VQ6P 1QVFO 3CC7P 1YJWP 1VQKP 1VQPP
chains in the Genus database with same CATH superfamily
2P10A 3RG2A 1LGHB 2EHSA 1L0LJ 1GD2E 4PD4E 4U3FE 4GR6A 5KKZC 1Z56A 1G2CB 3CCJP 3H25A 4EIJA 2FVAA 4UB8H 5TISE 2O3JA 2JWDA 2O01J 3HUSA 1BDDA 5KLVG 3PH0A 2G3AA 4COPA 3HD7A 1SQQJ 2NPSA 3L70D 1T6AA 3TYYA 4EDFA 4MN4C 1UIIA 5KJ7C 3MGEA 4KT0J 1SFCC 4Y28J 5AW4B 2W8ZA 3AEBC 2IYPA 2Y0EA 5H2FE 3OA7A 3NTNA 3TDKA 2P67A 2FXPA 2HODB 2VLPA 1FBMA 2LIWA 1H89A 3Q5PA 1VQ7P 2KYVA 2M8LA 2O01H 2FHSC 1KLPA 3U1CA 3L72D 3G21A 3H1JE 2QEXP 2PEOA 1BGYJ 2E74D 1PGJA 1NU1K 3B5ND 1Q7YQ 2QRXA 3M0AA 2AXTH 2ZT9D 1FU1A 3AE5C 4UB8E 4GODA 4H13B 4R4LA 4UB6E 2FVFA 1KB9E 3VYIA 1L4AA 3R2PA 1KILB 3GZLA 2GZIA 4I7ZC 2IZ1A 1MFTA 2R3CA 4BRYB 3RK2B 2ZVOB 5CCHD 2YKQA 2XV6A 4DCKA 1EMVA 3Q5SA 1FAVA 3HD7D 2MD9A 3B71A 3PLNA 3AEGC 3GF7A 3V2RA 1OW8A 1S5LX 5KTBA 4U3FG 1S9KE 3AE1C 1JUNA 1KZUB 2J59M 1VQ6P 3B8EB 2L0QA 3GF3A 2L9FA 1IK7A 1S72P 2PGDA 4DT0A 3O6QA 3H1LJ 3DS5A 3HUSB 1JY2P 2PAJA 1LTJC 2GZJA 1X8YA 5CCGA 2EG5A 4BPHA 1OW6A 2OQQA 1JY2N 1HJ0A 3L37A 1VHNA 4H44D 3AEAC 3CCMP 3JCUE 3V5BA 2M3BA 2K5XA 1SLQA 1YI2P 1NTKE 5KLVD 4TLFA 1KD1Q 1JY3N 1EZVG 5KP7B 1N7SD 2K92A 1L0ND 2QVAA 3Q20A 2QM7A 4BWNA 2XZ1C 1YJNP 4Y99B 1DNYA 2K93A 2CQ8A 1FZCB 1SQPK 1JB0J 2HR3A 1OVRA 2IBZE 3L73E 4D6TE 1DIPA 1GDTA 2NPSC 3G28A 3IAOA 4LC1A 5CJ4A 1KFNA 1KILD 3A0HH 2EHTA 3AE4C 1IZNB 2AEMA 2CG5B 1LTBC 3WU2H 2ZFCA 1ZR4A 2HG5D 1GMJA 1Y9BA 3BCCE 1L4AB 3GKLC 5B66E 2KGAA 3AECC 2FQ2A 2AEFA 3H1LD 4H2WC 1E5WA 2JQ4A 2LKIA 1KYOD 5AVRB 1QVGO 1AUMA 3BCCG 1N7LA 1VQ4P 3G6EP 2WPRA 2XZRA 4I2LC 4L73A 5TJHA 1LT9B 1SQXG 1KV4A 2LIUA 4W7ZA 2WTYA 2K1AA 3B5IA 4H2XC 3L74G 1NHLA 4NPDA 1U7MA 2WMMA 1SFCA 1P84E 1SQBE 1L0HA 1PEUA 3MIWA 1WT6A 3BRTB 2B9BA 3P8MC 1JMBA 3MZWB 7CEIA 2PEIA 2Z4EA 2EFJA 1HWTC 3DTJA 2MVUA 1KB9D 1M6NA 2N98A 2IBZD 3L73D 4D6TD 1A02F 3HTKA 4YPCA 3WUUA 2DW3A 4PH1A 1L2PA 1PP9J 1JY2O 5APTA 3HD7B 4XRQA 2ZYAA 2PEMA 1NTZG 3M9HA 1LTAC 4PV1C 2G8YA 1U57A 4U0FA 1FDMA 2O1JA 1IFPA 1GPJA 2DGYA 1ZNVA 4U0EA 1VQMP 1HF9A 1SQVD 1AYIA 3H1JG 4H13D 4BPFA 2OTKE 4OGQC 3L72J 5B5EH 4I1LA 2H88C 3CWBD 2Q3EA 4HKZH 2ZYGA 2L6EA 2YKOA 1X3OA 2JDIH 3HE4B 4HYTB 5KAIE 2W6JH 4N3YB 2KGCA 2Q3IA 1R5SA 2QSIA 1PGQA 5AW0B 4WVZA 1HUCA 1K73Q 1JTHB 2FYNB 1GL2A 5KKZB 2POHA 1VF5B 3CE7A 1SQQE 1GL2D 1SQBD 2IPPA 4YXWH 3LIEA 1WRGA 2W83C 4CPGA 1KORA 2B87B 2NPSD 1GU5A 1FDOA 1URQC 2OARA 1SQVK 5HGMA 1ZMBA 1QEXA 4IL6H 4C7NA 1X9VA 4JF7A 1SFCD 2O1KA 1YBKA 2E5YA 3T97B 5HGLA 3EQ2A 3RL0D 1NVOA 4WY4C 4XFYA 4EI2A 1K05A 2IYOA 4EYYQ 3FX0A 1K8AQ 3EFFK 1OZHA 4M3LA 4N78E 2XNDH 2N6ZA 4ZKPA 1NU1E 3BCCD 3BVHA 2YO3A 5DCKA 4R0MA 3MUDC 2ZYDA 2KZJA 3H1KE 3H47A 4XROA 2EIAA 4PD4I 2RH0A 1EDKA 4ASVA 2N1TA 2E75B 1FJPA 3PP5A 2E74B 3DPHA 2K0YA 3H1HJ 3H1ID 2N6YA 1EC5A 1OFCX 3HD7C 1EZVE 3O8ZA 1H8AA 4XFXA 3HUSC 3K5BA 1J1DB 2A45I 5DJUB 1LWUB 2ZT9B 3L71J 3GHGB 5CBOA 5M1BA 1GL2B 3C8VA 2YIUC 1DD4A 3CMEP 3CWBG 1T3JA 3L35A 1VQKP 1VQPP 3II6A 1FZBA 3RBZA 1IUQA 1M90Q 3AE8C 2PEKA 1RO2A 2KSJA 3CX5H 5KLIB 4Y99C 4OH8B 1RNIA 4H0LD 2BEZF 3AE9C 3RGUA 1BSHA 3B5NC 3SWYA 2XT1A 1BE3D 1KB9H 1L0LG 1LP1A 3Q2YA 1JY3P 1M1JC 3OW2O 2JYGA 2KS1B 3N4XA 1HY8A 1RE3A 2H8PD 1Y47A 1USEA 3HRNA 1LNQA 3D6ZA 2YKPA 1MFZA 1KQLA 2Z5HA 2ZAEB 3IFMA 1EDIA 3FWLA 1URQA 1NTMD 1URQD 5CMZA 3L75D 1LWUC 3F89A 1OXZA 1GXHA 2Q6QA 2Y9YA 5APSA 1LP1B 5BS2A 4PD4H 4C7RA 4KJMA 1FS0E 1GL2C 5EJDA 2WSSH 2Z5IA 2NRGA 1Y8AA 3VTPC 2AXCA 3L74J 1T8ZA 4RJTA 2JO1A 3RK3D 1M8OB 1T8KA 3VOPA 1PEMA 1N73C 3KYQA 3MD0A 1IMQA 2D2CD 2JJLA 2MR8A 1W2BO 2JBGA 1IK9A 4N6JA 4NEOA 2Z46A 1M1JB 2OGUA 4IL6X 3Q5RA 3CCVP 2JP3A 1KILE 2MJZA 4W80A 1EOQA 2WQYC 1NKNA 3AE6C 3V2QA 2MVVA 3P8CE 1VQ9P 1GK4A 3GW6A 2JU1A 3P8CD 2ZJSE 4OWFA 4AQRD 2FFDA 2Q1KA 1S1CX 2KSEA 3M9BA 3CXCO 1D7MA 1ACPA 3VMZA 1IFMA 1UJZA 2YIUB 3S4RA 4L76A 1N2DC 3EFGA 3TSIA 4EOTA 1J1EC 4HB1A 3HYBA 1EZVD 2FY8A 2V7QH 4NPEA 4MRTC 3PRJA 2IZ0A 2N9YB 2AF8A 3RK2C 1SS1A 1NO4A 4IOIH 3Q3DA 2KG6A 4U0AA 3A3YB 3CC7P 2GZEA 1X0TA 5AW3B 5DJTB 2KOPA 2KNCB 2NO8A 1IC2A 3E2DA 1Q2NA 1SQXE 2FYNC 4GR2A 1YTZT 2N5IA 1LT1A 2WPTA 1SVFA 3FXEA 3SWFA 3KDPB 5AW9B 3CCQP 3L70G 3VN0A 3CXHH 3H1LG 3V2NA 3RK3E 4PV1B 2QJYC 1Q86Q 4LLHA 1SQPJ 2WITA 2V4HA 1HGZA 2B89A 2R44A 5HGOA 2KS1A 2PY8A 1BGYG 3QH9A 4PH0A 1CEIA 4WYMA 1S2EA 2FQ1A 1S3JA 2R32A 2XU6A 1ZP0C 2WSEJ 5HV8A 2KZIA 2FYUD 2GUVA 1NTME 2OYHA 3RG6C 4JYCA 3VMAA 2QNWA 1FZGA 3BRVB 3VP9A 3HE5B 1D1DA 5F2OA 2KOSA 4W7YA 1YJ9P 3PJSK 1DD3A 2PEQA 2N5HA 1P84D 1ZR2A 5CCGC 1LTJA 1PL5A 3CCSP 2W27A 4ASWA 2FBWC 2FVEA 5KLVJ 1MKMA 1QX8A 3CWBE 1BDCA 1RH5B 2WSEH 5CCHA 2M8RA 2GA1A 1SQQG 3RBXA 1QGKB 2KWLA 3L72E 1NYHA 1SFCB 5AW5B 2QM8A 3KZIE 2FYUJ 1HGVA 1RQVA 3A5TA 2P7JA 1R8EA 3CCRP 3H32B 2K9YA 1AVYA 4A7PA 3KXDA 2P1JA 2E1MA 1E0HA 2PFXA 4KHXA 4F37A 2L5GB 3GZMA 1T2KC 3NXSA 3W67A 3MGNA 1PPJD 5CCHC 1EIAA 3DS0A 2KOQA 1NU1D 1CI6A 1PPJE 3G9RA 2MKVA 2JKVA 2FKWB 5BU5A 1OR5A 3BCCJ 5EW5E 1JEKA 5KP6B 2I1KA 1L4AC 3VMYA 3T97A 3AEEC 2XZ0D 3H1IG 2YXQB 3V4QA 1AQTA 2H7HA 1U7JA 5AVSB 3S1KA 2ZT9C 1PEQA 2UWJE 2PENA 4TT3H 2HLOA 3BATA 1FZFA 1N7SB 2JR8A 4JPZB 4WB4A 1L0NG 3RL0B 2WSCJ 2VLNA 2FYZA 3CX5D 1RE4C 2SPZA 1NU1J 4U0CA 2BCCJ 2YMKA 2FFDB 1BE3J 2GDYA 5KLIC 3OAKA 1VQLP 3M0DA 2K37A 3LRYA 3F5HA 4K35A 1N7SA 2M3EA 1BE3G 4H0LB 1VF5C 4ZNCA 2BUOA 2JEEA 1RF0C 2BCCG 3DS3A 1JTHA 3AE2C 2RMZA 3VMXA 1SQBK 1H88A 1IFNA 3D71A 1FZCA 1GU4A 2H43A 2CGQA 1PP9E 4O9BA 4AUWA 1YJWP 2YXRB 2P9XA 3L70E 1JO5A 1M6EX 4JYBA 3O6QB 3HE5A 3TK1A 1YYCA 2Z45A 2KP8A 2LXBA 2YO2A 3L72G 2VSQA 1S9KD 2M5RA 1FE6A 3L70J 1F80D 1X22A 3HE4A 2C0XA 1OVUA 5AVWB 1OW7A 2IBZI 5B66H 2E76C 4M0IA 3C9IA 3TGUJ 5AVQB 2KK7A 1NTZE 2WPSA 3M06A 2CPSA 4QKOA 5E79E 5KP8B 3A0BE 1GW3A 4U0DA 3P05A 1N73B 1FZCC 1FOSF 2M5AB 4DZOA 3U59A 4WBAA 3I56P 2K94A 1CI6B 4H44B 2BEQD 5I4TG 1BGYE 2WSCH 5CZDB 3GHGA 1OWAA 2P58A 1E79H 2A06D 2KOOA 1OVVA 4YXDC 3ITKA 3L74E 1IFIA 1J1DC 2KG8A 5APVA 3CXHI 2IX7C 2MF4A 1RF1A 5B5EE 1BSNA 4IFDK 4WY4D 1PV3A 3L71D 3RL0C 1L0NE 1ZLLA 2R5DA 5HVCA 2GDWA 2N50A 1LT9C 2ONTA 1BAJA 5GTHH 3C1LA 2KLUA 2WPQA 1VF5D 1W5CE 1EXJA 1KN7A 1LT9A 2KLVA 1CW5A 3W68A 4HKGA 2MR7A 2QJPC 5F2NA 2QA4P 1NTKJ 5GTIH 4PJ0E 3RK3B 2NPSB 1VL2A 1IJDB 4JQ0D 5APQA 1QL2A 2V7QJ 1BCCJ 1S5LE 2VLQA 2E75C 3NY7B 3G71P 2XDJA 3CX5I 1SP4A 1LTTC 4ZMDA 5BS1A 2AFDA 1RE3C 2K9JB 5APWA 3CC2P 5TISH 1JM0A 1M1JA 1WMKA 1VQNP 1P84H 2KOGA 4IZ6A 1GW4A 3MHVA 3B5NA 2A45G 1SQPG 1X79B 3L71G 3CWBJ 4H13C 1KQFB 1NTMK 2K9JA 3IN6A 2BCCD 5BVZA 3CCEP 3R4YA 2BCCE 3DS2A 2OYIA 4GT1A 1L4AD 4DG9A 3RL0g 1Q90D 1K30A 2HYNA 1L0IA 3M91A 4YTPC 4C7NB 4U7JA 2FYUG 3L74D 1L0LD 2KR5A 1Q82Q 3N7NA 1KQGB 1YTZI 1T2KD 3A2AA 3H1HE 3WU2E 3NTEA 1QRJA 2IFMA 2QIWA 2P2UA 4U3FJ 1A02J 2Y0CA 2Z44A 2N1TC 1M56D 1NAFA 2L22A 1VKUA 2ZVNB 3AEFC 3Q1MA 3GG2A 1NTZD 2KNCA 5AVUB 3PTZA 1EDLA 3D6YA 1KYOE 3WMM0 4HH2A 1GTWA 2AXTE 4RESB 1IO4A 2C0WA 5CCGD 3V6IA 2LKMA 2WT7B 3H32A 3LIDA 3SFEC 1DH3A 1NKZB 3H1JD 4AYCA 1EDJA 1J1EB 1KB9I 3G0VA 2JU2A 1ZV8A 1KTMA 2QJPB 1N8RQ 4ZKUA 1P84I 1MZ9A 1AFOA 2E75D 2KB7P 2LMLA 3H4EA 2AEJA 5KLVE 4JBZA 2KGEA 2FADA 2LPKA 4WWIA 3DS1A 3B4QA 3IF4A 2GZFA 1HQBA 3CPWO 1YHQP 1SQBG 2HPCA 2N9BA 1URQB 4UHPB 1FZAA 1RF0A 2I8DA 1UIXA 3H6PA 4GKGA 3AEDC 2VLOA 2DNWA 3H1HD 3M0DC 1SQVE 2XXMA 3ABVC 3A0HE 2OYHB 1RO0A 1M1KQ 4OGQD 4XA4A 5AVZB 1PIXA 2M8NA 3M1MA 2PEJA 2FFDC 2QG4A 3B4SA 1FR2A 1SQPD 1RE4A 1ZRTD 4GOFA 2WZ7A 2R3SA 1ZW0A 2JYLA 2XV5A 2D2CB 3TGUD 1SQPE 2RKLA 3CCUP 5CHXA 2NZ2A 5AW8B 3SFDC 2BHVA 2KGDA 5KLVK 4QNBA 1BCCG 2N1TD 3JSVC 1VQOP 3KQGA 2KXPB 1VDFA 2Q7CA 2X2BA 2CNRA 1RF1C 4R4MA 1JOCA 1G1JA 1SQXJ 2E42A 3IR9A 1KQSO 3LMOA 3DS4A 2A06G 2KIKA 3TF5A 4RKUJ 2XKMA 5AVTB 4B86A 2GYKA 3G1GA 2K3RA 1AA0A 1S5LH 1L0LE 1HVVA 1Z6MA 1FC2C 2ERHA 1A43A 5L8RJ 2PNGA 1LWUA 4N78D 3FWNA 2WPVB 2L4BA 2L91A 3CL3D 3P7KA 1RY3A 2QJKB 1M57D 5AW2B 1H0TA 1GXGA 2Y9ZA 1PGPA 2D2CC 1SQQK 1IFJA 2GUSA 3U43A 3CMAP 1KC8Q 3RK3C 2JAZA 2OTLP 2MY5A 4COCA 1T3UA 1TU3F 1UNKA 3V2PA 3A7OA 1M7LA 1RF1B 5BU8B 1EZVI 3CLQA 3HTKB 4QMAA 1SQQD 1XTCC 1W2EA 1Q81Q 1NTKK 2OYOA 5C39A 1LTJB 3EJEA 4IPYA 4Z1MH 3E1IA 3CC4P 3U1AA 2OYHC 1OX3A 3WUTA 4L74A 1N7SC 2OTJP 2K88A 1NTMJ 3S9OA 1SQBJ 1QL1A 1M74A 1PPJG 2QJKC 3A0BH 2O01N 1JJ2O 1R5LA 2J58A 4PD4D 1BGYD 4H2YC 1HJBA 3H1LE 1YQ3C 1MV8A 5KAFH 3P32A 1JCCA 1NH4A 2H89C 4L75A 4PV1D 3M9QA 1BE3E 1DV5A 2A45H 2IFNA 3H1HG 3PHLA 5HGNA 1G1IA 3JCUH 3MTUE 3ZDMA 1ZMEC 1OIPA 3BASA 1HBWA 4GDOA 3H1IE 1FOSE 1JY3O 3GJNA 1QLED 2E76D 3FGAD 4C46A 4WY4B 4WY4A 1E6JP 4OVNF 3USSA 2FQ0A 4BRYA 2LR2A 3FXDA 2B88A 2CPBA 4GOEA 2J5UA 1NJIQ 5APYA 1ZN5A 2Q9IA 4K3AA 2OYIC 1SQXD 3WBHA 3L71E 1DX7A 1VPCA 2ZXEB 2R5BA 2ZXXA 2HPCB 1NTMG 2LXCB 5KAFE 2CWOA 1RQUA 2ITAA 5AVXB 2E43A 3B5NB 2W6AA 2FXMA 1G2CA 2A06E 3H1JJ 5E79H 1HTLC 2IDBA 1NTKG 2E74C 2W6BA 1KFMA 2N1TB 4IL6E 1NU1G 1VQ8P 1DEEG 2FYUE 1YITP 1IMPA 1A8OA 5H2FH 5EFWB 2QJYB 1NTZJ 3G1IA 3TGUE 2FYUK 4UB6H 1GZLA 2K0DX 1AF8A 1PP9G 4CA3A 1BCCE 1J2JB 3L75J 3QWOC 1KILC 1YQ4C 2GDXA 2VRSA 1PZQA 5CBNA 4HJGH 5AW1B 2KODA 4OGQB 4I7ZB 4DOJA 1PGOA 5KJ7D 5APUA 2AVAA 1H0TB 2XNXA 5AW6B 3EJBA 1GK6A 2KI7B 5KJ7A 1AQ5A 4RO0A 5CJ0A 2GZGA 3L75E 2YMYA 5AVYB 2M0BA 3I5CA 5APXA 2WVRA 1DEBA 4H44C 2BQ1E 4BXLA 4NPFX 4XE5B 5GTHE 2LL8A 2FACA 4LGDE 5AW7B 1EQ7A 2Q5UA 2PRRA 3AE7C 4BPGA 4PWVB 1L0LK 1AJYA 2M8PA 5AVVB 2WSFH 3EJDA 5GTIE 2B87A 3I55P 3OJAB 1MUUA 4U3FD 1NTKD 1LJ2A 1ZXGA 2KW2A 1KYOI 2LTEA 3H0DA 2JWAA 2FXOA 1XTGB 3GLMA 1IFDA 2FAEA 2HODA 2W90A 3JC22 3MP7B 3AE3C 2C9LY 2LOLA 1PFIA 2OYIB 1AV1A 2C9NY 1USDA 1PP9D 2K0XA 5JPAA 1JCDA 1S4XA 2WWWA 3L73J 4D6TJ 2I1JA 3CXHD 3VP8A 2JB0A 4PXHB 3NFQA 5KAIH 1VQ5P 1KMIZ 1JMMA 3KPEA 1K9MQ 4GIFA 2CK3H 3L4FA 1FZEA 2KORA 1JNMA 4IFFA 1N86A 3H1KG 1NGMB 1NAYA 3KZIH 3WUVA 5K5GB 3UIAA 3CX5E 3GMAA 3SSUA 3MUDA 4U0BA 1KILA 1YIJP 3H1KJ 2AFEA 2E5TA 3LW5H 3L36A 3V4WA 5F2KA 1N73A 1SQVJ 2E76B 1LTGC 4IFMA 1L0NK 4XFZA 3D70A 1OMIA 1FDIA 1ZOYC 2ROQA 3TGUG 2HFED 1EXIA 2WSFJ 3VRLC 1BCCD 1K04A 1NOHA 3SWKA 1KYOH 4H0LC 1SQVG 1NWQA 2K2QA 2RN0A 1NTZK 2M5AA 3NMDA 2IBZG 3L73G 4D6TG 1AVOA 2GM4A 1QVFO 1BXIA 3CXHE 1NQ4A 4XFJA 3G4SP 2KUBA 3G29A 1MZ8A 3CCLP 4DJGA 3LW5J 1L0NJ 3G3ZA 3HZQA 4I6MC 2JO0A 1LTIC 3RK2D 3GHGC 2WT7A 2BASA 3H1IJ 2QE7H 1ZRTE 3KHUA 2YNYA 1LTSC 3H1KD 3L75G 2LF4A 4PJ0H 3CD6P 3E1RA 1HH0A 3CI9A 3EWKA 1CZQA 3E7KA 2Y0DA 1CSBA 3G26A 1SQXK 3TNUA 3TNUB 2KG9A 1PEOA 1RHZB 1FJKA 2JGPA 2PP6A
chains in the Genus database with same CATH topology
3H47A 4XROA 3CMAP 1KC8Q 3G28A 2OTLP 2EIAA 3E2DA 4U0FA 2XXMA 2DGYA 4COCA 4U0BA 4GR6A 4U0EA 5BS2A 4GR2A 1E6JP 1YIJP 3NTEA 1VQMP 2BQ1E 1RO0A 3CCJP 1M1KQ 2BUOA 1QRJA 2ONTA 1BAJA 3DS3A 2M8NA 3M1MA 3CCRP 3DPHA 2PEJA 5F2KA 3CCQP 1NJIQ 2Z44A 1VQNP 4XFZA 2E1MA 1YJWP 2XV6A 2JYLA 3WBHA 2P9XA 2M8PA 4XFXA 1M6EX 2L6EA 5F2NA 2QA4P 1Q81Q 3CCUP 4COPA 3I55P 1QVGO 1EIAA 2BHVA 3DS0A 1PEMA 4QNBA 2CWOA 1Q86Q 4IPYA 1AUMA 3VRLC 2Z45A 1VQOP 1W2BO 1K73Q 1VQ4P 3G6EP 3CC4P 3MGEA 3H0DA 5HGOA 2PY8A 3CMEP 2OTJP 2Z46A 3G71P 4PH0A 3CCVP 1VQ6P 4WYMA 1QVFO 1VQKP 1VQPP 1EOQA 1S72P 5BS1A 1M74A 1IUQA 3G4SP 3CC2P 4M0IA 3G0VA 1M90Q 3G29A 1VQ8P 1VQ9P 3B5IA 3DS5A 3CCLP 1VQ7P 2OARA 2PEKA 5HGMA 1N8RQ 1KQSO 1YITP 1JJ2O 1ZMBA 1A8OA 1RO2A 3HZQA 4U0DA 3RG6C 5JPAA 3G1IA 2JO0A 3H4EA 3P05A 3DS4A 2M8LA 1RNIA 1PEUA 2EG5A 1PEQA 3CXCO 3G1GA 2PENA 3CCEP 5HGLA 3G21A 3I56P 1D1DA 2XT1A 2PEIA 5F2OA 1YJ9P 2EFJA 3DTJA 3DS1A 3CCMP 3DS2A 1M6NA 4XFYA 1VQ5P 2QEXP 2PEOA 3OW2O 2JYGA 3CPWO 1YHQP 1A43A 2PEQA 1K9MQ 1YI2P 2LF4A 5I4TG 1K8AQ 1KD1Q 3CD6P 4U0CA 1Q7YQ 3HYBA 2KODA 4PH1A 1K30A 5HGNA 3Q20A 3G26A 4XRQA 1YJNP 3CCSP 1PEOA 2PEMA 5DCKA 1VQLP 1Q82Q 4U0AA 3CC7P 3LRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 P;  3CMA P;  1KC8 Q;  3CCM P;  1S72 P;  1VQ5 P;  2QEX P;  3OW2 O;  3G4S P;  2OTL P;  2QA4 P;  1Q81 Q;  3CC2 P;  3CPW O;  1YHQ P;  3CCU P;  3I55 P;  1K9M Q;  1M90 Q;  1VQ8 P;  1VQ9 P;  1YI2 P;  1QVG O;  3CCL P;  1VQ7 P;  1K8A Q;  1KQS O;  1Q86 Q;  1N8R Q;  1KD1 Q;  1YIT P;  1JJ2 O;  1YIJ P;  1VQN P;  1VQM P;  1Q7Y Q;  3CCJ P;  1M1K Q;  1VQO P;  1W2B O;  1K73 Q;  1VQ4 P;  3G6E P;  3CC4 P;  3CD6 P;  3CCR P;  1YJN P;  3CCS P;  3CXC O;  3CCQ P;  1NJI Q;  1VQL P;  3CME P;  2OTJ P;  3G71 P;  3CCE P;  1Q82 Q;  3CCV P;  3I56 P;  1VQ6 P;  1QVF O;  3CC7 P;  1YJW P;  1VQK P;  1VQP P; 
#chains in the Genus database with same CATH topology
 2P10 A;  3RG2 A;  1LGH B;  2EHS A;  1L0L J;  1GD2 E;  4PD4 E;  4U3F E;  4GR6 A;  5KKZ C;  1Z56 A;  1G2C B;  3CCJ P;  3H25 A;  4EIJ A;  2FVA A;  4UB8 H;  5TIS E;  2O3J A;  2JWD A;  2O01 J;  3HUS A;  1BDD A;  5KLV G;  3PH0 A;  2G3A A;  4COP A;  3HD7 A;  1SQQ J;  2NPS A;  3L70 D;  1T6A A;  3TYY A;  4EDF A;  4MN4 C;  1UII A;  5KJ7 C;  3MGE A;  4KT0 J;  1SFC C;  4Y28 J;  5AW4 B;  2W8Z A;  3AEB C;  2IYP A;  2Y0E A;  5H2F E;  3OA7 A;  3NTN A;  3TDK A;  2P67 A;  2FXP A;  2HOD B;  2VLP A;  1FBM A;  2LIW A;  1H89 A;  3Q5P A;  1VQ7 P;  2KYV A;  2M8L A;  2O01 H;  2FHS C;  1KLP A;  3U1C A;  3L72 D;  3G21 A;  3H1J E;  2QEX P;  2PEO A;  1BGY J;  2E74 D;  1PGJ A;  1NU1 K;  3B5N D;  1Q7Y Q;  2QRX A;  3M0A A;  2AXT H;  2ZT9 D;  1FU1 A;  3AE5 C;  4UB8 E;  4GOD A;  4H13 B;  4R4L A;  4UB6 E;  2FVF A;  1KB9 E;  3VYI A;  1L4A A;  3R2P A;  1KIL B;  3GZL A;  2GZI A;  4I7Z C;  2IZ1 A;  1MFT A;  2R3C A;  4BRY B;  3RK2 B;  2ZVO B;  5CCH D;  2YKQ A;  2XV6 A;  4DCK A;  1EMV A;  3Q5S A;  1FAV A;  3HD7 D;  2MD9 A;  3B71 A;  3PLN A;  3AEG C;  3GF7 A;  3V2R A;  1OW8 A;  1S5L X;  5KTB A;  4U3F G;  1S9K E;  3AE1 C;  1JUN A;  1KZU B;  2J59 M;  1VQ6 P;  3B8E B;  2L0Q A;  3GF3 A;  2L9F A;  1IK7 A;  1S72 P;  2PGD A;  4DT0 A;  3O6Q A;  3H1L J;  3DS5 A;  3HUS B;  1JY2 P;  2PAJ A;  1LTJ C;  2GZJ A;  1X8Y A;  5CCG A;  2EG5 A;  4BPH A;  1OW6 A;  2OQQ A;  1JY2 N;  1HJ0 A;  3L37 A;  1VHN A;  4H44 D;  3AEA C;  3CCM P;  3JCU E;  3V5B A;  2M3B A;  2K5X A;  1SLQ A;  1YI2 P;  1NTK E;  5KLV D;  4TLF A;  1KD1 Q;  1JY3 N;  1EZV G;  5KP7 B;  1N7S D;  2K92 A;  1L0N D;  2QVA A;  3Q20 A;  2QM7 A;  4BWN A;  2XZ1 C;  1YJN P;  4Y99 B;  1DNY A;  2K93 A;  2CQ8 A;  1FZC B;  1SQP K;  1JB0 J;  2HR3 A;  1OVR A;  2IBZ E;  3L73 E;  4D6T E;  1DIP A;  1GDT A;  2NPS C;  3G28 A;  3IAO A;  4LC1 A;  5CJ4 A;  1KFN A;  1KIL D;  3A0H H;  2EHT A;  3AE4 C;  1IZN B;  2AEM A;  2CG5 B;  1LTB C;  3WU2 H;  2ZFC A;  1ZR4 A;  2HG5 D;  1GMJ A;  1Y9B A;  3BCC E;  1L4A B;  3GKL C;  5B66 E;  2KGA A;  3AEC C;  2FQ2 A;  2AEF A;  3H1L D;  4H2W C;  1E5W A;  2JQ4 A;  2LKI A;  1KYO D;  5AVR B;  1QVG O;  1AUM A;  3BCC G;  1N7L A;  1VQ4 P;  3G6E P;  2WPR A;  2XZR A;  4I2L C;  4L73 A;  5TJH A;  1LT9 B;  1SQX G;  1KV4 A;  2LIU A;  4W7Z A;  2WTY A;  2K1A A;  3B5I A;  4H2X C;  3L74 G;  1NHL A;  4NPD A;  1U7M A;  2WMM A;  1SFC A;  1P84 E;  1SQB E;  1L0H A;  1PEU A;  3MIW A;  1WT6 A;  3BRT B;  2B9B A;  3P8M C;  1JMB A;  3MZW B;  7CEI A;  2PEI A;  2Z4E A;  2EFJ A;  1HWT C;  3DTJ A;  2MVU A;  1KB9 D;  1M6N A;  2N98 A;  2IBZ D;  3L73 D;  4D6T D;  1A02 F;  3HTK A;  4YPC A;  3WUU A;  2DW3 A;  4PH1 A;  1L2P A;  1PP9 J;  1JY2 O;  5APT A;  3HD7 B;  4XRQ A;  2ZYA A;  2PEM A;  1NTZ G;  3M9H A;  1LTA C;  4PV1 C;  2G8Y A;  1U57 A;  4U0F A;  1FDM A;  2O1J A;  1IFP A;  1GPJ A;  2DGY A;  1ZNV A;  4U0E A;  1VQM P;  1HF9 A;  1SQV D;  1AYI A;  3H1J G;  4H13 D;  4BPF A;  2OTK E;  4OGQ C;  3L72 J;  5B5E H;  4I1L A;  2H88 C;  3CWB D;  2Q3E A;  4HKZ H;  2ZYG A;  2L6E A;  2YKO A;  1X3O A;  2JDI H;  3HE4 B;  4HYT B;  5KAI E;  2W6J H;  4N3Y B;  2KGC A;  2Q3I A;  1R5S A;  2QSI A;  1PGQ A;  5AW0 B;  4WVZ A;  1HUC A;  1K73 Q;  1JTH B;  2FYN B;  1GL2 A;  5KKZ B;  2POH A;  1VF5 B;  3CE7 A;  1SQQ E;  1GL2 D;  1SQB D;  2IPP A;  4YXW H;  3LIE A;  1WRG A;  2W83 C;  4CPG A;  1KOR A;  2B87 B;  2NPS D;  1GU5 A;  1FDO A;  1URQ C;  2OAR A;  1SQV K;  5HGM A;  1ZMB A;  1QEX A;  4IL6 H;  4C7N A;  1X9V A;  4JF7 A;  1SFC D;  2O1K A;  1YBK A;  2E5Y A;  3T97 B;  5HGL A;  3EQ2 A;  3RL0 D;  1NVO A;  4WY4 C;  4XFY A;  4EI2 A;  1K05 A;  2IYO A;  4EYY Q;  3FX0 A;  1K8A Q;  3EFF K;  1OZH A;  4M3L A;  4N78 E;  2XND H;  2N6Z A;  4ZKP A;  1NU1 E;  3BCC D;  3BVH A;  2YO3 A;  5DCK A;  4R0M A;  3MUD C;  2ZYD A;  2KZJ A;  3H1K E;  3H47 A;  4XRO A;  2EIA A;  4PD4 I;  2RH0 A;  1EDK A;  4ASV A;  2N1T A;  2E75 B;  1FJP A;  3PP5 A;  2E74 B;  3DPH A;  2K0Y A;  3H1H J;  3H1I D;  2N6Y A;  1EC5 A;  1OFC X;  3HD7 C;  1EZV E;  3O8Z A;  1H8A A;  4XFX A;  3HUS C;  3K5B A;  1J1D B;  2A45 I;  5DJU B;  1LWU B;  2ZT9 B;  3L71 J;  3GHG B;  5CBO A;  5M1B A;  1GL2 B;  3C8V A;  2YIU C;  1DD4 A;  3CME P;  3CWB G;  1T3J A;  3L35 A;  1VQK P;  1VQP P;  3II6 A;  1FZB A;  3RBZ A;  1IUQ A;  1M90 Q;  3AE8 C;  2PEK A;  1RO2 A;  2KSJ A;  3CX5 H;  5KLI B;  4Y99 C;  4OH8 B;  1RNI A;  4H0L D;  2BEZ F;  3AE9 C;  3RGU A;  1BSH A;  3B5N C;  3SWY A;  2XT1 A;  1BE3 D;  1KB9 H;  1L0L G;  1LP1 A;  3Q2Y A;  1JY3 P;  1M1J C;  3OW2 O;  2JYG A;  2KS1 B;  3N4X A;  1HY8 A;  1RE3 A;  2H8P D;  1Y47 A;  1USE A;  3HRN A;  1LNQ A;  3D6Z A;  2YKP A;  1MFZ A;  1KQL A;  2Z5H A;  2ZAE B;  3IFM A;  1EDI A;  3FWL A;  1URQ A;  1NTM D;  1URQ D;  5CMZ A;  3L75 D;  1LWU C;  3F89 A;  1OXZ A;  1GXH A;  2Q6Q A;  2Y9Y A;  5APS A;  1LP1 B;  5BS2 A;  4PD4 H;  4C7R A;  4KJM A;  1FS0 E;  1GL2 C;  5EJD A;  2WSS H;  2Z5I A;  2NRG A;  1Y8A A;  3VTP C;  2AXC A;  3L74 J;  1T8Z A;  4RJT A;  2JO1 A;  3RK3 D;  1M8O B;  1T8K A;  3VOP A;  1PEM A;  1N73 C;  3KYQ A;  3MD0 A;  1IMQ A;  2D2C D;  2JJL A;  2MR8 A;  1W2B O;  2JBG A;  1IK9 A;  4N6J A;  4NEO A;  2Z46 A;  1M1J B;  2OGU A;  4IL6 X;  3Q5R A;  3CCV P;  2JP3 A;  1KIL E;  2MJZ A;  4W80 A;  1EOQ A;  2WQY C;  1NKN A;  3AE6 C;  3V2Q A;  2MVV A;  3P8C E;  1VQ9 P;  1GK4 A;  3GW6 A;  2JU1 A;  3P8C D;  2ZJS E;  4OWF A;  4AQR D;  2FFD A;  2Q1K A;  1S1C X;  2KSE A;  3M9B A;  3CXC O;  1D7M A;  1ACP A;  3VMZ A;  1IFM A;  1UJZ A;  2YIU B;  3S4R A;  4L76 A;  1N2D C;  3EFG A;  3TSI A;  4EOT A;  1J1E C;  4HB1 A;  3HYB A;  1EZV D;  2FY8 A;  2V7Q H;  4NPE A;  4MRT C;  3PRJ A;  2IZ0 A;  2N9Y B;  2AF8 A;  3RK2 C;  1SS1 A;  1NO4 A;  4IOI H;  3Q3D A;  2KG6 A;  4U0A A;  3A3Y B;  3CC7 P;  2GZE A;  1X0T A;  5AW3 B;  5DJT B;  2KOP A;  2KNC B;  2NO8 A;  1IC2 A;  3E2D A;  1Q2N A;  1SQX E;  2FYN C;  4GR2 A;  1YTZ T;  2N5I A;  1LT1 A;  2WPT A;  1SVF A;  3FXE A;  3SWF A;  3KDP B;  5AW9 B;  3CCQ P;  3L70 G;  3VN0 A;  3CXH H;  3H1L G;  3V2N A;  3RK3 E;  4PV1 B;  2QJY C;  1Q86 Q;  4LLH A;  1SQP J;  2WIT A;  2V4H A;  1HGZ A;  2B89 A;  2R44 A;  5HGO A;  2KS1 A;  2PY8 A;  1BGY G;  3QH9 A;  4PH0 A;  1CEI A;  4WYM A;  1S2E A;  2FQ1 A;  1S3J A;  2R32 A;  2XU6 A;  1ZP0 C;  2WSE J;  5HV8 A;  2KZI A;  2FYU D;  2GUV A;  1NTM E;  2OYH A;  3RG6 C;  4JYC A;  3VMA A;  2QNW A;  1FZG A;  3BRV B;  3VP9 A;  3HE5 B;  1D1D A;  5F2O A;  2KOS A;  4W7Y A;  1YJ9 P;  3PJS K;  1DD3 A;  2PEQ A;  2N5H A;  1P84 D;  1ZR2 A;  5CCG C;  1LTJ A;  1PL5 A;  3CCS P;  2W27 A;  4ASW A;  2FBW C;  2FVE A;  5KLV J;  1MKM A;  1QX8 A;  3CWB E;  1BDC A;  1RH5 B;  2WSE H;  5CCH A;  2M8R A;  2GA1 A;  1SQQ G;  3RBX A;  1QGK B;  2KWL A;  3L72 E;  1NYH A;  1SFC B;  5AW5 B;  2QM8 A;  3KZI E;  2FYU J;  1HGV A;  1RQV A;  3A5T A;  2P7J A;  1R8E A;  3CCR P;  3H32 B;  2K9Y A;  1AVY A;  4A7P A;  3KXD A;  2P1J A;  2E1M A;  1E0H A;  2PFX A;  4KHX A;  4F37 A;  2L5G B;  3GZM A;  1T2K C;  3NXS A;  3W67 A;  3MGN A;  1PPJ D;  5CCH C;  1EIA A;  3DS0 A;  2KOQ A;  1NU1 D;  1CI6 A;  1PPJ E;  3G9R A;  2MKV A;  2JKV A;  2FKW B;  5BU5 A;  1OR5 A;  3BCC J;  5EW5 E;  1JEK A;  5KP6 B;  2I1K A;  1L4A C;  3VMY A;  3T97 A;  3AEE C;  2XZ0 D;  3H1I G;  2YXQ B;  3V4Q A;  1AQT A;  2H7H A;  1U7J A;  5AVS B;  3S1K A;  2ZT9 C;  1PEQ A;  2UWJ E;  2PEN A;  4TT3 H;  2HLO A;  3BAT A;  1FZF A;  1N7S B;  2JR8 A;  4JPZ B;  4WB4 A;  1L0N G;  3RL0 B;  2WSC J;  2VLN A;  2FYZ A;  3CX5 D;  1RE4 C;  2SPZ A;  1NU1 J;  4U0C A;  2BCC J;  2YMK A;  2FFD B;  1BE3 J;  2GDY A;  5KLI C;  3OAK A;  1VQL P;  3M0D A;  2K37 A;  3LRY A;  3F5H A;  4K35 A;  1N7S A;  2M3E A;  1BE3 G;  4H0L B;  1VF5 C;  4ZNC A;  2BUO A;  2JEE A;  1RF0 C;  2BCC G;  3DS3 A;  1JTH A;  3AE2 C;  2RMZ A;  3VMX A;  1SQB K;  1H88 A;  1IFN A;  3D71 A;  1FZC A;  1GU4 A;  2H43 A;  2CGQ A;  1PP9 E;  4O9B A;  4AUW A;  1YJW P;  2YXR B;  2P9X A;  3L70 E;  1JO5 A;  1M6E X;  4JYB A;  3O6Q B;  3HE5 A;  3TK1 A;  1YYC A;  2Z45 A;  2KP8 A;  2LXB A;  2YO2 A;  3L72 G;  2VSQ A;  1S9K D;  2M5R A;  1FE6 A;  3L70 J;  1F80 D;  1X22 A;  3HE4 A;  2C0X A;  1OVU A;  5AVW B;  1OW7 A;  2IBZ I;  5B66 H;  2E76 C;  4M0I A;  3C9I A;  3TGU J;  5AVQ B;  2KK7 A;  1NTZ E;  2WPS A;  3M06 A;  2CPS A;  4QKO A;  5E79 E;  5KP8 B;  3A0B E;  1GW3 A;  4U0D A;  3P05 A;  1N73 B;  1FZC C;  1FOS F;  2M5A B;  4DZO A;  3U59 A;  4WBA A;  3I56 P;  2K94 A;  1CI6 B;  4H44 B;  2BEQ D;  5I4T G;  1BGY E;  2WSC H;  5CZD B;  3GHG A;  1OWA A;  2P58 A;  1E79 H;  2A06 D;  2KOO A;  1OVV A;  4YXD C;  3ITK A;  3L74 E;  1IFI A;  1J1D C;  2KG8 A;  5APV A;  3CXH I;  2IX7 C;  2MF4 A;  1RF1 A;  5B5E E;  1BSN A;  4IFD K;  4WY4 D;  1PV3 A;  3L71 D;  3RL0 C;  1L0N E;  1ZLL A;  2R5D A;  5HVC A;  2GDW A;  2N50 A;  1LT9 C;  2ONT A;  1BAJ A;  5GTH H;  3C1L A;  2KLU A;  2WPQ A;  1VF5 D;  1W5C E;  1EXJ A;  1KN7 A;  1LT9 A;  2KLV A;  1CW5 A;  3W68 A;  4HKG A;  2MR7 A;  2QJP C;  5F2N A;  2QA4 P;  1NTK J;  5GTI H;  4PJ0 E;  3RK3 B;  2NPS B;  1VL2 A;  1IJD B;  4JQ0 D;  5APQ A;  1QL2 A;  2V7Q J;  1BCC J;  1S5L E;  2VLQ A;  2E75 C;  3NY7 B;  3G71 P;  2XDJ A;  3CX5 I;  1SP4 A;  1LTT C;  4ZMD A;  5BS1 A;  2AFD A;  1RE3 C;  2K9J B;  5APW A;  3CC2 P;  5TIS H;  1JM0 A;  1M1J A;  1WMK A;  1VQN P;  1P84 H;  2KOG A;  4IZ6 A;  1GW4 A;  3MHV A;  3B5N A;  2A45 G;  1SQP G;  1X79 B;  3L71 G;  3CWB J;  4H13 C;  1KQF B;  1NTM K;  2K9J A;  3IN6 A;  2BCC D;  5BVZ A;  3CCE P;  3R4Y A;  2BCC E;  3DS2 A;  2OYI A;  4GT1 A;  1L4A D;  4DG9 A;  3RL0 g;  1Q90 D;  1K30 A;  2HYN A;  1L0I A;  3M91 A;  4YTP C;  4C7N B;  4U7J A;  2FYU G;  3L74 D;  1L0L D;  2KR5 A;  1Q82 Q;  3N7N A;  1KQG B;  1YTZ I;  1T2K D;  3A2A A;  3H1H E;  3WU2 E;  3NTE A;  1QRJ A;  2IFM A;  2QIW A;  2P2U A;  4U3F J;  1A02 J;  2Y0C A;  2Z44 A;  2N1T C;  1M56 D;  1NAF A;  2L22 A;  1VKU A;  2ZVN B;  3AEF C;  3Q1M A;  3GG2 A;  1NTZ D;  2KNC A;  5AVU B;  3PTZ A;  1EDL A;  3D6Y A;  1KYO E;  3WMM 0;  4HH2 A;  1GTW A;  2AXT E;  4RES B;  1IO4 A;  2C0W A;  5CCG D;  3V6I A;  2LKM A;  2WT7 B;  3H32 A;  3LID A;  3SFE C;  1DH3 A;  1NKZ B;  3H1J D;  4AYC A;  1EDJ A;  1J1E B;  1KB9 I;  3G0V A;  2JU2 A;  1ZV8 A;  1KTM A;  2QJP B;  1N8R Q;  4ZKU A;  1P84 I;  1MZ9 A;  1AFO A;  2E75 D;  2KB7 P;  2LML A;  3H4E A;  2AEJ A;  5KLV E;  4JBZ A;  2KGE A;  2FAD A;  2LPK A;  4WWI A;  3DS1 A;  3B4Q A;  3IF4 A;  2GZF A;  1HQB A;  3CPW O;  1YHQ P;  1SQB G;  2HPC A;  2N9B A;  1URQ B;  4UHP B;  1FZA A;  1RF0 A;  2I8D A;  1UIX A;  3H6P A;  4GKG A;  3AED C;  2VLO A;  2DNW A;  3H1H D;  3M0D C;  1SQV E;  2XXM A;  3ABV C;  3A0H E;  2OYH B;  1RO0 A;  1M1K Q;  4OGQ D;  4XA4 A;  5AVZ B;  1PIX A;  2M8N A;  3M1M A;  2PEJ A;  2FFD C;  2QG4 A;  3B4S A;  1FR2 A;  1SQP D;  1RE4 A;  1ZRT D;  4GOF A;  2WZ7 A;  2R3S A;  1ZW0 A;  2JYL A;  2XV5 A;  2D2C B;  3TGU D;  1SQP E;  2RKL A;  3CCU P;  5CHX A;  2NZ2 A;  5AW8 B;  3SFD C;  2BHV A;  2KGD A;  5KLV K;  4QNB A;  1BCC G;  2N1T D;  3JSV C;  1VQO P;  3KQG A;  2KXP B;  1VDF A;  2Q7C A;  2X2B A;  2CNR A;  1RF1 C;  4R4M A;  1JOC A;  1G1J A;  1SQX J;  2E42 A;  3IR9 A;  1KQS O;  3LMO A;  3DS4 A;  2A06 G;  2KIK A;  3TF5 A;  4RKU J;  2XKM A;  5AVT B;  4B86 A;  2GYK A;  3G1G A;  2K3R A;  1AA0 A;  1S5L H;  1L0L E;  1HVV A;  1Z6M A;  1FC2 C;  2ERH A;  1A43 A;  5L8R J;  2PNG A;  1LWU A;  4N78 D;  3FWN A;  2WPV B;  2L4B A;  2L91 A;  3CL3 D;  3P7K A;  1RY3 A;  2QJK B;  1M57 D;  5AW2 B;  1H0T A;  1GXG A;  2Y9Z A;  1PGP A;  2D2C C;  1SQQ K;  1IFJ A;  2GUS A;  3U43 A;  3CMA P;  1KC8 Q;  3RK3 C;  2JAZ A;  2OTL P;  2MY5 A;  4COC A;  1T3U A;  1TU3 F;  1UNK A;  3V2P A;  3A7O A;  1M7L A;  1RF1 B;  5BU8 B;  1EZV I;  3CLQ A;  3HTK B;  4QMA A;  1SQQ D;  1XTC C;  1W2E A;  1Q81 Q;  1NTK K;  2OYO A;  5C39 A;  1LTJ B;  3EJE A;  4IPY A;  4Z1M H;  3E1I A;  3CC4 P;  3U1A A;  2OYH C;  1OX3 A;  3WUT A;  4L74 A;  1N7S C;  2OTJ P;  2K88 A;  1NTM J;  3S9O A;  1SQB J;  1QL1 A;  1M74 A;  1PPJ G;  2QJK C;  3A0B H;  2O01 N;  1JJ2 O;  1R5L A;  2J58 A;  4PD4 D;  1BGY D;  4H2Y C;  1HJB A;  3H1L E;  1YQ3 C;  1MV8 A;  5KAF H;  3P32 A;  1JCC A;  1NH4 A;  2H89 C;  4L75 A;  4PV1 D;  3M9Q A;  1BE3 E;  1DV5 A;  2A45 H;  2IFN A;  3H1H G;  3PHL A;  5HGN A;  1G1I A;  3JCU H;  3MTU E;  3ZDM A;  1ZME C;  1OIP A;  3BAS A;  1HBW A;  4GDO A;  3H1I E;  1FOS E;  1JY3 O;  3GJN A;  1QLE D;  2E76 D;  3FGA D;  4C46 A;  4WY4 B;  4WY4 A;  1E6J P;  4OVN F;  3USS A;  2FQ0 A;  4BRY A;  2LR2 A;  3FXD A;  2B88 A;  2CPB A;  4GOE A;  2J5U A;  1NJI Q;  5APY A;  1ZN5 A;  2Q9I A;  4K3A A;  2OYI C;  1SQX D;  3WBH A;  3L71 E;  1DX7 A;  1VPC A;  2ZXE B;  2R5B A;  2ZXX A;  2HPC B;  1NTM G;  2LXC B;  5KAF E;  2CWO A;  1RQU A;  2ITA A;  5AVX B;  2E43 A;  3B5N B;  2W6A A;  2FXM A;  1G2C A;  2A06 E;  3H1J J;  5E79 H;  1HTL C;  2IDB A;  1NTK G;  2E74 C;  2W6B A;  1KFM A;  2N1T B;  4IL6 E;  1NU1 G;  1VQ8 P;  1DEE G;  2FYU E;  1YIT P;  1IMP A;  1A8O A;  5H2F H;  5EFW B;  2QJY B;  1NTZ J;  3G1I A;  3TGU E;  2FYU K;  4UB6 H;  1GZL A;  2K0D X;  1AF8 A;  1PP9 G;  4CA3 A;  1BCC E;  1J2J B;  3L75 J;  3QWO C;  1KIL C;  1YQ4 C;  2GDX A;  2VRS A;  1PZQ A;  5CBN A;  4HJG H;  5AW1 B;  2KOD A;  4OGQ B;  4I7Z B;  4DOJ A;  1PGO A;  5KJ7 D;  5APU A;  2AVA A;  1H0T B;  2XNX A;  5AW6 B;  3EJB A;  1GK6 A;  2KI7 B;  5KJ7 A;  1AQ5 A;  4RO0 A;  5CJ0 A;  2GZG A;  3L75 E;  2YMY A;  5AVY B;  2M0B A;  3I5C A;  5APX A;  2WVR A;  1DEB A;  4H44 C;  2BQ1 E;  4BXL A;  4NPF X;  4XE5 B;  5GTH E;  2LL8 A;  2FAC A;  4LGD E;  5AW7 B;  1EQ7 A;  2Q5U A;  2PRR A;  3AE7 C;  4BPG A;  4PWV B;  1L0L K;  1AJY A;  2M8P A;  5AVV B;  2WSF H;  3EJD A;  5GTI E;  2B87 A;  3I55 P;  3OJA B;  1MUU A;  4U3F D;  1NTK D;  1LJ2 A;  1ZXG A;  2KW2 A;  1KYO I;  2LTE A;  3H0D A;  2JWA A;  2FXO A;  1XTG B;  3GLM A;  1IFD A;  2FAE A;  2HOD A;  2W90 A;  3JC2 2;  3MP7 B;  3AE3 C;  2C9L Y;  2LOL A;  1PFI A;  2OYI B;  1AV1 A;  2C9N Y;  1USD A;  1PP9 D;  2K0X A;  5JPA A;  1JCD A;  1S4X A;  2WWW A;  3L73 J;  4D6T J;  2I1J A;  3CXH D;  3VP8 A;  2JB0 A;  4PXH B;  3NFQ A;  5KAI H;  1VQ5 P;  1KMI Z;  1JMM A;  3KPE A;  1K9M Q;  4GIF A;  2CK3 H;  3L4F A;  1FZE A;  2KOR A;  1JNM A;  4IFF A;  1N86 A;  3H1K G;  1NGM B;  1NAY A;  3KZI H;  3WUV A;  5K5G B;  3UIA A;  3CX5 E;  3GMA A;  3SSU A;  3MUD A;  4U0B A;  1KIL A;  1YIJ P;  3H1K J;  2AFE A;  2E5T A;  3LW5 H;  3L36 A;  3V4W A;  5F2K A;  1N73 A;  1SQV J;  2E76 B;  1LTG C;  4IFM A;  1L0N K;  4XFZ A;  3D70 A;  1OMI A;  1FDI A;  1ZOY C;  2ROQ A;  3TGU G;  2HFE D;  1EXI A;  2WSF J;  3VRL C;  1BCC D;  1K04 A;  1NOH A;  3SWK A;  1KYO H;  4H0L C;  1SQV G;  1NWQ A;  2K2Q A;  2RN0 A;  1NTZ K;  2M5A A;  3NMD A;  2IBZ G;  3L73 G;  4D6T G;  1AVO A;  2GM4 A;  1QVF O;  1BXI A;  3CXH E;  1NQ4 A;  4XFJ A;  3G4S P;  2KUB A;  3G29 A;  1MZ8 A;  3CCL P;  4DJG A;  3LW5 J;  1L0N J;  3G3Z A;  3HZQ A;  4I6M C;  2JO0 A;  1LTI C;  3RK2 D;  3GHG C;  2WT7 A;  2BAS A;  3H1I J;  2QE7 H;  1ZRT E;  3KHU A;  2YNY A;  1LTS C;  3H1K D;  3L75 G;  2LF4 A;  4PJ0 H;  3CD6 P;  3E1R A;  1HH0 A;  3CI9 A;  3EWK A;  1CZQ A;  3E7K A;  2Y0D A;  1CSB A;  3G26 A;  1SQX K;  3TNU A;  3TNU B;  2KG9 A;  1PEO A;  1RHZ B;  1FJK A;  2JGP A;  2PP6 A; 
#chains in the Genus database with same CATH homology
 3H47 A;  4XRO A;  3CMA P;  1KC8 Q;  3G28 A;  2OTL P;  2EIA A;  3E2D A;  4U0F A;  2XXM A;  2DGY A;  4COC A;  4U0B A;  4GR6 A;  4U0E A;  5BS2 A;  4GR2 A;  1E6J P;  1YIJ P;  3NTE A;  1VQM P;  2BQ1 E;  1RO0 A;  3CCJ P;  1M1K Q;  2BUO A;  1QRJ A;  2ONT A;  1BAJ A;  3DS3 A;  2M8N A;  3M1M A;  3CCR P;  3DPH A;  2PEJ A;  5F2K A;  3CCQ P;  1NJI Q;  2Z44 A;  1VQN P;  4XFZ A;  2E1M A;  1YJW P;  2XV6 A;  2JYL A;  3WBH A;  2P9X A;  2M8P A;  4XFX A;  1M6E X;  2L6E A;  5F2N A;  2QA4 P;  1Q81 Q;  3CCU P;  4COP A;  3I55 P;  1QVG O;  1EIA A;  2BHV A;  3DS0 A;  1PEM A;  4QNB A;  2CWO A;  1Q86 Q;  4IPY A;  1AUM A;  3VRL C;  2Z45 A;  1VQO P;  1W2B O;  1K73 Q;  1VQ4 P;  3G6E P;  3CC4 P;  3MGE A;  3H0D A;  5HGO A;  2PY8 A;  3CME P;  2OTJ P;  2Z46 A;  3G71 P;  4PH0 A;  3CCV P;  1VQ6 P;  4WYM A;  1QVF O;  1VQK P;  1VQP P;  1EOQ A;  1S72 P;  5BS1 A;  1M74 A;  1IUQ A;  3G4S P;  3CC2 P;  4M0I A;  3G0V A;  1M90 Q;  3G29 A;  1VQ8 P;  1VQ9 P;  3B5I A;  3DS5 A;  3CCL P;  1VQ7 P;  2OAR A;  2PEK A;  5HGM A;  1N8R Q;  1KQS O;  1YIT P;  1JJ2 O;  1ZMB A;  1A8O A;  1RO2 A;  3HZQ A;  4U0D A;  3RG6 C;  5JPA A;  3G1I A;  2JO0 A;  3H4E A;  3P05 A;  3DS4 A;  2M8L A;  1RNI A;  1PEU A;  2EG5 A;  1PEQ A;  3CXC O;  3G1G A;  2PEN A;  3CCE P;  5HGL A;  3G21 A;  3I56 P;  1D1D A;  2XT1 A;  2PEI A;  5F2O A;  1YJ9 P;  2EFJ A;  3DTJ A;  3DS1 A;  3CCM P;  3DS2 A;  1M6N A;  4XFY A;  1VQ5 P;  2QEX P;  2PEO A;  3OW2 O;  2JYG A;  3CPW O;  1YHQ P;  1A43 A;  2PEQ A;  1K9M Q;  1YI2 P;  2LF4 A;  5I4T G;  1K8A Q;  1KD1 Q;  3CD6 P;  4U0C A;  1Q7Y Q;  3HYB A;  2KOD A;  4PH1 A;  1K30 A;  5HGN A;  3Q20 A;  3G26 A;  4XRQ A;  1YJN P;  3CCS P;  1PEO A;  2PEM A;  5DCK A;  1VQL P;  1Q82 Q;  4U0A A;  3CC7 P;  3LRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...