3CCMP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccmP02
1K73Q 1VQNP 3G6EP 1N8RQ 1VQ6P 3CCEP 1VQ9P 3CMEP 1M1KQ 2QEXP 1QVGO 1VQ5P 2QA4P 1YIJP 1YJWP 3CCUP 3CCQP 3G4SP 1YI2P 3CMAP 1KC8Q 1K9MQ 1JJ2O 3CCVP 3CC4P 3CCJP 1KQSO 3CCMP 1NJIQ 3CD6P 3OW2O 3CPWO 3CCSP 1YITP 1Q81Q 1S72P 1VQ8P 3CC2P 1W2BO 3I56P 3G71P 2OTJP 2OTLP 1YJ9P 1VQ4P 1VQOP 1YHQP 1Q86Q 1VQKP 1Q7YQ 3CC7P 1YJNP 1Q82Q 1VQMP 1VQLP 1K8AQ 3I55P 3CXCO 3CCRP 1QVFO 1M90Q 1KD1Q 1VQ7P 3CCLP 1VQPP
chains in the Genus database with same CATH superfamily
2R3SA 3FXDA 2IBZI 1D7MA 1PGQA 4Y28J 1NTKG 3CCVP 1ZW0A 3EJEA 2FAEA 3G28A 3HRNA 4PV1D 5L8RJ 1MZ9A 3RK3B 3M9QA 1CI6A 1LP1A 3L37A 2IZ1A 3DS0A 2LPKA 2X2BA 3PHLA 5DJUB 1Y9BA 1QRJA 1VF5B 1IO4A 2YKOA 5CCGD 3TNUB 4HJGH 1NTMJ 3G3ZA 3AE9C 2P2UA 1ZNVA 1LTAC 2MVVA 5HGLA 2WMMA 2HFED 1FDIA 2N5HA 4PJ0H 2JYLA 1L0NK 2E75D 4WY4A 1QLED 4R0MA 2GZIA 2KSEA 4I6MC 3CWBJ 2M0BA 4N3YB 1BSNA 3HUSC 1USEA 2OYIC 2Y0DA 1EIAA 1RE3A 1Q86Q 2EHSA 1Y47A 4RO0A 3MUDC 4PXHB 4PD4I 3DS2A 1Q82Q 3B4QA 2BCCJ 4JQ0D 4A7PA 2E76C 4HYTB 3CCEP 1SQVG 5AVXB 1F80D 5K5GB 1WMKA 4U3FJ 3G4SP 1JJ2O 2GUSA 3W67A 2Y0CA 1LJ2A 2KOGA 3O8ZA 2PEOA 1KLPA 2WZ7A 1LT9C 5F2OA 1EZVG 4MN4C 2Z46A 5KTBA 1RF1C 2LMLA 3HD7A 5KKZB 1LTIC 1SQQJ 1BCCD 2ZYDA 4QMAA 2AEFA 1JMMA 1KQSO 3AE8C 1YITP 3GF3A 1FE6A 3RK2B 1SQBE 1S72P 3GZLA 3H1IE 2FYNB 4EYYQ 1FZGA 3C9IA 1VQOP 4YXDC 2HG5D 1HWTC 1YJNP 3VMYA 3V4QA 1WT6A 3H32A 2R3CA 3HE4B 1CW5A 5EW5E 3TGUG 1SQBD 3MIWA 1DH3A 2M5AB 3H1ID 5APTA 2AFEA 3N4XA 3V2QA 4HB1A 2K92A 4HKZH 1SP4A 2EG5A 2R5DA 3Q2YA 2XDJA 1EDIA 4LGDE 2HYNA 3TSIA 1T8KA 2E76D 1HGVA 2FFDB 1VQ6P 3CCUP 2AEJA 3FWNA 1ZRTE 4U0DA 2VLOA 2OQQA 2FYUJ 4ASVA 2XNXA 1L4AC 1AF8A 1GK6A 3KZIE 3BRTB 2A45G 3H25A 1GMJA 3MHVA 3RK3C 1ZRTD 2O1KA 1SQXJ 1YYCA 2OYOA 3Q5RA 2QM7A 1VF5C 3M0AA 1K04A 2IZ0A 4UB6H 5B66E 4JPZB 3S4RA 1GU4A 4UB8H 2Q9IA 2QRXA 3WUTA 1PFIA 3FGAD 3AEGC 2EFJA 4NEOA 4IL6H 5KLVE 2IFMA 1ZP0C 4H44B 3JC22 2N1TA 4XA4A 1WRGA 3C8VA 1T3JA 2WPQA 1T6AA 3NTEA 1JMBA 2WVRA 3RK3E 1SQVE 1PEUA 5KLVD 4CA3A 2B87A 4IOIH 1CI6B 3GG2A 1LP1B 1PIXA 2W6BA 1L4AD 3CCSP 2XV5A 1FZCA 2JWDA 2L6EA 4K3AA 4NPEA 3USSA 2KOQA 3RK3D 1IK9A 1SQVD 1OMIA 2WSEH 2BHVA 3L72J 1RF0C 1USDA 1YQ4C 2CWOA 5B5EH 3AE3C 1ZMEC 2WSEJ 1N7SA 2AVAA 4WY4B 4U0FA 3AEBC 5KKZC 1W2EA 1NKZB 4H0LD 2JEEA 1VQLP 3LIEA 1RQVA 3VTPC 2ONTA 1N8RQ 2FVAA 1U7MA 1KORA 1IFPA 1M56D 5AW0B 2C0XA 1EDLA 2KGAA 1FU1A 3H1LE 3KHUA 3M0DC 1SQBK 4H2XC 2WPRA 2FQ0A 4K35A 3QH9A 3CMEP 2JGPA 5APQA 5APUA 2FHSC 4GOEA 2H8PD 3Q20A 3VYIA 3IFMA 1UIXA 2FKWB 3H1LD 1DD4A 4GT1A 4GDOA 5KJ7A 3WU2H 5AW4B 5DJTB 2JAZA 2PEJA 1YJ9P 1QL1A 5AW5B 2VLQA 3HD7B 1PP9G 1YBKA 3Q1MA 2XU6A 2FYZA 2G3AA 1M1KQ 3P7KA 2JYGA 2L5GB 2KOPA 1AV1A 3SWYA 2LR2A 1NOHA 2FVEA 3N7NA 1FBMA 2WQYC 4ZMDA 4U0CA 3H32B 4GOFA 5AW7B 4GIFA 3CL3D 2UWJE 1M8OB 3LMOA 2OARA 2PEKA 3EFGA 4AUWA 3BCCJ 1SFCC 4NPDA 2Z5IA 4QKOA 1FDMA 1P84E 2A45H 1FS0E 5TISE 3VMAA 2LKIA 1H88A 1VDFA 1NU1J 1EDKA 2D2CB 1JO5A 1Q7YQ 4IFDK 1M6NA 2P58A 4BWNA 2FACA 1RNIA 2KOSA 4PWVB 4BPGA 1X79B 2PP6A 2W6AA 1FZEA 2J5UA 1U7JA 2GA1A 1JM0A 2OYHA 2KZIA 2W27A 3CC7P 1JTHA 5KLVK 3LRYA 1KD1Q 3P32A 2VSQA 5KAIE 2PFXA 3H1KE 2ZXXA 3MP7B 3CCQP 1OW8A 3JSVC 5CJ0A 1S1CX 3H1JG 3AE4C 3H1KD 5CCHA 3WBHA 1SFCD 3W68A 4WY4C 2YO2A 5KLIB 1L2PA 4H13B 3WUVA 3PLNA 1J2JB 2M3BA 5AVQB 2I1KA 2JO0A 2N1TB 1L0NJ 1EZVI 1ZMBA 3RL0B 1LWUC 4I7ZC 1A8OA 5CBOA 1S5LX 1XTGB 2LTEA 2M8PA 1URQA 4CPGA 2QE7H 2B87B 1PEMA 2ZT9B 1GL2A 1D1DA 3AE7C 2O01N 1OVRA 1FZCB 2K0XA 2WWWA 2NPSA 2QJKB 2C0WA 2QM8A 5GTHH 1KMIZ 3I5CA 1X0TA 2Z5HA 1PP9E 1EMVA 1M74A 2CK3H 2KUBA 1NHLA 1OZHA 4DOJA 1NO4A 4YXWH 3L75E 4YPCA 5HVCA 2K9JA 3O6QA 1N7SB 3RG6C 3CPWO 1X9VA 1PP9D 1SQBG 2KLVA 3H1IG 3L71E 3M1MA 1LGHB 1T8ZA 3EQ2A 2AXTE 3FWLA 3L75D 5E79E 3IAOA 3OA7A 3CC2P 1BE3J 3MZWB 2WPTA 2KGDA 3L71D 2E43A 2A45I 3L70G 1BDCA 5BS1A 1JB0J 2N6ZA 4GR6A 2MR7A 2IFNA 3NFQA 1GXGA 2I1JA 2J59M 1SQPE 2WPVB 2MVUA 2HR3A 1VQPP 2D2CC 2GZEA 2YO3A 4HKGA 3DS3A 2E1MA 1SQPD 2N9YB 2PENA 2KIKA 3PH0A 3GHGA 3L74J 3CCRP 1PPJE 5F2KA 1ZLLA 1RO2A 2BUOA 1QVGO 4M3LA 2E74B 1BGYG 2Z4EA 1N86A 5CJ4A 2P1JA 1PPJD 1JY3O 2JU1A 1OWAA 3H1JE 1KYOE 1KTMA 4U0AA 1RHZB 1PGJA 1JY3N 1AQTA 2BCCE 1YQ3C 1KFNA 1VQ7P 2GM4A 4U3FE 1S2EA 2KR5A 1NGMB 1W5CE 3H1JD 1KYOD 3L35A 1JOCA 2KGCA 1E79H 3VRLC 2ITAA 3DS5A 5KLVG 2BCCD 1KZUB 4OWFA 5KLIC 2Q1KA 3F89A 4H13C 5AVZB 1AUMA 3AEDC 4XFZA 2N1TC 3CXCO 1QVFO 3RL0C 2H89C 2KI7B 2D2CD 1ZOYC 1PEOA 1SQQE 1YJWP 3GZMA 4Y99B 4OGQB 4COCA 3Q5PA 3RG2A 3S1KA 1JTHB 1HY8A 1FZCC 5AW1B 2QJKC 1SQQD 4BPHA 2MD9A 1JY2O 3EFFK 2AFDA 3CXHE 4GR2A 5APYA 1JY2N 1IFDA 3ABVC 2PEQA 1M1JC 3HTKA 2GDYA 1Z56A 1H89A 1IZNB 5EJDA 2Y0EA 1LTSC 2P10A 3CXHD 3VN0A 1AVOA 1FZAA 5CCGA 3E1IA 5JPAA 4W7ZA 1YHQP 1HH0A 2Q6QA 5AVWB 1KILA 1OX3A 1H0TA 3IF4A 2ZFCA 2N98A 1BCCJ 3L70E 2J58A 1URQB 2Q7CA 2IYPA 1A02J 3M9BA 4R4MA 2JR8A 1GL2B 4L75A 3H1LG 1LT1A 2NPSB 2YMYA 4IFMA 3KPEA 2PAJA 3L70D 1K9MQ 1HJ0A 2AXCA 2QJPB 1KV4A 2MY5A 2QJYB 1LNQA 2LKMA 1SQBJ 2IDBA 2PRRA 4JBZA 3H0DA 1DEEG 1IFIA 5KJ7C 4KHXA 3L73G 5APWA 2K9JB 3H4EA 2FQ2A 3O6QB 1GW3A 2W6JH 2EHTA 4U0EA 3LIDA 1N2DC 1M7LA 1SQPK 2XT1A 3TDKA 3AE2C 1BGYE 2KG6A 3A0BE 1PL5A 3V2NA 4DZOA 2E5TA 1VQ8P 1GK4A 2HODA 1PGOA 4H2YC 4BRYA 2E74C 5AVSB 2R44A 2HLOA 4RJTA 2O3JA 1BGYD 3KXDA 2C9LY 2QEXP 3IR9A 1NTKJ 3KZIH 3U59A 3V2RA 2ZVNB 3GF7A 3DPHA 1L0IA 2IBZG 2GZFA 3E2DA 2ROQA 2Q3IA 2K3RA 3CX5E 2OTLP 1IMQA 2P9XA 1VKUA 3WUUA 3WMM0 3HUSA 2L0QA 5B66H 2C9NY 3L72E 4IL6X 1H8AA 2OYIA 2KZJA 4EIJA 1LTGC 3CX5D 1KQFB 3QWOC 3EJDA 1QL2A 4LLHA 1NTZG 3GHGB 2O01H 4M0IA 5KJ7D 5CZDB 4RESB 4Y99C 2K5XA 4OGQC 5TJHA 2AEMA 2O01J 4DJGA 3L72D 1YTZI 1JUNA 2PEMA 2N9BA 4IPYA 1VQ5P 1VF5D 3H1KG 3AEFC 4N6JA 2YXQB 1J1EB 5KLVJ 1LT9A 1SVFA 1SQQK 1VL2A 2K1AA 3H1HE 4H2WC 1BDDA 2G8YA 1UIIA 1DX7A 3RK2C 2KSJA 1OXZA 1Y8AA 1SQVJ 3A0HE 4JYBA 2FYNC 5H2FE 5CCHC 1YTZT 3D70A 3H1HD 2FVFA 1MFZA 3Q3DA 2MF4A 1DEBA 2KP8A 5KAFE 5AW9B 1GXHA 3PP5A 1IC2A 2Y9YA 2KYVA 1RE4C 2QG4A 2OGUA 3OJAB 1M90Q 2L22A 1URQC 1FZFA 1RH5B 2ZJSE 1GL2C 5HGNA 5BVZA 1N7LA 2JDIH 3RL0g 1GD2E 4ZKUA 2PY8A 2NPSC 2LOLA 4XE5B 4OGQD 1LTJA 2FFDC 4HH2A 2M8LA 2QJYC 1X22A 3L73E 1HQBA 1DV5A 1FJPA 3HTKB 1VQNP 3TGUJ 1S3JA 3L75G 3V6IA 1JCCA 3JCUE 4F37A 2YKQA 3L73D 1KB9E 3V4WA 3L71G 1KN7A 3ZDMA 3H1LJ 3PTZA 4I2LC 3SWKA 4B86A 3RK2D 1KILB 1K8AQ 4D6TE 1H0TB 4COPA 2FY8A 1E6JP 1KB9D 1NKNA 1DD3A 2YIUB 2PGDA 2E75B 5APVA 2NO8A 1JNMA 1EDJA 2IBZE 4D6TD 4GODA 3L36A 4NPFX 1S9KE 1SQPG 4OVNF 3A7OA 4EOTA 3B71A 3MD0A 1P84D 4H44C 2IBZD 2Y9ZA 4MRTC 2Z45A 3H47A 1NTZE 1S9KD 1QX8A 3A5TA 3II6A 1MZ8A 2LIWA 1GW4A 2GZGA 1PPJG 5TISH 1HVVA 1NTZD 2NZ2A 3NMDA 1S5LE 3CWBG 2IYOA 2I8DA 4WBAA 2ZYAA 3EWKA 4BRYB 1MKMA 4W7YA 4XRQA 3VOPA 3D71A 3AE5C 3CE7A 5CBNA 1RF0A 2BCCG 4L76A 4PD4E 1L0LE 4GKGA 4U3FG 4DT0A 1IUQA 1JY3P 3D6YA 3A3YB 3MTUE 1DIPA 1AYIA 2GDWA 4DCKA 5KAIH 1NH4A 4PD4D 3G0VA 1L0LD 3HUSB 3R4YA 4H44D 1RE3C 3CI9A 2OYIB 3AECC 1OVVA 1ACPA 3OAKA 1SQQG 5HGOA 3K5BA 1NJIQ 2XNDH 2E76B 2PNGA 5AVTB 1T2KC 3GKLC 2IPPA 4TT3H 3V5BA 1PZQA 4I1LA 2VLNA 3MGNA 1BSHA 1LT9B 2JKVA 2KW2A 5DCKA 3HD7C 3DS1A 1HJBA 1FR2A 2P67A 4XFYA 3I56P 2B89A 5KP7B 2V7QH 2VLPA 1VQKP 1JY2P 4WY4D 2GZJA 2FXMA 5AW2B 5GTIE 1YIJP 5AVVB 4TLFA 3CC4P 3MGEA 3CD6P 1FJKA 1KILC 1FOSF 3G1IA 5APXA 1L0HA 2FYUG 3AEAC 1EC5A 4BXLA 1PP9J 3SFDC 2YIUC 3L74E 3AE6C 1SFCA 1KFMA 3TF5A 3ITKA 5AVUB 3B5NA 3G9RA 2CQ8A 2KK7A 3BRVB 1NTME 2AXTH 2N5IA 1LTJB 1G1IA 2O1JA 5E79H 1FC2C 3L74D 3L71J 1T2KD 1EXIA 1FZBA 3U1AA 1FAVA 1BXIA 2N6YA 1NTMD 3DS4A 2AF8A 5EFWB 2QVAA 4PJ0E 1S4XA 2ZAEB 3HD7D 1ZXGA 3AEEC 2KORA 2MJZA 3CWBE 1NQ4A 1R5LA 1EOQA 1MV8A 1KILE 3E7KA 3RGUA 1LTTC 1SQPJ 2KS1A 2ZXEB 2MKVA 3FX0A 1NTZK 3NTNA 4IFFA 3CWBD 3B8EB 1BAJA 4U0BA 1KILD 2EIAA 1NAYA 2DGYA 2M8NA 5HV8A 4H0LB 2YMKA 1HF9A 1KQLA 2KNCA 1SLQA 2JB0A 1Q2NA 4U3FD 1MFTA 3M06A 1LWUA 2XXMA 4C46A 1KYOH 3L72G 2W8ZA 2KG9A 2OYHB 1L0LK 3FXEA 5APSA 2ZT9C 3H1JJ 1J1DB 1LTBC 3F5HA 4KJMA 2LL8A 2Q3EA 3PRJA 1OVUA 5AVRB 4L73A 1T3UA 1FOSE 4DG9A 1FDOA 1CEIA 3SFEC 2OTKE 2WT7A 2CGQA 3CCJP 4L74A 3OW2O 1BCCE 1NYHA 3H1HG 4W80A 1N7SC 2CG5B 2XV6A 2JO1A 2KG8A 4U7JA 5AW8B 1EXJA 4JF7A 2HPCA 1HBWA 1KQGB 3RBXA 2K0DX 2W83C 4H13D 2FYUE 3CXHH 1VQ4P 2R32A 2N1TD 2FADA 3RL0D 1N73A 7CEIA 1PGPA 2WSCH 4R4LA 1SQXE 1X3OA 3LW5H 2FYUD 3KDPB 2FQ1A 1JEKA 2KODA 2ZT9D 2WSCJ 1Q81Q 1M57D 3H1IJ 3LW5J 2LXCB 1R5SA 4UHPB 2WITA 1LTJC 1SQXD 1U57A 2M8RA 4UB6E 3CCLP 1PEQA 5AW6B 1E0HA 1DNYA 1NTKE 3BCCG 4EI2A 2JQ4A 3VMXA 4UB8E 1RQUA 3L70J 1NTMK 2FXPA 1N7SD 2FXOA 1XTCC 1NU1G 1G2CA 4LC1A 4ASWA 2XZ1C 4IL6E 1NTKD 2FBWC 2PEIA 4D6TG 5BS2A 3G6EP 2P7JA 2XKMA 2W90A 3G29A 2CPBA 2YKPA 1SFCB 3M91A 2E5YA 2H88C 3B5NB 2Z44A 1VQMP 4H0LC 3A0BH 2KWLA 3D6ZA 5HGMA 3M9HA 2KGEA 5BU5A 2K93A 3TK1A 3KQGA 1BGYJ 1KYOI 1CSBA 1R8EA 3T97A 3MUDA 2BEQD 4AYCA 4AQRD 1OW6A 3SWFA 5B5EE 1GZLA 2M3EA 2K0YA 2OYHC 3BASA 2QSIA 1OW7A 2RH0A 1K73Q 1J1DC 4JYCA 1GTWA 1AJYA 3CX5H 3CMAP 2CPSA 4WYMA 1A43A 3NXSA 2RN0A 5BU8B 1L0NG 2KS1B 1IFMA 2K9YA 2KXPB 3B5IA 2E74D 1RF1A 1EZVE 1UNKA 1GU5A 3UIAA 3VP8A 1M1JA 3H6PA 4Z1MH 1G1JA 1L0LG 1KC8Q 1PV3A 4QNBA 1OR5A 3E1RA 3DTJA 2KNCB 1EZVD 2K88A 3CXHI 2JWAA 3HE5A 2DW3A 1LWUB 1GDTA 2A06G 3C1LA 4I7ZB 3NY7B 3GJNA 3G26A 3WU2E 3TGUE 2GYKA 2XZRA 2QA4P 3H1HJ 2B9BA 1K30A 1GPJA 1K05A 1OFCX 4YTPC 5M1BA 4C7RA 3A0HH 5H2FH 3TGUD 2QJPC 4C7NA 2V4HA 2H43A 2FYUK 2GDXA 5KP6B 2JBGA 4XFJA 2WT7B 1RY3A 4XROA 4PV1B 1BE3G 2K94A 5KAFH 5KP8B 3BCCE 1Z6MA 2MR8A 2WPSA 2WSFH 1L4AA 1SQXK 3IN6A 5I4TG 2WSFJ 3G21A 1NU1E 1ZV8A 5CHXA 3BCCD 2H7HA 2HPCB 4O9BA 4WB4A 5CCHD 3U1CA 4KT0J 2ZVOB 5F2NA 4N78E 3TNUA 1NU1D 3BATA 4OH8B 4PH0A 3VP9A 2RKLA 1NTKK 3AE1C 1CZQA 1IFJA 1N73B 3L73J 1HUCA 3L74G 4N78D 1URQD 4WWIA 3P8MC 1QGKB 3JCUH 1KB9H 1GL2D 1NTMG 1QEXA 3B5NC 2NPSD 2GUVA 2CNRA 2N50A 2L91A 3KYQA 3B4SA 2LIUA 2ERHA 2KOOA 3BVHA 4D6TJ 3VMZA 3I55P 2LXBA 3S9OA 1P84H 1ZR2A 1NWQA 1MUUA 3GHGC 2BEZF 2LF4A 4EDFA 2L4BA 3U43A 1ZN5A 3CX5I 2HODB 3A2AA 2BASA 1G2CB 2YNYA 1L0NE 3L4FA 2POHA 3GW6A 1OIPA 1AFOA 2R5BA 1IK7A 2M5RA 1AVYA 1J1EC 2QIWA 2ZYGA 5C39A 1L0ND 3P8CE 2VRSA 4IZ6A 1UJZA 1IFNA 1SQVK 1NTZJ 1ZR4A 1S5LH 2KB7P 3P8CD 5GTHE 2A06E 3CLQA 3B5ND 4ZKPA 3T97B 1VQ9P 3SSUA 3H1KJ 3HE4A 5CMZA 2E42A 1NVOA 3CCMP 1JCDA 1AQ5A 2M5AA 1VPCA 1RE4A 2A06D 3M0DA 2WSSH 3G71P 3Q5SA 4PD4H 1Q90D 1AA0A 1L0LJ 1BE3E 2JJLA 1X8YA 3V2PA 4WVZA 2FFDA 2QNWA 1RF1B 3GMAA 2JU2A 1BCCG 4PV1C 3TYYA 1M1JB 1BE3D 2DNWA 2JP3A 1IMPA 2V7QJ 5AW3B 2OTJP 1E5WA 4RKUJ 5CCGC 3HZQA 2B88A 2SPZA 4XFXA 3PJSK 3HE5B 5AVYB 3GLMA 4PH1A 2WTYA 3EJBA 2L9FA 2YXRB 2KLUA 1M6EX 1SS1A 2RMZA 2BQ1E 2NRGA 2E75C 1A02F 2XZ0D 1NU1K 2K37A 3L75J 2K2QA 3G1GA 1KB9I 1N73C 1SQXG 1YI2P 3RBZA 1RO0A 1EQ7A 3R2PA 2Q5UA 3P05A 4BPFA 4C7NB 1HGZA 1HTLC 1W2BO 1VHNA 1TU3F 1IJDB 3HYBA 5GTIH 1NAFA 2IX7C 4ZNCA 1P84I 1L4AB
chains in the Genus database with same CATH topology
4U0EA 1K73Q 1PEOA 1VQ9P 3CMEP 5F2NA 2XT1A 2EIAA 1YJWP 3CCQP 2DGYA 2M8NA 3CMAP 4COCA 5DCKA 3CCVP 4WYMA 1A43A 3G28A 2EFJA 3CCMP 2KODA 1KQSO 1YITP 3DS1A 3Q20A 1Q81Q 2Z45A 3H47A 4PH0A 5BS1A 1S72P 1VQ8P 4XFYA 3I56P 4GR6A 3G71P 3DS0A 2PEJA 3B5IA 1VQOP 1YJ9P 1VQKP 1YJNP 1QRJA 1M90Q 3WBHA 3CCLP 3NTEA 1PEQA 1VQPP 4GR2A 1PEUA 1M1KQ 2XXMA 2QEXP 1YIJP 2JYGA 1KC8Q 3CC4P 2PEQA 3MGEA 2JO0A 4QNBA 5HGNA 3DS3A 2E1MA 3CD6P 3DTJA 3DPHA 1ZMBA 3CCSP 3G1IA 3E2DA 2PY8A 1A8OA 2EG5A 2PENA 2L6EA 4XRQA 5HGLA 4U0CA 2OTLP 2JYLA 2M8PA 2M8LA 2P9XA 3I55P 3CCRP 2OARA 2PEIA 5F2KA 5JPAA 2PEKA 1PEMA 1RO2A 3G26A 5BS2A 1YHQP 2BUOA 1D1DA 1VQNP 3G6EP 1VQ6P 2BHVA 2LF4A 1QVGO 3G29A 2QA4P 2OTJP 3CCUP 3HZQA 3CCJP 1IUQA 3OW2O 4U0DA 2CWOA 4XFXA 1K30A 4M0IA 1EIAA 4U0FA 4PH1A 1Q86Q 4U0AA 1Q7YQ 2Z44A 3G0VA 1M6NA 1M74A 3DS2A 1VQMP 2XV6A 1Q82Q 1K8AQ 1VQLP 1M6EX 1VQ7P 1RNIA 4COPA 2BQ1E 3DS4A 4XROA 5HGMA 3G1GA 3CCEP 2ONTA 2PEMA 5HGOA 1E6JP 4IPYA 1VQ5P 1N8RQ 1K9MQ 3G4SP 1JJ2O 1YI2P 3RG6C 1RO0A 1NJIQ 3CPWO 3VRLC 1EOQA 3DS5A 3P05A 5I4TG 2PEOA 1W2BO 3G21A 3M1MA 3H0DA 1AUMA 1VQ4P 5F2OA 3HYBA 3CC7P 4XFZA 3LRYA 2Z46A 3CXCO 3H4EA 1QVFO 1KD1Q 1BAJA 3CC2P 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 Q;  1VQN P;  3G6E P;  1N8R Q;  1VQ6 P;  3CCE P;  1VQ9 P;  3CME P;  1M1K Q;  2QEX P;  1QVG O;  1VQ5 P;  2QA4 P;  1YIJ P;  1YJW P;  3CCU P;  3CCQ P;  3G4S P;  1YI2 P;  3CMA P;  1KC8 Q;  1K9M Q;  1JJ2 O;  3CCV P;  3CC4 P;  3CCJ P;  1KQS O;  3CCM P;  1NJI Q;  3CD6 P;  3OW2 O;  3CPW O;  3CCS P;  1YIT P;  1Q81 Q;  1S72 P;  1VQ8 P;  3CC2 P;  1W2B O;  3I56 P;  3G71 P;  2OTJ P;  2OTL P;  1YJ9 P;  1VQ4 P;  1VQO P;  1YHQ P;  1Q86 Q;  1VQK P;  1Q7Y Q;  3CC7 P;  1YJN P;  1Q82 Q;  1VQM P;  1VQL P;  1K8A Q;  3I55 P;  3CXC O;  3CCR P;  1QVF O;  1M90 Q;  1KD1 Q;  1VQ7 P;  3CCL P;  1VQP P; 
#chains in the Genus database with same CATH topology
 2R3S A;  3FXD A;  2IBZ I;  1D7M A;  1PGQ A;  4Y28 J;  1NTK G;  3CCV P;  1ZW0 A;  3EJE A;  2FAE A;  3G28 A;  3HRN A;  4PV1 D;  5L8R J;  1MZ9 A;  3RK3 B;  3M9Q A;  1CI6 A;  1LP1 A;  3L37 A;  2IZ1 A;  3DS0 A;  2LPK A;  2X2B A;  3PHL A;  5DJU B;  1Y9B A;  1QRJ A;  1VF5 B;  1IO4 A;  2YKO A;  5CCG D;  3TNU B;  4HJG H;  1NTM J;  3G3Z A;  3AE9 C;  2P2U A;  1ZNV A;  1LTA C;  2MVV A;  5HGL A;  2WMM A;  2HFE D;  1FDI A;  2N5H A;  4PJ0 H;  2JYL A;  1L0N K;  2E75 D;  4WY4 A;  1QLE D;  4R0M A;  2GZI A;  2KSE A;  4I6M C;  3CWB J;  2M0B A;  4N3Y B;  1BSN A;  3HUS C;  1USE A;  2OYI C;  2Y0D A;  1EIA A;  1RE3 A;  1Q86 Q;  2EHS A;  1Y47 A;  4RO0 A;  3MUD C;  4PXH B;  4PD4 I;  3DS2 A;  1Q82 Q;  3B4Q A;  2BCC J;  4JQ0 D;  4A7P A;  2E76 C;  4HYT B;  3CCE P;  1SQV G;  5AVX B;  1F80 D;  5K5G B;  1WMK A;  4U3F J;  3G4S P;  1JJ2 O;  2GUS A;  3W67 A;  2Y0C A;  1LJ2 A;  2KOG A;  3O8Z A;  2PEO A;  1KLP A;  2WZ7 A;  1LT9 C;  5F2O A;  1EZV G;  4MN4 C;  2Z46 A;  5KTB A;  1RF1 C;  2LML A;  3HD7 A;  5KKZ B;  1LTI C;  1SQQ J;  1BCC D;  2ZYD A;  4QMA A;  2AEF A;  1JMM A;  1KQS O;  3AE8 C;  1YIT P;  3GF3 A;  1FE6 A;  3RK2 B;  1SQB E;  1S72 P;  3GZL A;  3H1I E;  2FYN B;  4EYY Q;  1FZG A;  3C9I A;  1VQO P;  4YXD C;  2HG5 D;  1HWT C;  1YJN P;  3VMY A;  3V4Q A;  1WT6 A;  3H32 A;  2R3C A;  3HE4 B;  1CW5 A;  5EW5 E;  3TGU G;  1SQB D;  3MIW A;  1DH3 A;  2M5A B;  3H1I D;  5APT A;  2AFE A;  3N4X A;  3V2Q A;  4HB1 A;  2K92 A;  4HKZ H;  1SP4 A;  2EG5 A;  2R5D A;  3Q2Y A;  2XDJ A;  1EDI A;  4LGD E;  2HYN A;  3TSI A;  1T8K A;  2E76 D;  1HGV A;  2FFD B;  1VQ6 P;  3CCU P;  2AEJ A;  3FWN A;  1ZRT E;  4U0D A;  2VLO A;  2OQQ A;  2FYU J;  4ASV A;  2XNX A;  1L4A C;  1AF8 A;  1GK6 A;  3KZI E;  3BRT B;  2A45 G;  3H25 A;  1GMJ A;  3MHV A;  3RK3 C;  1ZRT D;  2O1K A;  1SQX J;  1YYC A;  2OYO A;  3Q5R A;  2QM7 A;  1VF5 C;  3M0A A;  1K04 A;  2IZ0 A;  4UB6 H;  5B66 E;  4JPZ B;  3S4R A;  1GU4 A;  4UB8 H;  2Q9I A;  2QRX A;  3WUT A;  1PFI A;  3FGA D;  3AEG C;  2EFJ A;  4NEO A;  4IL6 H;  5KLV E;  2IFM A;  1ZP0 C;  4H44 B;  3JC2 2;  2N1T A;  4XA4 A;  1WRG A;  3C8V A;  1T3J A;  2WPQ A;  1T6A A;  3NTE A;  1JMB A;  2WVR A;  3RK3 E;  1SQV E;  1PEU A;  5KLV D;  4CA3 A;  2B87 A;  4IOI H;  1CI6 B;  3GG2 A;  1LP1 B;  1PIX A;  2W6B A;  1L4A D;  3CCS P;  2XV5 A;  1FZC A;  2JWD A;  2L6E A;  4K3A A;  4NPE A;  3USS A;  2KOQ A;  3RK3 D;  1IK9 A;  1SQV D;  1OMI A;  2WSE H;  2BHV A;  3L72 J;  1RF0 C;  1USD A;  1YQ4 C;  2CWO A;  5B5E H;  3AE3 C;  1ZME C;  2WSE J;  1N7S A;  2AVA A;  4WY4 B;  4U0F A;  3AEB C;  5KKZ C;  1W2E A;  1NKZ B;  4H0L D;  2JEE A;  1VQL P;  3LIE A;  1RQV A;  3VTP C;  2ONT A;  1N8R Q;  2FVA A;  1U7M A;  1KOR A;  1IFP A;  1M56 D;  5AW0 B;  2C0X A;  1EDL A;  2KGA A;  1FU1 A;  3H1L E;  3KHU A;  3M0D C;  1SQB K;  4H2X C;  2WPR A;  2FQ0 A;  4K35 A;  3QH9 A;  3CME P;  2JGP A;  5APQ A;  5APU A;  2FHS C;  4GOE A;  2H8P D;  3Q20 A;  3VYI A;  3IFM A;  1UIX A;  2FKW B;  3H1L D;  1DD4 A;  4GT1 A;  4GDO A;  5KJ7 A;  3WU2 H;  5AW4 B;  5DJT B;  2JAZ A;  2PEJ A;  1YJ9 P;  1QL1 A;  5AW5 B;  2VLQ A;  3HD7 B;  1PP9 G;  1YBK A;  3Q1M A;  2XU6 A;  2FYZ A;  2G3A A;  1M1K Q;  3P7K A;  2JYG A;  2L5G B;  2KOP A;  1AV1 A;  3SWY A;  2LR2 A;  1NOH A;  2FVE A;  3N7N A;  1FBM A;  2WQY C;  4ZMD A;  4U0C A;  3H32 B;  4GOF A;  5AW7 B;  4GIF A;  3CL3 D;  2UWJ E;  1M8O B;  3LMO A;  2OAR A;  2PEK A;  3EFG A;  4AUW A;  3BCC J;  1SFC C;  4NPD A;  2Z5I A;  4QKO A;  1FDM A;  1P84 E;  2A45 H;  1FS0 E;  5TIS E;  3VMA A;  2LKI A;  1H88 A;  1VDF A;  1NU1 J;  1EDK A;  2D2C B;  1JO5 A;  1Q7Y Q;  4IFD K;  1M6N A;  2P58 A;  4BWN A;  2FAC A;  1RNI A;  2KOS A;  4PWV B;  4BPG A;  1X79 B;  2PP6 A;  2W6A A;  1FZE A;  2J5U A;  1U7J A;  2GA1 A;  1JM0 A;  2OYH A;  2KZI A;  2W27 A;  3CC7 P;  1JTH A;  5KLV K;  3LRY A;  1KD1 Q;  3P32 A;  2VSQ A;  5KAI E;  2PFX A;  3H1K E;  2ZXX A;  3MP7 B;  3CCQ P;  1OW8 A;  3JSV C;  5CJ0 A;  1S1C X;  3H1J G;  3AE4 C;  3H1K D;  5CCH A;  3WBH A;  1SFC D;  3W68 A;  4WY4 C;  2YO2 A;  5KLI B;  1L2P A;  4H13 B;  3WUV A;  3PLN A;  1J2J B;  2M3B A;  5AVQ B;  2I1K A;  2JO0 A;  2N1T B;  1L0N J;  1EZV I;  1ZMB A;  3RL0 B;  1LWU C;  4I7Z C;  1A8O A;  5CBO A;  1S5L X;  1XTG B;  2LTE A;  2M8P A;  1URQ A;  4CPG A;  2QE7 H;  2B87 B;  1PEM A;  2ZT9 B;  1GL2 A;  1D1D A;  3AE7 C;  2O01 N;  1OVR A;  1FZC B;  2K0X A;  2WWW A;  2NPS A;  2QJK B;  2C0W A;  2QM8 A;  5GTH H;  1KMI Z;  3I5C A;  1X0T A;  2Z5H A;  1PP9 E;  1EMV A;  1M74 A;  2CK3 H;  2KUB A;  1NHL A;  1OZH A;  4DOJ A;  1NO4 A;  4YXW H;  3L75 E;  4YPC A;  5HVC A;  2K9J A;  3O6Q A;  1N7S B;  3RG6 C;  3CPW O;  1X9V A;  1PP9 D;  1SQB G;  2KLV A;  3H1I G;  3L71 E;  3M1M A;  1LGH B;  1T8Z A;  3EQ2 A;  2AXT E;  3FWL A;  3L75 D;  5E79 E;  3IAO A;  3OA7 A;  3CC2 P;  1BE3 J;  3MZW B;  2WPT A;  2KGD A;  3L71 D;  2E43 A;  2A45 I;  3L70 G;  1BDC A;  5BS1 A;  1JB0 J;  2N6Z A;  4GR6 A;  2MR7 A;  2IFN A;  3NFQ A;  1GXG A;  2I1J A;  2J59 M;  1SQP E;  2WPV B;  2MVU A;  2HR3 A;  1VQP P;  2D2C C;  2GZE A;  2YO3 A;  4HKG A;  3DS3 A;  2E1M A;  1SQP D;  2N9Y B;  2PEN A;  2KIK A;  3PH0 A;  3GHG A;  3L74 J;  3CCR P;  1PPJ E;  5F2K A;  1ZLL A;  1RO2 A;  2BUO A;  1QVG O;  4M3L A;  2E74 B;  1BGY G;  2Z4E A;  1N86 A;  5CJ4 A;  2P1J A;  1PPJ D;  1JY3 O;  2JU1 A;  1OWA A;  3H1J E;  1KYO E;  1KTM A;  4U0A A;  1RHZ B;  1PGJ A;  1JY3 N;  1AQT A;  2BCC E;  1YQ3 C;  1KFN A;  1VQ7 P;  2GM4 A;  4U3F E;  1S2E A;  2KR5 A;  1NGM B;  1W5C E;  3H1J D;  1KYO D;  3L35 A;  1JOC A;  2KGC A;  1E79 H;  3VRL C;  2ITA A;  3DS5 A;  5KLV G;  2BCC D;  1KZU B;  4OWF A;  5KLI C;  2Q1K A;  3F89 A;  4H13 C;  5AVZ B;  1AUM A;  3AED C;  4XFZ A;  2N1T C;  3CXC O;  1QVF O;  3RL0 C;  2H89 C;  2KI7 B;  2D2C D;  1ZOY C;  1PEO A;  1SQQ E;  1YJW P;  3GZM A;  4Y99 B;  4OGQ B;  4COC A;  3Q5P A;  3RG2 A;  3S1K A;  1JTH B;  1HY8 A;  1FZC C;  5AW1 B;  2QJK C;  1SQQ D;  4BPH A;  2MD9 A;  1JY2 O;  3EFF K;  2AFD A;  3CXH E;  4GR2 A;  5APY A;  1JY2 N;  1IFD A;  3ABV C;  2PEQ A;  1M1J C;  3HTK A;  2GDY A;  1Z56 A;  1H89 A;  1IZN B;  5EJD A;  2Y0E A;  1LTS C;  2P10 A;  3CXH D;  3VN0 A;  1AVO A;  1FZA A;  5CCG A;  3E1I A;  5JPA A;  4W7Z A;  1YHQ P;  1HH0 A;  2Q6Q A;  5AVW B;  1KIL A;  1OX3 A;  1H0T A;  3IF4 A;  2ZFC A;  2N98 A;  1BCC J;  3L70 E;  2J58 A;  1URQ B;  2Q7C A;  2IYP A;  1A02 J;  3M9B A;  4R4M A;  2JR8 A;  1GL2 B;  4L75 A;  3H1L G;  1LT1 A;  2NPS B;  2YMY A;  4IFM A;  3KPE A;  2PAJ A;  3L70 D;  1K9M Q;  1HJ0 A;  2AXC A;  2QJP B;  1KV4 A;  2MY5 A;  2QJY B;  1LNQ A;  2LKM A;  1SQB J;  2IDB A;  2PRR A;  4JBZ A;  3H0D A;  1DEE G;  1IFI A;  5KJ7 C;  4KHX A;  3L73 G;  5APW A;  2K9J B;  3H4E A;  2FQ2 A;  3O6Q B;  1GW3 A;  2W6J H;  2EHT A;  4U0E A;  3LID A;  1N2D C;  1M7L A;  1SQP K;  2XT1 A;  3TDK A;  3AE2 C;  1BGY E;  2KG6 A;  3A0B E;  1PL5 A;  3V2N A;  4DZO A;  2E5T A;  1VQ8 P;  1GK4 A;  2HOD A;  1PGO A;  4H2Y C;  4BRY A;  2E74 C;  5AVS B;  2R44 A;  2HLO A;  4RJT A;  2O3J A;  1BGY D;  3KXD A;  2C9L Y;  2QEX P;  3IR9 A;  1NTK J;  3KZI H;  3U59 A;  3V2R A;  2ZVN B;  3GF7 A;  3DPH A;  1L0I A;  2IBZ G;  2GZF A;  3E2D A;  2ROQ A;  2Q3I A;  2K3R A;  3CX5 E;  2OTL P;  1IMQ A;  2P9X A;  1VKU A;  3WUU A;  3WMM 0;  3HUS A;  2L0Q A;  5B66 H;  2C9N Y;  3L72 E;  4IL6 X;  1H8A A;  2OYI A;  2KZJ A;  4EIJ A;  1LTG C;  3CX5 D;  1KQF B;  3QWO C;  3EJD A;  1QL2 A;  4LLH A;  1NTZ G;  3GHG B;  2O01 H;  4M0I A;  5KJ7 D;  5CZD B;  4RES B;  4Y99 C;  2K5X A;  4OGQ C;  5TJH A;  2AEM A;  2O01 J;  4DJG A;  3L72 D;  1YTZ I;  1JUN A;  2PEM A;  2N9B A;  4IPY A;  1VQ5 P;  1VF5 D;  3H1K G;  3AEF C;  4N6J A;  2YXQ B;  1J1E B;  5KLV J;  1LT9 A;  1SVF A;  1SQQ K;  1VL2 A;  2K1A A;  3H1H E;  4H2W C;  1BDD A;  2G8Y A;  1UII A;  1DX7 A;  3RK2 C;  2KSJ A;  1OXZ A;  1Y8A A;  1SQV J;  3A0H E;  4JYB A;  2FYN C;  5H2F E;  5CCH C;  1YTZ T;  3D70 A;  3H1H D;  2FVF A;  1MFZ A;  3Q3D A;  2MF4 A;  1DEB A;  2KP8 A;  5KAF E;  5AW9 B;  1GXH A;  3PP5 A;  1IC2 A;  2Y9Y A;  2KYV A;  1RE4 C;  2QG4 A;  2OGU A;  3OJA B;  1M90 Q;  2L22 A;  1URQ C;  1FZF A;  1RH5 B;  2ZJS E;  1GL2 C;  5HGN A;  5BVZ A;  1N7L A;  2JDI H;  3RL0 g;  1GD2 E;  4ZKU A;  2PY8 A;  2NPS C;  2LOL A;  4XE5 B;  4OGQ D;  1LTJ A;  2FFD C;  4HH2 A;  2M8L A;  2QJY C;  1X22 A;  3L73 E;  1HQB A;  1DV5 A;  1FJP A;  3HTK B;  1VQN P;  3TGU J;  1S3J A;  3L75 G;  3V6I A;  1JCC A;  3JCU E;  4F37 A;  2YKQ A;  3L73 D;  1KB9 E;  3V4W A;  3L71 G;  1KN7 A;  3ZDM A;  3H1L J;  3PTZ A;  4I2L C;  3SWK A;  4B86 A;  3RK2 D;  1KIL B;  1K8A Q;  4D6T E;  1H0T B;  4COP A;  2FY8 A;  1E6J P;  1KB9 D;  1NKN A;  1DD3 A;  2YIU B;  2PGD A;  2E75 B;  5APV A;  2NO8 A;  1JNM A;  1EDJ A;  2IBZ E;  4D6T D;  4GOD A;  3L36 A;  4NPF X;  1S9K E;  1SQP G;  4OVN F;  3A7O A;  4EOT A;  3B71 A;  3MD0 A;  1P84 D;  4H44 C;  2IBZ D;  2Y9Z A;  4MRT C;  2Z45 A;  3H47 A;  1NTZ E;  1S9K D;  1QX8 A;  3A5T A;  3II6 A;  1MZ8 A;  2LIW A;  1GW4 A;  2GZG A;  1PPJ G;  5TIS H;  1HVV A;  1NTZ D;  2NZ2 A;  3NMD A;  1S5L E;  3CWB G;  2IYO A;  2I8D A;  4WBA A;  2ZYA A;  3EWK A;  4BRY B;  1MKM A;  4W7Y A;  4XRQ A;  3VOP A;  3D71 A;  3AE5 C;  3CE7 A;  5CBN A;  1RF0 A;  2BCC G;  4L76 A;  4PD4 E;  1L0L E;  4GKG A;  4U3F G;  4DT0 A;  1IUQ A;  1JY3 P;  3D6Y A;  3A3Y B;  3MTU E;  1DIP A;  1AYI A;  2GDW A;  4DCK A;  5KAI H;  1NH4 A;  4PD4 D;  3G0V A;  1L0L D;  3HUS B;  3R4Y A;  4H44 D;  1RE3 C;  3CI9 A;  2OYI B;  3AEC C;  1OVV A;  1ACP A;  3OAK A;  1SQQ G;  5HGO A;  3K5B A;  1NJI Q;  2XND H;  2E76 B;  2PNG A;  5AVT B;  1T2K C;  3GKL C;  2IPP A;  4TT3 H;  3V5B A;  1PZQ A;  4I1L A;  2VLN A;  3MGN A;  1BSH A;  1LT9 B;  2JKV A;  2KW2 A;  5DCK A;  3HD7 C;  3DS1 A;  1HJB A;  1FR2 A;  2P67 A;  4XFY A;  3I56 P;  2B89 A;  5KP7 B;  2V7Q H;  2VLP A;  1VQK P;  1JY2 P;  4WY4 D;  2GZJ A;  2FXM A;  5AW2 B;  5GTI E;  1YIJ P;  5AVV B;  4TLF A;  3CC4 P;  3MGE A;  3CD6 P;  1FJK A;  1KIL C;  1FOS F;  3G1I A;  5APX A;  1L0H A;  2FYU G;  3AEA C;  1EC5 A;  4BXL A;  1PP9 J;  3SFD C;  2YIU C;  3L74 E;  3AE6 C;  1SFC A;  1KFM A;  3TF5 A;  3ITK A;  5AVU B;  3B5N A;  3G9R A;  2CQ8 A;  2KK7 A;  3BRV B;  1NTM E;  2AXT H;  2N5I A;  1LTJ B;  1G1I A;  2O1J A;  5E79 H;  1FC2 C;  3L74 D;  3L71 J;  1T2K D;  1EXI A;  1FZB A;  3U1A A;  1FAV A;  1BXI A;  2N6Y A;  1NTM D;  3DS4 A;  2AF8 A;  5EFW B;  2QVA A;  4PJ0 E;  1S4X A;  2ZAE B;  3HD7 D;  1ZXG A;  3AEE C;  2KOR A;  2MJZ A;  3CWB E;  1NQ4 A;  1R5L A;  1EOQ A;  1MV8 A;  1KIL E;  3E7K A;  3RGU A;  1LTT C;  1SQP J;  2KS1 A;  2ZXE B;  2MKV A;  3FX0 A;  1NTZ K;  3NTN A;  4IFF A;  3CWB D;  3B8E B;  1BAJ A;  4U0B A;  1KIL D;  2EIA A;  1NAY A;  2DGY A;  2M8N A;  5HV8 A;  4H0L B;  2YMK A;  1HF9 A;  1KQL A;  2KNC A;  1SLQ A;  2JB0 A;  1Q2N A;  4U3F D;  1MFT A;  3M06 A;  1LWU A;  2XXM A;  4C46 A;  1KYO H;  3L72 G;  2W8Z A;  2KG9 A;  2OYH B;  1L0L K;  3FXE A;  5APS A;  2ZT9 C;  3H1J J;  1J1D B;  1LTB C;  3F5H A;  4KJM A;  2LL8 A;  2Q3E A;  3PRJ A;  1OVU A;  5AVR B;  4L73 A;  1T3U A;  1FOS E;  4DG9 A;  1FDO A;  1CEI A;  3SFE C;  2OTK E;  2WT7 A;  2CGQ A;  3CCJ P;  4L74 A;  3OW2 O;  1BCC E;  1NYH A;  3H1H G;  4W80 A;  1N7S C;  2CG5 B;  2XV6 A;  2JO1 A;  2KG8 A;  4U7J A;  5AW8 B;  1EXJ A;  4JF7 A;  2HPC A;  1HBW A;  1KQG B;  3RBX A;  2K0D X;  2W83 C;  4H13 D;  2FYU E;  3CXH H;  1VQ4 P;  2R32 A;  2N1T D;  2FAD A;  3RL0 D;  1N73 A;  7CEI A;  1PGP A;  2WSC H;  4R4L A;  1SQX E;  1X3O A;  3LW5 H;  2FYU D;  3KDP B;  2FQ1 A;  1JEK A;  2KOD A;  2ZT9 D;  2WSC J;  1Q81 Q;  1M57 D;  3H1I J;  3LW5 J;  2LXC B;  1R5S A;  4UHP B;  2WIT A;  1LTJ C;  1SQX D;  1U57 A;  2M8R A;  4UB6 E;  3CCL P;  1PEQ A;  5AW6 B;  1E0H A;  1DNY A;  1NTK E;  3BCC G;  4EI2 A;  2JQ4 A;  3VMX A;  4UB8 E;  1RQU A;  3L70 J;  1NTM K;  2FXP A;  1N7S D;  2FXO A;  1XTC C;  1NU1 G;  1G2C A;  4LC1 A;  4ASW A;  2XZ1 C;  4IL6 E;  1NTK D;  2FBW C;  2PEI A;  4D6T G;  5BS2 A;  3G6E P;  2P7J A;  2XKM A;  2W90 A;  3G29 A;  2CPB A;  2YKP A;  1SFC B;  3M91 A;  2E5Y A;  2H88 C;  3B5N B;  2Z44 A;  1VQM P;  4H0L C;  3A0B H;  2KWL A;  3D6Z A;  5HGM A;  3M9H A;  2KGE A;  5BU5 A;  2K93 A;  3TK1 A;  3KQG A;  1BGY J;  1KYO I;  1CSB A;  1R8E A;  3T97 A;  3MUD A;  2BEQ D;  4AYC A;  4AQR D;  1OW6 A;  3SWF A;  5B5E E;  1GZL A;  2M3E A;  2K0Y A;  2OYH C;  3BAS A;  2QSI A;  1OW7 A;  2RH0 A;  1K73 Q;  1J1D C;  4JYC A;  1GTW A;  1AJY A;  3CX5 H;  3CMA P;  2CPS A;  4WYM A;  1A43 A;  3NXS A;  2RN0 A;  5BU8 B;  1L0N G;  2KS1 B;  1IFM A;  2K9Y A;  2KXP B;  3B5I A;  2E74 D;  1RF1 A;  1EZV E;  1UNK A;  1GU5 A;  3UIA A;  3VP8 A;  1M1J A;  3H6P A;  4Z1M H;  1G1J A;  1L0L G;  1KC8 Q;  1PV3 A;  4QNB A;  1OR5 A;  3E1R A;  3DTJ A;  2KNC B;  1EZV D;  2K88 A;  3CXH I;  2JWA A;  3HE5 A;  2DW3 A;  1LWU B;  1GDT A;  2A06 G;  3C1L A;  4I7Z B;  3NY7 B;  3GJN A;  3G26 A;  3WU2 E;  3TGU E;  2GYK A;  2XZR A;  2QA4 P;  3H1H J;  2B9B A;  1K30 A;  1GPJ A;  1K05 A;  1OFC X;  4YTP C;  5M1B A;  4C7R A;  3A0H H;  5H2F H;  3TGU D;  2QJP C;  4C7N A;  2V4H A;  2H43 A;  2FYU K;  2GDX A;  5KP6 B;  2JBG A;  4XFJ A;  2WT7 B;  1RY3 A;  4XRO A;  4PV1 B;  1BE3 G;  2K94 A;  5KAF H;  5KP8 B;  3BCC E;  1Z6M A;  2MR8 A;  2WPS A;  2WSF H;  1L4A A;  1SQX K;  3IN6 A;  5I4T G;  2WSF J;  3G21 A;  1NU1 E;  1ZV8 A;  5CHX A;  3BCC D;  2H7H A;  2HPC B;  4O9B A;  4WB4 A;  5CCH D;  3U1C A;  4KT0 J;  2ZVO B;  5F2N A;  4N78 E;  3TNU A;  1NU1 D;  3BAT A;  4OH8 B;  4PH0 A;  3VP9 A;  2RKL A;  1NTK K;  3AE1 C;  1CZQ A;  1IFJ A;  1N73 B;  3L73 J;  1HUC A;  3L74 G;  4N78 D;  1URQ D;  4WWI A;  3P8M C;  1QGK B;  3JCU H;  1KB9 H;  1GL2 D;  1NTM G;  1QEX A;  3B5N C;  2NPS D;  2GUV A;  2CNR A;  2N50 A;  2L91 A;  3KYQ A;  3B4S A;  2LIU A;  2ERH A;  2KOO A;  3BVH A;  4D6T J;  3VMZ A;  3I55 P;  2LXB A;  3S9O A;  1P84 H;  1ZR2 A;  1NWQ A;  1MUU A;  3GHG C;  2BEZ F;  2LF4 A;  4EDF A;  2L4B A;  3U43 A;  1ZN5 A;  3CX5 I;  2HOD B;  3A2A A;  2BAS A;  1G2C B;  2YNY A;  1L0N E;  3L4F A;  2POH A;  3GW6 A;  1OIP A;  1AFO A;  2R5B A;  1IK7 A;  2M5R A;  1AVY A;  1J1E C;  2QIW A;  2ZYG A;  5C39 A;  1L0N D;  3P8C E;  2VRS A;  4IZ6 A;  1UJZ A;  1IFN A;  1SQV K;  1NTZ J;  1ZR4 A;  1S5L H;  2KB7 P;  3P8C D;  5GTH E;  2A06 E;  3CLQ A;  3B5N D;  4ZKP A;  3T97 B;  1VQ9 P;  3SSU A;  3H1K J;  3HE4 A;  5CMZ A;  2E42 A;  1NVO A;  3CCM P;  1JCD A;  1AQ5 A;  2M5A A;  1VPC A;  1RE4 A;  2A06 D;  3M0D A;  2WSS H;  3G71 P;  3Q5S A;  4PD4 H;  1Q90 D;  1AA0 A;  1L0L J;  1BE3 E;  2JJL A;  1X8Y A;  3V2P A;  4WVZ A;  2FFD A;  2QNW A;  1RF1 B;  3GMA A;  2JU2 A;  1BCC G;  4PV1 C;  3TYY A;  1M1J B;  1BE3 D;  2DNW A;  2JP3 A;  1IMP A;  2V7Q J;  5AW3 B;  2OTJ P;  1E5W A;  4RKU J;  5CCG C;  3HZQ A;  2B88 A;  2SPZ A;  4XFX A;  3PJS K;  3HE5 B;  5AVY B;  3GLM A;  4PH1 A;  2WTY A;  3EJB A;  2L9F A;  2YXR B;  2KLU A;  1M6E X;  1SS1 A;  2RMZ A;  2BQ1 E;  2NRG A;  2E75 C;  1A02 F;  2XZ0 D;  1NU1 K;  2K37 A;  3L75 J;  2K2Q A;  3G1G A;  1KB9 I;  1N73 C;  1SQX G;  1YI2 P;  3RBZ A;  1RO0 A;  1EQ7 A;  3R2P A;  2Q5U A;  3P05 A;  4BPF A;  4C7N B;  1HGZ A;  1HTL C;  1W2B O;  1VHN A;  1TU3 F;  1IJD B;  3HYB A;  5GTI H;  1NAF A;  2IX7 C;  4ZNC A;  1P84 I;  1L4A B; 
#chains in the Genus database with same CATH homology
 4U0E A;  1K73 Q;  1PEO A;  1VQ9 P;  3CME P;  5F2N A;  2XT1 A;  2EIA A;  1YJW P;  3CCQ P;  2DGY A;  2M8N A;  3CMA P;  4COC A;  5DCK A;  3CCV P;  4WYM A;  1A43 A;  3G28 A;  2EFJ A;  3CCM P;  2KOD A;  1KQS O;  1YIT P;  3DS1 A;  3Q20 A;  1Q81 Q;  2Z45 A;  3H47 A;  4PH0 A;  5BS1 A;  1S72 P;  1VQ8 P;  4XFY A;  3I56 P;  4GR6 A;  3G71 P;  3DS0 A;  2PEJ A;  3B5I A;  1VQO P;  1YJ9 P;  1VQK P;  1YJN P;  1QRJ A;  1M90 Q;  3WBH A;  3CCL P;  3NTE A;  1PEQ A;  1VQP P;  4GR2 A;  1PEU A;  1M1K Q;  2XXM A;  2QEX P;  1YIJ P;  2JYG A;  1KC8 Q;  3CC4 P;  2PEQ A;  3MGE A;  2JO0 A;  4QNB A;  5HGN A;  3DS3 A;  2E1M A;  3CD6 P;  3DTJ A;  3DPH A;  1ZMB A;  3CCS P;  3G1I A;  3E2D A;  2PY8 A;  1A8O A;  2EG5 A;  2PEN A;  2L6E A;  4XRQ A;  5HGL A;  4U0C A;  2OTL P;  2JYL A;  2M8P A;  2M8L A;  2P9X A;  3I55 P;  3CCR P;  2OAR A;  2PEI A;  5F2K A;  5JPA A;  2PEK A;  1PEM A;  1RO2 A;  3G26 A;  5BS2 A;  1YHQ P;  2BUO A;  1D1D A;  1VQN P;  3G6E P;  1VQ6 P;  2BHV A;  2LF4 A;  1QVG O;  3G29 A;  2QA4 P;  2OTJ P;  3CCU P;  3HZQ A;  3CCJ P;  1IUQ A;  3OW2 O;  4U0D A;  2CWO A;  4XFX A;  1K30 A;  4M0I A;  1EIA A;  4U0F A;  4PH1 A;  1Q86 Q;  4U0A A;  1Q7Y Q;  2Z44 A;  3G0V A;  1M6N A;  1M74 A;  3DS2 A;  1VQM P;  2XV6 A;  1Q82 Q;  1K8A Q;  1VQL P;  1M6E X;  1VQ7 P;  1RNI A;  4COP A;  2BQ1 E;  3DS4 A;  4XRO A;  5HGM A;  3G1G A;  3CCE P;  2ONT A;  2PEM A;  5HGO A;  1E6J P;  4IPY A;  1VQ5 P;  1N8R Q;  1K9M Q;  3G4S P;  1JJ2 O;  1YI2 P;  3RG6 C;  1RO0 A;  1NJI Q;  3CPW O;  3VRL C;  1EOQ A;  3DS5 A;  3P05 A;  5I4T G;  2PEO A;  1W2B O;  3G21 A;  3M1M A;  3H0D A;  1AUM A;  1VQ4 P;  5F2O A;  3HYB A;  3CC7 P;  4XFZ A;  3LRY A;  2Z46 A;  3CXC O;  3H4E A;  1QVF O;  1KD1 Q;  1BAJ A;  3CC2 P;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...