3CCMP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccmP02
1KQSO 3CCUP 1YJNP 2QEXP 1W2BO 1VQ7P 3CMEP 1QVFO 1QVGO 1K9MQ 1M1KQ 3CPWO 3CCJP 1Q7YQ 1Q82Q 1K73Q 1VQ4P 1YJ9P 1M90Q 2OTLP 3CC2P 3CMAP 3I55P 3CCSP 1YI2P 3CCLP 1K8AQ 1VQ9P 3G4SP 1VQOP 2OTJP 3CD6P 3CCRP 3I56P 1KD1Q 1VQLP 3CXCO 1YITP 1YHQP 1VQPP 1Q86Q 1VQMP 1JJ2O 1VQ8P 3CCQP 3G6EP 3OW2O 1S72P 1Q81Q 3CCVP 3CC7P 1KC8Q 1VQNP 1VQ5P 3CCMP 1NJIQ 3CCEP 1YIJP 1N8RQ 3CC4P 1VQ6P 1YJWP 1VQKP 3G71P 2QA4P
chains in the Genus database with same CATH superfamily
2N1TA 2YXQB 5KLVJ 4KJMA 2KLUA 1R5SA 3H1IE 5CCHC 3VP8A 1RF0A 2KYVA 1BXIA 2ONTA 4LC1A 2GZGA 3G21A 1Q81Q 3E1RA 1NTZD 5AW9B 3CWBG 2LKIA 3G0VA 1JTHA 2QSIA 2XZ0D 1J1DB 1LTIC 3L73E 4WY4C 4U0DA 2LTEA 3JCUE 1BGYD 3TGUD 3AEAC 2ZT9D 1JO5A 1LTBC 2IYPA 3M0AA 4IOIH 3M1MA 3FWNA 1X0TA 3HZQA 1L0NK 1LT9B 4D6TG 3CCVP 3BASA 1ZW0A 3CMEP 4N3YB 4PH1A 1Z6MA 2IPPA 2XZRA 2WPQA 1Q90D 1GPJA 2IFMA 1JCDA 3A0HH 1BSHA 3ZDMA 2XDJA 2IBZE 1W5CE 1N73A 5KLIC 4HKZH 3AEDC 4CPGA 1NKNA 5HGOA 1RQUA 2OTLP 2YMKA 3Q5RA 3HRNA 3O6QA 2A06E 5KKZC 1NU1J 1SQVJ 1X8YA 2Q6QA 2K37A 2V7QH 2K0DX 3UIAA 1EDKA 2Q9IA 5HV8A 1QX8A 3SFDC 3C8VA 3FX0A 2P2UA 1HGVA 4U0EA 2FYNB 4PD4H 3ABVC 3GHGC 1PGPA 1GL2D 2M3BA 1IFIA 2E42A 4UB8E 2RMZA 3WU2E 2OYHC 2DGYA 2GDYA 3EJEA 2FQ1A 2FQ0A 2PNGA 3RK2C 1JUNA 1S2EA 1VQNP 2IBZG 1N8RQ 1YBKA 3EWKA 3P8CD 4U3FJ 2E5YA 1FDIA 1ZR4A 3HUSA 2K9JB 4PJ0E 3L70D 3CXHE 2A06G 2Z4EA 3BCCD 3I56P 2I1JA 2QE7H 2WSCJ 2WPRA 1KTMA 1EOQA 2O01J 3IR9A 2W90A 4NPFX 2AF8A 3V2NA 2D2CB 1FZCA 4HKGA 1GMJA 2Z45A 3LIDA 3CCSP 4BPFA 2XNDH 2MVVA 3B5NC 4C46A 1LWUA 3WMM0 4DG9A 1SQQE 1XTGB 2M8NA 2GM4A 3NMDA 4BXLA 1T8ZA 1FC2C 1KB9H 5AVZB 2JBGA 3MUDC 2HPCA 1HGZA 2QJKC 2KG6A 1ACPA 1EC5A 2XV5A 2PEIA 1FZEA 4C7RA 4DCKA 3B71A 1L0HA 2NPSA 4H44D 3L74J 3AECC 5AVQB 2EFJA 2KOGA 3L72E 5AW5B 1LP1A 1VQLP 1SQQG 2M5AB 4ZKUA 1URQD 1VF5B 2QA4P 3H32A 5AW1B 1VQ4P 4PH0A 1PIXA 2LKMA 3GF3A 1N2DC 1GD2E 1HWTC 2FYUD 1T3JA 1RO0A 3L71D 1VL2A 3VP9A 2ZJSE 3BATA 5KLVD 1DH3A 5CCHA 1KORA 3CCMP 2JKVA 4GOEA 3A5TA 1BAJA 2JO0A 3WUTA 3H25A 2H88C 2CGQA 5HGLA 3CCLP 1IFNA 3L72G 2AEMA 3G28A 2C0XA 3VN0A 4Z1MH 2Z5IA 3HE5A 2K2QA 1N7SC 1R5LA 5CCGC 1IFPA 3OA7A 1KILA 3MTUE 4PXHB 1NKZB 1RF1A 2YMYA 1QL1A 5JPAA 3NTEA 1CZQA 3FXDA 2P67A 3G4SP 2QRXA 5AVSB 2GZFA 2N1TC 2Z5HA 2Q5UA 2C9NY 2O1JA 5CJ0A 2E74B 4XFYA 1S9KD 1YJ9P 1RF0C 1RQVA 2WSEJ 1NYHA 2CWOA 1MFZA 4DZOA 1X9VA 3D6ZA 2WT7A 2EIAA 3I55P 3NTNA 3OAKA 1NTZJ 3HD7B 2JJLA 1SQPE 2KG8A 1X22A 3S4RA 2O1KA 1UNKA 3GKLC 2AXTH 4PWVB 1SFCA 4K35A 4WWIA 2ZAEB 1BGYJ 1EMVA 2MY5A 1SQBJ 3OW2O 2LR2A 1M74A 2CK3H 4I6MC 1BCCD 1LT1A 5APUA 3B4QA 1QL2A 3K5BA 1EZVE 3GZLA 1GU5A 4OGQB 3G1IA 1VKUA 3H1JE 2GDWA 3CWBJ 2QJYC 3RL0g 2KW2A 1NTKK 2KUBA 3A0HE 4H13B 3W67A 2YKPA 1Y9BA 4LGDE 4ASVA 1SQPG 4QNBA 3EFGA 3EJBA 2WMMA 2OTJP 1N73C 4D6TJ 1KQFB 3Q5PA 4U3FD 1MZ9A 3R4YA 4RJTA 1JJ2O 1E5WA 1PGQA 2E76C 3O8ZA 2KNCA 1M8OB 2WSFH 4B86A 1RO2A 2WPTA 1OW7A 4Y28J 3RL0B 3BRVB 1NQ4A 2V4HA 1GK6A 4Y99B 1EZVG 4AUWA 3H1JG 3BRTB 2KODA 1ZNVA 3GLMA 1NTKE 4PD4E 2WVRA 3V4QA 3TNUB 2O01N 3RK3C 3CCUP 2AEJA 2D2CD 2W8ZA 2OARA 2JO1A 3AE9C 2R32A 1VQ9P 1PEUA 2KOPA 5H2FH 1SQXK 2HODB 5M1BA 3CX5D 1U7MA 3CC4P 3MD0A 2ZXXA 5CHXA 4XROA 1QVFO 3HE4B 5KJ7D 4DOJA 4WY4B 3CE7A 3L35A 3RK3E 1YHQP 3L74D 1NTKG 2UWJE 3H1LG 1BSNA 1PV3A 1HY8A 1FZCC 3LRYA 4I7ZC 2K93A 3DS0A 3MIWA 4UHPB 4BRYB 1LWUC 3IF4A 5APXA 2ZT9C 5L8RJ 4GT1A 2PEJA 5B5EH 2KOSA 1G2CB 4GIFA 4CA3A 1KB9E 1MUUA 1EQ7A 2VRSA 2FY8A 1X3OA 2M8LA 2WT7B 5APQA 3L4FA 1DX7A 1SS1A 1FOSF 5BVZA 1VF5D 3AEGC 5KLIB 5APTA 2K9YA 3SSUA 3H4EA 1NH4A 3LW5J 2NO8A 1IFDA 5AVVB 1KYOD 2N9YB 5KKZB 4HJGH 5C39A 3IFMA 2NPSC 2YXRB 2W6AA 3TGUE 1FU1A 3F89A 3I5CA 2HR3A 4R4LA 1RHZB 1KYOI 3G3ZA 2CQ8A 5BU8B 1KQSO 3AE2C 5KP8B 2OYIA 2XXMA 3GHGB 3FWLA 1DD4A 2MR7A 1FE6A 1AQ5A 2NRGA 2LL8A 4R4MA 2OYHB 4M0IA 5KP6B 1GXHA 3WUUA 1BE3E 3RK2B 3RG2A 2NZ2A 2R5BA 1YYCA 2MVUA 2FYUJ 5KTBA 5DJTB 1L4AD 1M57D 2Q1KA 2QNWA 2I8DA 1SQQJ 2POHA 3L75E 2JDIH 1VQPP 1GZLA 2A45I 4IPYA 2E74D 4C7NB 2JAZA 1LTJA 2JR8A 4TLFA 4U0BA 1IO4A 1NTME 2B87B 2M3EA 1S3JA 2G3AA 3HD7D 4R0MA 2WSCH 1SQBD 1KILC 4IL6H 3USSA 2O01H 3M06A 4ZNCA 3B5NB 3TDKA 1GK4A 3M91A 1RF1C 2YO2A 3H6PA 2ZXEB 1BE3G 1RY3A 4H0LC 4OGQD 2KORA 2FVEA 1WRGA 1FJPA 3LIEA 3P8CE 4L73A 3CWBD 2K92A 1IJDB 1QRJA 3H1IG 2KGDA 2DNWA 1OWAA 1P84D 3L75G 3PLNA 3DS5A 1MV8A 3T97B 4BPHA 1N86A 2QJKB 3Q20A 1RNIA 3CX5H 1GDTA 3BCCE 2AXTE 3CD6P 1KILE 3IN6A 4H13D 4IL6X 5APVA 1P84I 1H88A 1SFCC 1NTMG 2FXPA 3L73G 4N78D 4D6TD 1BCCJ 2AVAA 3DS1A 2Q3IA 4OWFA 1L0NE 2DW3A 2RH0A 3KDPB 2OQQA 2HG5D 3VOPA 2P1JA 3GF7A 2KK7A 2ZVNB 3QH9A 3RL0D 4HB1A 3PH0A 4A7PA 3H1KE 1K8AQ 1PGOA 3KQGA 1FDMA 1JY3O 2GA1A 2Y9ZA 1RE3A 2BCCE 4COCA 3V6IA 3VMXA 5F2OA 4HYTB 4IFFA 1T8KA 1QVGO 1HVVA 1SVFA 1WMKA 3KHUA 1L0NG 4NEOA 1DD3A 5KLVK 3GZMA 1N7SB 2N98A 5TJHA 2M5RA 2SPZA 3CI9A 3AE1C 4RESB 2LIUA 1OR5A 2JU2A 2BASA 2MKVA 1QLED 1A8OA 2E75C 1H0TB 1SQPJ 4WY4D 3H1KG 3Q1MA 2IBZD 1L0LJ 1UJZA 2OTKE 3AE8C 1LTTC 2PEKA 2IZ0A 2BCCG 3NXSA 3EFFK 2H7HA 1PZQA 2FHSC 1JY3N 2N1TB 1MKMA 2A06D 1CI6A 1D1DA 4GR6A 2IBZI 3P32A 1EXJA 5H2FE 2Y0DA 1EXIA 3AEFC 5KLVE 3F5HA 3GG2A 5GTHH 2KS1A 4COPA 2FACA 2RN0A 1JTHB 2WSEH 1VQMP 2KOQA 1BDDA 5BS2A 3G9RA 2PENA 4PV1C 2FFDA 1IK9A 5B66H 1ZR2A 2YNYA 1HJ0A 3V2RA 4WBAA 3R2PA 3E2DA 5B5EE 3B8EB 1NU1K 1SQVK 2KGEA 2V7QJ 2QJYB 2JQ4A 4U0CA 3ITKA 3AE6C 3SWKA 1HQBA 2K94A 1M90Q 1LJ2A 5KLVG 3CXHI 5DCKA 1S9KE 1HH0A 4EIJA 2MJZA 1DEBA 3U59A 3H1LJ 1N73B 1GL2A 1ZV8A 3PP5A 1AQTA 1D7MA 1WT6A 1AV1A 5BU5A 2E76B 4JQ0D 3GJNA 2ROQA 1VQ5P 3RK2D 1TU3F 1HUCA 2LXBA 2KXPB 3O6QB 2CPSA 1M1JA 1K05A 2K1AA 2KZIA 3TF5A 1FAVA 1SQQD 3VRLC 1T2KD 4W80A 5HVCA 5AW2B 1NU1E 1SQVE 1VPCA 5EJDA 4GDOA 2HLOA 4JF7A 4H2YC 2JYLA 3S1KA 1FDOA 5KAIH 2OYIC 2QJPC 3A2AA 3G71P 5AW4B 2ZYAA 2R3SA 3RK3B 3KZIH 2N50A 2PEMA 3B5ND 5AVUB 2GUSA 2H89C 1PP9J 2IYOA 2P9XA 3HUSB 3H1HE 3L72D 3G26A 1ZRTD 2YO3A 3CC2P 1ZP0C 4ZKPA 5AW8B 3S9OA 2M0BA 1LTJC 1NU1G 1SQVG 2FXOA 5TISH 4LLHA 5AW7B 2LMLA 3P05A 2WPVB 1USDA 4OVNF 4N6JA 1FZCB 2FVAA 4IL6E 4I7ZB 3M9HA 3KXDA 3P7KA 1LWUB 1OXZA 2ZT9B 2PRRA 2N5IA 4EI2A 1FR2A 4JPZB 2FQ2A 4QMAA 1Z56A 5AVTB 5CBOA 2Q7CA 3H1HG 2JU1A 2ZYDA 4H2XC 1YJNP 3E1IA 1URQA 2ZYGA 2HPCB 2KR5A 1KZUB 2W6BA 4MRTC 3L37A 3CX5E 1UIXA 2KP8A 2B89A 3JC22 1EDLA 4H2WC 2NPSB 3EJDA 3PJSK 2PFXA 1BE3J 3HTKA 3SWYA 2P58A 3LW5H 1AA0A 1PEQA 3L74E 1KMIZ 1LP1B 3H1IJ 3WBHA 4GOFA 4U0FA 3L75J 1OW8A 1N7SD 3CXCO 5CCGD 2PEOA 2P7JA 3H32B 1SLQA 1SQPD 3L73J 1KN7A 1L0LD 3B4SA 1AUMA 3JSVC 1RE3C 4XA4A 1USEA 1AF8A 4K3AA 1S5LH 2FBWC 2FKWB 1FZGA 2GZIA 4L76A 4JYBA 1EZVD 2N1TD 1G1IA 1S4XA 2W83C 2K0XA 1W2EA 2JWAA 4GODA 3L74G 2GDXA 1L4AC 3HE5B 4YXWH 3VYIA 1UIIA 3AE7C 1EZVI 2CPBA 2KSEA 1E79H 3A7OA 1LNQA 1J1EC 1YTZT 2YKQA 1KILB 4YTPC 1NTZK 1PPJE 1Q86Q 3CLQA 1RF1B 3N4XA 1J2JB 3H47A 3MZWB 4H0LB 2QG4A 1SQBK 4AQRD 4IZ6A 1L0NJ 1SQXE 4IFMA 3FXEA 2Y0EA 3U1AA 2EHTA 1FZAA 3M9BA 5GTHE 1H89A 3PRJA 1PGJA 1LGHB 3H1KJ 1PL5A 1YQ3C 4PD4D 3H1LD 1SFCB 1RE4C 3SFEC 4IFDK 4TT3H 1NTZE 5KP7B 2QVAA 2BCCJ 1ZOYC 2L91A 4RKUJ 5K5GB 1GW3A 1PPJG 5B66E 3GW6A 1BGYE 4PD4I 3RBZA 2GZJA 2E76D 2FFDC 3CCEP 4L74A 2LOLA 4MN4C 4JYCA 2Q3EA 2VLNA 3DS4A 1SQXG 3M9QA 3NY7B 2WZ7A 1ZMEC 2K9JA 2XZ1C 1KD1Q 1FBMA 3VMYA 4ZMDA 2FVFA 1DV5A 5DJUB 2AFEA 2KOOA 4Y99C 5E79H 3RG6C 3RK3D 1M1KQ 1GL2C 2YKOA 3RBXA 2BEQD 1NTZG 1PP9D 2KI7B 2KNCB 1M1JC 5CZDB 3Q5SA 3AE4C 1KQGB 1BGYG 2YIUC 4UB6H 3TGUG 3G6EP 1NWQA 1VQ6P 5APSA 4XRQA 5AVYB 1HTLC 2H43A 3CL3D 5GTIH 3CCJP 1KB9D 4L75A 1FS0E 3II6A 5KAIE 7CEIA 2E75B 1OMIA 1YI2P 3H0DA 2C9LY 2G8YA 1KLPA 3DS3A 2PGDA 5KJ7A 3KZIE 1OIPA 2BQ1E 4WB4A 1KB9I 1NO4A 1NJIQ 1NAFA 2OGUA 2IX7C 4OH8B 2M8PA 2OYOA 3TSIA 1K73Q 1K30A 3IAOA 2R44A 3L72J 3L36A 2M8RA 3WUVA 2WQYC 1VHNA 4M3LA 4HH2A 2E5TA 3L70E 1LTSC 2M5AA 5TISE 3V2QA 3BVHA 4XE5B 1W2BO 1OVUA 2X2BA 4YPCA 4AYCA 4PV1B 3Q3DA 2VLPA 5F2NA 1BE3D 5KAFH 3C9IA 2NPSD 4EOTA 1OZHA 2PEQA 2PAJA 2XV6A 4H44C 3H1ID 1YIJP 1VQKP 2VLQA 2EG5A 3L75D 4W7YA 4JBZA 1JY2P 5APWA 5AVXB 1JM0A 2B88A 2PP6A 3CCRP 2N9BA 3N7NA 1NTMD 3L73D 1URQC 1IUQA 2FYZA 3L70G 3BCCG 2QIWA 2QM7A 2JEEA 2K3RA 2JWDA 5AVWB 1NVOA 1PFIA 1L2PA 2K0YA 1AYIA 2FYUK 3G1GA 2PY8A 2ZFCA 1KYOH 5CCHD 5AW0B 1Y8AA 2KWLA 1L4AA 1OW6A 3DTJA 2ITAA 2HYNA 3H1HJ 1QGKB 1E0HA 1U7JA 2XU6A 2O3JA 1SQQK 3TK1A 3HYBA 2OYIB 3U43A 3M0DA 2QJPB 2L9FA 1MZ8A 1T2KC 3AE3C 2R3CA 1JCCA 1M7LA 1GXGA 1OVRA 4XFJA 1KILD 4O9BA 3VTPC 3HD7A 1IFJA 2FXMA 2GUVA 2H8PD 3GMAA 2VLOA 5I4TG 3MGEA 1S5LE 1GU4A 1L0ND 1J1DC 2FYUE 4H0LD 3L71E 2A45H 3H1JJ 2AXCA 3A3YB 1X79B 4ASWA 3MHVA 1KFMA 1JMMA 1LTJB 1LT9C 1RE4A 4U0AA 3H1KD 2JB0A 4EDFA 5EW5E 1QEXA 1PEMA 2FAEA 2BCCD 3B5IA 1SFCD 2P10A 4NPDA 3NFQA 1T6AA 1IFMA 1LTAC 3D71A 3CC7P 3CXHD 4I2LC 1YJWP 5EFWB 2FYUG 3L71G 1JB0J 1NOHA 1KQLA 1H8AA 3OJAB 3VMZA 1AVYA 4XFXA 1ZRTE 1SP4A 2AFDA 2CG5B 1IMQA 1EIAA 1JMBA 4BPGA 1NTKJ 1P84H 2K88A 2MF4A 3A0BH 1CW5A 1RH5B 1NGMB 2XKMA 2KGAA 2FYNC 1HBWA 2LPKA 1Q7YQ 4WVZA 3TNUA 2Y0CA 1BCCE 3LMOA 1YQ4C 5CJ4A 3U1CA 1G1JA 1YITP 2R5DA 1U57A 1HJBA 2HODA 1A02J 2QEXP 2E75D 5E79E 3HE4A 1YTZI 4WY4A 1GW4A 1SQPK 2CNRA 1VQ8P 2KGCA 2KLVA 3AE5C 3JCUH 1L0LK 5APYA 4WYMA 2D2CC 1ZLLA 1M56D 4U3FE 4UB6E 4DT0A 1SQXJ 1L4AB 1GTWA 4EYYQ 4I1LA 2W6JH 3VMAA 2E1MA 2N6ZA 1BCCG 4BRYA 4F37A 2BEZF 4BWNA 1J1EB 1Q2NA 5GTIE 1A43A 2LIWA 5HGNA 1G2CA 2IZ1A 1DNYA 1CEIA 2GZEA 4GR2A 2XNXA 1VQ7P 1IZNB 1K9MQ 5KJ7C 4PV1D 2RKLA 5CBNA 2LF4A 1FJKA 1CI6B 1L0LE 3TGUJ 2IFNA 4XFZA 5F2KA 1KV4A 1LTGC 1DEEG 1E6JP 1OX3A 1Y47A 3FGAD 1NU1D 1SQVD 4QKOA 2KS1B 1JOCA 3MP7B 4U3FG 2JGPA 1JY3P 3KYQA 3EQ2A 5AW3B 1NAYA 3PTZA 3GHGA 4U7JA 3DPHA 5KAFE 1VF5C 4YXDC 2FFDB 2MR8A 4UB8H 2OYHA 2Y9YA 3KPEA 2L6EA 2Z44A 3WU2H 3AEBC 2I1KA 2KZJA 3CMAP 3H1HD 3C1LA 2J5UA 3D70A 2LXCB 2GYKA 1L0LG 2KB7P 2WTYA 2IDBA 5AVRB 2W27A 1PEOA 4PJ0H 3CXHH 1JNMA 2K5XA 3RGUA 1NTMJ 3E7KA 1FOSE 4C7NA 1VDFA 1JY2O 1GL2B 2WSSH 1VQOP 2B87A 1FZBA 2J58A 1M1JB 3H1LE 3QWOC 2N5HA 1HF9A 3Q2YA 1M6EX 2WITA 1MFTA 2YIUB 1KYOE 3H1JD 1F80D 3B5NA 1EDIA 1LT9A 1Q82Q 4KHXA 5AW6B 1EDJA 2KSJA 1AVOA 3PHLA 1IMPA 3M0DC 3D6YA 3L70J 3HUSC 3BCCJ 2VSQA 2E74C 2HFED 3MUDA 3SWFA 3T97A 2L4BA 1M6NA 1S5LX 3HD7C 4NPEA 1CSBA 1NHLA 2WPSA 3CX5I 4GKGA 3W68A 1JY2N 3TYYA 1FZFA 2AEFA 1AFOA 2KIKA 1PP9E 1KC8Q 3DS2A 3P8MC 1AJYA 1N7LA 1K04A 4OGQC 2J59M 1OFCX 1NTKD 2ZVOB 5CMZA 5BS1A 5HGMA 2BHVA 1L0IA 3V5BA 1BDCA 2B9BA 2WWWA 1KFNA 1S72P 1IC2A 2Z46A 1S1CX 4H44B 1SQBE 2BUOA 4H13C 2N6YA 3CPWO 2WSFJ 1XTCC 3G29A 2ERHA 2JP3A 3AEEC 4RO0A 2A45G 2L5GB 2FADA 3MGNA 1URQB 3CCQP 1IK7A 1PP9G 2KG9A 3CWBE 1N7SA 5CCGA 3RL0C 1A02F 1P84E 2E43A 4DJGA 2QM8A 1OVVA 1T3UA 3V4WA 1PPJD 3A0BE 2MD9A 1ZXGA 1ZN5A 2C0WA 1JEKA 4KT0J 2EHSA 1DIPA 1NTMK 3HTKB 1H0TA 2XT1A 4W7ZA 4N78E 4D6TE 3V2PA 2L0QA 2JYGA 1SQXD 2L22A 1ZMBA 1SQBG 3L71J 1R8EA
chains in the Genus database with same CATH topology
1M6NA 1KQSO 3CCUP 2M8PA 1PEQA 2CWOA 1Q7YQ 1K73Q 2OARA 2EFJA 1K30A 2PEMA 4U0EA 2EIAA 3WBHA 3I55P 2XXMA 4U0FA 3DS1A 1VQ9P 1PEUA 4COPA 2ONTA 1VQLP 3CXCO 2DGYA 1YITP 2PEOA 1VQMP 4M0IA 2P9XA 3G21A 3OW2O 3DPHA 1M74A 1Q81Q 1KC8Q 5I4TG 3DS2A 3MGEA 3CCEP 1VQNP 3G26A 1N8RQ 3CC4P 3G0VA 5BS2A 2QA4P 1W2BO 2L6EA 2Z44A 2QEXP 2PENA 4XROA 1QVFO 1AUMA 4U0DA 4PH0A 1VQ4P 3DS4A 3CC2P 3G1IA 3CMAP 5BS1A 5F2NA 1K8AQ 5HGMA 2BHVA 1KD1Q 3I56P 1RO0A 3M1MA 3P05A 2PEQA 1VQPP 1YHQP 4COCA 3HZQA 5F2OA 3E2DA 4U0AA 1VQ8P 1PEOA 1S72P 1EOQA 2XV6A 3LRYA 3CCVP 4IPYA 2Z46A 3CCMP 1YIJP 3DS0A 2BUOA 4U0CA 1BAJA 2JO0A 4U0BA 1VQKP 2EG5A 1PEMA 3CMEP 3RG6C 4WYMA 4PH1A 1QVGO 1M1KQ 3CPWO 1YJ9P 1M90Q 2Z45A 3B5IA 5HGLA 3CCSP 3G29A 2PEJA 2E1MA 3CCLP 4QNBA 3G28A 5DCKA 1VQOP 2OTJP 1A43A 3CCRP 2M8NA 1IUQA 1Q86Q 1JJ2O 5HGNA 2M8LA 1M6EX 3G6EP 3CCQP 3CC7P 1VQ5P 1VQ6P 1YJWP 3H47A 1RO2A 4GR2A 4XRQA 1YJNP 1VQ7P 1K9MQ 1Q82Q 1A8OA 3CCJP 5HGOA 5JPAA 3NTEA 3H4EA 2OTLP 3VRLC 1YI2P 3H0DA 4XFXA 3G1GA 2PY8A 3G4SP 1QRJA 2KODA 2LF4A 3DS3A 1EIAA 2PEKA 3DS5A 2BQ1E 2XT1A 2PEIA 4XFZA 5F2KA 3DTJA 2JYLA 3Q20A 1RNIA 2JYGA 1D1DA 3HYBA 1NJIQ 1E6JP 4XFYA 1ZMBA 4GR6A 3CD6P 3G71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS O;  3CCU P;  1YJN P;  2QEX P;  1W2B O;  1VQ7 P;  3CME P;  1QVF O;  1QVG O;  1K9M Q;  1M1K Q;  3CPW O;  3CCJ P;  1Q7Y Q;  1Q82 Q;  1K73 Q;  1VQ4 P;  1YJ9 P;  1M90 Q;  2OTL P;  3CC2 P;  3CMA P;  3I55 P;  3CCS P;  1YI2 P;  3CCL P;  1K8A Q;  1VQ9 P;  3G4S P;  1VQO P;  2OTJ P;  3CD6 P;  3CCR P;  3I56 P;  1KD1 Q;  1VQL P;  3CXC O;  1YIT P;  1YHQ P;  1VQP P;  1Q86 Q;  1VQM P;  1JJ2 O;  1VQ8 P;  3CCQ P;  3G6E P;  3OW2 O;  1S72 P;  1Q81 Q;  3CCV P;  3CC7 P;  1KC8 Q;  1VQN P;  1VQ5 P;  3CCM P;  1NJI Q;  3CCE P;  1YIJ P;  1N8R Q;  3CC4 P;  1VQ6 P;  1YJW P;  1VQK P;  3G71 P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 2N1T A;  2YXQ B;  5KLV J;  4KJM A;  2KLU A;  1R5S A;  3H1I E;  5CCH C;  3VP8 A;  1RF0 A;  2KYV A;  1BXI A;  2ONT A;  4LC1 A;  2GZG A;  3G21 A;  1Q81 Q;  3E1R A;  1NTZ D;  5AW9 B;  3CWB G;  2LKI A;  3G0V A;  1JTH A;  2QSI A;  2XZ0 D;  1J1D B;  1LTI C;  3L73 E;  4WY4 C;  4U0D A;  2LTE A;  3JCU E;  1BGY D;  3TGU D;  3AEA C;  2ZT9 D;  1JO5 A;  1LTB C;  2IYP A;  3M0A A;  4IOI H;  3M1M A;  3FWN A;  1X0T A;  3HZQ A;  1L0N K;  1LT9 B;  4D6T G;  3CCV P;  3BAS A;  1ZW0 A;  3CME P;  4N3Y B;  4PH1 A;  1Z6M A;  2IPP A;  2XZR A;  2WPQ A;  1Q90 D;  1GPJ A;  2IFM A;  1JCD A;  3A0H H;  1BSH A;  3ZDM A;  2XDJ A;  2IBZ E;  1W5C E;  1N73 A;  5KLI C;  4HKZ H;  3AED C;  4CPG A;  1NKN A;  5HGO A;  1RQU A;  2OTL P;  2YMK A;  3Q5R A;  3HRN A;  3O6Q A;  2A06 E;  5KKZ C;  1NU1 J;  1SQV J;  1X8Y A;  2Q6Q A;  2K37 A;  2V7Q H;  2K0D X;  3UIA A;  1EDK A;  2Q9I A;  5HV8 A;  1QX8 A;  3SFD C;  3C8V A;  3FX0 A;  2P2U A;  1HGV A;  4U0E A;  2FYN B;  4PD4 H;  3ABV C;  3GHG C;  1PGP A;  1GL2 D;  2M3B A;  1IFI A;  2E42 A;  4UB8 E;  2RMZ A;  3WU2 E;  2OYH C;  2DGY A;  2GDY A;  3EJE A;  2FQ1 A;  2FQ0 A;  2PNG A;  3RK2 C;  1JUN A;  1S2E A;  1VQN P;  2IBZ G;  1N8R Q;  1YBK A;  3EWK A;  3P8C D;  4U3F J;  2E5Y A;  1FDI A;  1ZR4 A;  3HUS A;  2K9J B;  4PJ0 E;  3L70 D;  3CXH E;  2A06 G;  2Z4E A;  3BCC D;  3I56 P;  2I1J A;  2QE7 H;  2WSC J;  2WPR A;  1KTM A;  1EOQ A;  2O01 J;  3IR9 A;  2W90 A;  4NPF X;  2AF8 A;  3V2N A;  2D2C B;  1FZC A;  4HKG A;  1GMJ A;  2Z45 A;  3LID A;  3CCS P;  4BPF A;  2XND H;  2MVV A;  3B5N C;  4C46 A;  1LWU A;  3WMM 0;  4DG9 A;  1SQQ E;  1XTG B;  2M8N A;  2GM4 A;  3NMD A;  4BXL A;  1T8Z A;  1FC2 C;  1KB9 H;  5AVZ B;  2JBG A;  3MUD C;  2HPC A;  1HGZ A;  2QJK C;  2KG6 A;  1ACP A;  1EC5 A;  2XV5 A;  2PEI A;  1FZE A;  4C7R A;  4DCK A;  3B71 A;  1L0H A;  2NPS A;  4H44 D;  3L74 J;  3AEC C;  5AVQ B;  2EFJ A;  2KOG A;  3L72 E;  5AW5 B;  1LP1 A;  1VQL P;  1SQQ G;  2M5A B;  4ZKU A;  1URQ D;  1VF5 B;  2QA4 P;  3H32 A;  5AW1 B;  1VQ4 P;  4PH0 A;  1PIX A;  2LKM A;  3GF3 A;  1N2D C;  1GD2 E;  1HWT C;  2FYU D;  1T3J A;  1RO0 A;  3L71 D;  1VL2 A;  3VP9 A;  2ZJS E;  3BAT A;  5KLV D;  1DH3 A;  5CCH A;  1KOR A;  3CCM P;  2JKV A;  4GOE A;  3A5T A;  1BAJ A;  2JO0 A;  3WUT A;  3H25 A;  2H88 C;  2CGQ A;  5HGL A;  3CCL P;  1IFN A;  3L72 G;  2AEM A;  3G28 A;  2C0X A;  3VN0 A;  4Z1M H;  2Z5I A;  3HE5 A;  2K2Q A;  1N7S C;  1R5L A;  5CCG C;  1IFP A;  3OA7 A;  1KIL A;  3MTU E;  4PXH B;  1NKZ B;  1RF1 A;  2YMY A;  1QL1 A;  5JPA A;  3NTE A;  1CZQ A;  3FXD A;  2P67 A;  3G4S P;  2QRX A;  5AVS B;  2GZF A;  2N1T C;  2Z5H A;  2Q5U A;  2C9N Y;  2O1J A;  5CJ0 A;  2E74 B;  4XFY A;  1S9K D;  1YJ9 P;  1RF0 C;  1RQV A;  2WSE J;  1NYH A;  2CWO A;  1MFZ A;  4DZO A;  1X9V A;  3D6Z A;  2WT7 A;  2EIA A;  3I55 P;  3NTN A;  3OAK A;  1NTZ J;  3HD7 B;  2JJL A;  1SQP E;  2KG8 A;  1X22 A;  3S4R A;  2O1K A;  1UNK A;  3GKL C;  2AXT H;  4PWV B;  1SFC A;  4K35 A;  4WWI A;  2ZAE B;  1BGY J;  1EMV A;  2MY5 A;  1SQB J;  3OW2 O;  2LR2 A;  1M74 A;  2CK3 H;  4I6M C;  1BCC D;  1LT1 A;  5APU A;  3B4Q A;  1QL2 A;  3K5B A;  1EZV E;  3GZL A;  1GU5 A;  4OGQ B;  3G1I A;  1VKU A;  3H1J E;  2GDW A;  3CWB J;  2QJY C;  3RL0 g;  2KW2 A;  1NTK K;  2KUB A;  3A0H E;  4H13 B;  3W67 A;  2YKP A;  1Y9B A;  4LGD E;  4ASV A;  1SQP G;  4QNB A;  3EFG A;  3EJB A;  2WMM A;  2OTJ P;  1N73 C;  4D6T J;  1KQF B;  3Q5P A;  4U3F D;  1MZ9 A;  3R4Y A;  4RJT A;  1JJ2 O;  1E5W A;  1PGQ A;  2E76 C;  3O8Z A;  2KNC A;  1M8O B;  2WSF H;  4B86 A;  1RO2 A;  2WPT A;  1OW7 A;  4Y28 J;  3RL0 B;  3BRV B;  1NQ4 A;  2V4H A;  1GK6 A;  4Y99 B;  1EZV G;  4AUW A;  3H1J G;  3BRT B;  2KOD A;  1ZNV A;  3GLM A;  1NTK E;  4PD4 E;  2WVR A;  3V4Q A;  3TNU B;  2O01 N;  3RK3 C;  3CCU P;  2AEJ A;  2D2C D;  2W8Z A;  2OAR A;  2JO1 A;  3AE9 C;  2R32 A;  1VQ9 P;  1PEU A;  2KOP A;  5H2F H;  1SQX K;  2HOD B;  5M1B A;  3CX5 D;  1U7M A;  3CC4 P;  3MD0 A;  2ZXX A;  5CHX A;  4XRO A;  1QVF O;  3HE4 B;  5KJ7 D;  4DOJ A;  4WY4 B;  3CE7 A;  3L35 A;  3RK3 E;  1YHQ P;  3L74 D;  1NTK G;  2UWJ E;  3H1L G;  1BSN A;  1PV3 A;  1HY8 A;  1FZC C;  3LRY A;  4I7Z C;  2K93 A;  3DS0 A;  3MIW A;  4UHP B;  4BRY B;  1LWU C;  3IF4 A;  5APX A;  2ZT9 C;  5L8R J;  4GT1 A;  2PEJ A;  5B5E H;  2KOS A;  1G2C B;  4GIF A;  4CA3 A;  1KB9 E;  1MUU A;  1EQ7 A;  2VRS A;  2FY8 A;  1X3O A;  2M8L A;  2WT7 B;  5APQ A;  3L4F A;  1DX7 A;  1SS1 A;  1FOS F;  5BVZ A;  1VF5 D;  3AEG C;  5KLI B;  5APT A;  2K9Y A;  3SSU A;  3H4E A;  1NH4 A;  3LW5 J;  2NO8 A;  1IFD A;  5AVV B;  1KYO D;  2N9Y B;  5KKZ B;  4HJG H;  5C39 A;  3IFM A;  2NPS C;  2YXR B;  2W6A A;  3TGU E;  1FU1 A;  3F89 A;  3I5C A;  2HR3 A;  4R4L A;  1RHZ B;  1KYO I;  3G3Z A;  2CQ8 A;  5BU8 B;  1KQS O;  3AE2 C;  5KP8 B;  2OYI A;  2XXM A;  3GHG B;  3FWL A;  1DD4 A;  2MR7 A;  1FE6 A;  1AQ5 A;  2NRG A;  2LL8 A;  4R4M A;  2OYH B;  4M0I A;  5KP6 B;  1GXH A;  3WUU A;  1BE3 E;  3RK2 B;  3RG2 A;  2NZ2 A;  2R5B A;  1YYC A;  2MVU A;  2FYU J;  5KTB A;  5DJT B;  1L4A D;  1M57 D;  2Q1K A;  2QNW A;  2I8D A;  1SQQ J;  2POH A;  3L75 E;  2JDI H;  1VQP P;  1GZL A;  2A45 I;  4IPY A;  2E74 D;  4C7N B;  2JAZ A;  1LTJ A;  2JR8 A;  4TLF A;  4U0B A;  1IO4 A;  1NTM E;  2B87 B;  2M3E A;  1S3J A;  2G3A A;  3HD7 D;  4R0M A;  2WSC H;  1SQB D;  1KIL C;  4IL6 H;  3USS A;  2O01 H;  3M06 A;  4ZNC A;  3B5N B;  3TDK A;  1GK4 A;  3M91 A;  1RF1 C;  2YO2 A;  3H6P A;  2ZXE B;  1BE3 G;  1RY3 A;  4H0L C;  4OGQ D;  2KOR A;  2FVE A;  1WRG A;  1FJP A;  3LIE A;  3P8C E;  4L73 A;  3CWB D;  2K92 A;  1IJD B;  1QRJ A;  3H1I G;  2KGD A;  2DNW A;  1OWA A;  1P84 D;  3L75 G;  3PLN A;  3DS5 A;  1MV8 A;  3T97 B;  4BPH A;  1N86 A;  2QJK B;  3Q20 A;  1RNI A;  3CX5 H;  1GDT A;  3BCC E;  2AXT E;  3CD6 P;  1KIL E;  3IN6 A;  4H13 D;  4IL6 X;  5APV A;  1P84 I;  1H88 A;  1SFC C;  1NTM G;  2FXP A;  3L73 G;  4N78 D;  4D6T D;  1BCC J;  2AVA A;  3DS1 A;  2Q3I A;  4OWF A;  1L0N E;  2DW3 A;  2RH0 A;  3KDP B;  2OQQ A;  2HG5 D;  3VOP A;  2P1J A;  3GF7 A;  2KK7 A;  2ZVN B;  3QH9 A;  3RL0 D;  4HB1 A;  3PH0 A;  4A7P A;  3H1K E;  1K8A Q;  1PGO A;  3KQG A;  1FDM A;  1JY3 O;  2GA1 A;  2Y9Z A;  1RE3 A;  2BCC E;  4COC A;  3V6I A;  3VMX A;  5F2O A;  4HYT B;  4IFF A;  1T8K A;  1QVG O;  1HVV A;  1SVF A;  1WMK A;  3KHU A;  1L0N G;  4NEO A;  1DD3 A;  5KLV K;  3GZM A;  1N7S B;  2N98 A;  5TJH A;  2M5R A;  2SPZ A;  3CI9 A;  3AE1 C;  4RES B;  2LIU A;  1OR5 A;  2JU2 A;  2BAS A;  2MKV A;  1QLE D;  1A8O A;  2E75 C;  1H0T B;  1SQP J;  4WY4 D;  3H1K G;  3Q1M A;  2IBZ D;  1L0L J;  1UJZ A;  2OTK E;  3AE8 C;  1LTT C;  2PEK A;  2IZ0 A;  2BCC G;  3NXS A;  3EFF K;  2H7H A;  1PZQ A;  2FHS C;  1JY3 N;  2N1T B;  1MKM A;  2A06 D;  1CI6 A;  1D1D A;  4GR6 A;  2IBZ I;  3P32 A;  1EXJ A;  5H2F E;  2Y0D A;  1EXI A;  3AEF C;  5KLV E;  3F5H A;  3GG2 A;  5GTH H;  2KS1 A;  4COP A;  2FAC A;  2RN0 A;  1JTH B;  2WSE H;  1VQM P;  2KOQ A;  1BDD A;  5BS2 A;  3G9R A;  2PEN A;  4PV1 C;  2FFD A;  1IK9 A;  5B66 H;  1ZR2 A;  2YNY A;  1HJ0 A;  3V2R A;  4WBA A;  3R2P A;  3E2D A;  5B5E E;  3B8E B;  1NU1 K;  1SQV K;  2KGE A;  2V7Q J;  2QJY B;  2JQ4 A;  4U0C A;  3ITK A;  3AE6 C;  3SWK A;  1HQB A;  2K94 A;  1M90 Q;  1LJ2 A;  5KLV G;  3CXH I;  5DCK A;  1S9K E;  1HH0 A;  4EIJ A;  2MJZ A;  1DEB A;  3U59 A;  3H1L J;  1N73 B;  1GL2 A;  1ZV8 A;  3PP5 A;  1AQT A;  1D7M A;  1WT6 A;  1AV1 A;  5BU5 A;  2E76 B;  4JQ0 D;  3GJN A;  2ROQ A;  1VQ5 P;  3RK2 D;  1TU3 F;  1HUC A;  2LXB A;  2KXP B;  3O6Q B;  2CPS A;  1M1J A;  1K05 A;  2K1A A;  2KZI A;  3TF5 A;  1FAV A;  1SQQ D;  3VRL C;  1T2K D;  4W80 A;  5HVC A;  5AW2 B;  1NU1 E;  1SQV E;  1VPC A;  5EJD A;  4GDO A;  2HLO A;  4JF7 A;  4H2Y C;  2JYL A;  3S1K A;  1FDO A;  5KAI H;  2OYI C;  2QJP C;  3A2A A;  3G71 P;  5AW4 B;  2ZYA A;  2R3S A;  3RK3 B;  3KZI H;  2N50 A;  2PEM A;  3B5N D;  5AVU B;  2GUS A;  2H89 C;  1PP9 J;  2IYO A;  2P9X A;  3HUS B;  3H1H E;  3L72 D;  3G26 A;  1ZRT D;  2YO3 A;  3CC2 P;  1ZP0 C;  4ZKP A;  5AW8 B;  3S9O A;  2M0B A;  1LTJ C;  1NU1 G;  1SQV G;  2FXO A;  5TIS H;  4LLH A;  5AW7 B;  2LML A;  3P05 A;  2WPV B;  1USD A;  4OVN F;  4N6J A;  1FZC B;  2FVA A;  4IL6 E;  4I7Z B;  3M9H A;  3KXD A;  3P7K A;  1LWU B;  1OXZ A;  2ZT9 B;  2PRR A;  2N5I A;  4EI2 A;  1FR2 A;  4JPZ B;  2FQ2 A;  4QMA A;  1Z56 A;  5AVT B;  5CBO A;  2Q7C A;  3H1H G;  2JU1 A;  2ZYD A;  4H2X C;  1YJN P;  3E1I A;  1URQ A;  2ZYG A;  2HPC B;  2KR5 A;  1KZU B;  2W6B A;  4MRT C;  3L37 A;  3CX5 E;  1UIX A;  2KP8 A;  2B89 A;  3JC2 2;  1EDL A;  4H2W C;  2NPS B;  3EJD A;  3PJS K;  2PFX A;  1BE3 J;  3HTK A;  3SWY A;  2P58 A;  3LW5 H;  1AA0 A;  1PEQ A;  3L74 E;  1KMI Z;  1LP1 B;  3H1I J;  3WBH A;  4GOF A;  4U0F A;  3L75 J;  1OW8 A;  1N7S D;  3CXC O;  5CCG D;  2PEO A;  2P7J A;  3H32 B;  1SLQ A;  1SQP D;  3L73 J;  1KN7 A;  1L0L D;  3B4S A;  1AUM A;  3JSV C;  1RE3 C;  4XA4 A;  1USE A;  1AF8 A;  4K3A A;  1S5L H;  2FBW C;  2FKW B;  1FZG A;  2GZI A;  4L76 A;  4JYB A;  1EZV D;  2N1T D;  1G1I A;  1S4X A;  2W83 C;  2K0X A;  1W2E A;  2JWA A;  4GOD A;  3L74 G;  2GDX A;  1L4A C;  3HE5 B;  4YXW H;  3VYI A;  1UII A;  3AE7 C;  1EZV I;  2CPB A;  2KSE A;  1E79 H;  3A7O A;  1LNQ A;  1J1E C;  1YTZ T;  2YKQ A;  1KIL B;  4YTP C;  1NTZ K;  1PPJ E;  1Q86 Q;  3CLQ A;  1RF1 B;  3N4X A;  1J2J B;  3H47 A;  3MZW B;  4H0L B;  2QG4 A;  1SQB K;  4AQR D;  4IZ6 A;  1L0N J;  1SQX E;  4IFM A;  3FXE A;  2Y0E A;  3U1A A;  2EHT A;  1FZA A;  3M9B A;  5GTH E;  1H89 A;  3PRJ A;  1PGJ A;  1LGH B;  3H1K J;  1PL5 A;  1YQ3 C;  4PD4 D;  3H1L D;  1SFC B;  1RE4 C;  3SFE C;  4IFD K;  4TT3 H;  1NTZ E;  5KP7 B;  2QVA A;  2BCC J;  1ZOY C;  2L91 A;  4RKU J;  5K5G B;  1GW3 A;  1PPJ G;  5B66 E;  3GW6 A;  1BGY E;  4PD4 I;  3RBZ A;  2GZJ A;  2E76 D;  2FFD C;  3CCE P;  4L74 A;  2LOL A;  4MN4 C;  4JYC A;  2Q3E A;  2VLN A;  3DS4 A;  1SQX G;  3M9Q A;  3NY7 B;  2WZ7 A;  1ZME C;  2K9J A;  2XZ1 C;  1KD1 Q;  1FBM A;  3VMY A;  4ZMD A;  2FVF A;  1DV5 A;  5DJU B;  2AFE A;  2KOO A;  4Y99 C;  5E79 H;  3RG6 C;  3RK3 D;  1M1K Q;  1GL2 C;  2YKO A;  3RBX A;  2BEQ D;  1NTZ G;  1PP9 D;  2KI7 B;  2KNC B;  1M1J C;  5CZD B;  3Q5S A;  3AE4 C;  1KQG B;  1BGY G;  2YIU C;  4UB6 H;  3TGU G;  3G6E P;  1NWQ A;  1VQ6 P;  5APS A;  4XRQ A;  5AVY B;  1HTL C;  2H43 A;  3CL3 D;  5GTI H;  3CCJ P;  1KB9 D;  4L75 A;  1FS0 E;  3II6 A;  5KAI E;  7CEI A;  2E75 B;  1OMI A;  1YI2 P;  3H0D A;  2C9L Y;  2G8Y A;  1KLP A;  3DS3 A;  2PGD A;  5KJ7 A;  3KZI E;  1OIP A;  2BQ1 E;  4WB4 A;  1KB9 I;  1NO4 A;  1NJI Q;  1NAF A;  2OGU A;  2IX7 C;  4OH8 B;  2M8P A;  2OYO A;  3TSI A;  1K73 Q;  1K30 A;  3IAO A;  2R44 A;  3L72 J;  3L36 A;  2M8R A;  3WUV A;  2WQY C;  1VHN A;  4M3L A;  4HH2 A;  2E5T A;  3L70 E;  1LTS C;  2M5A A;  5TIS E;  3V2Q A;  3BVH A;  4XE5 B;  1W2B O;  1OVU A;  2X2B A;  4YPC A;  4AYC A;  4PV1 B;  3Q3D A;  2VLP A;  5F2N A;  1BE3 D;  5KAF H;  3C9I A;  2NPS D;  4EOT A;  1OZH A;  2PEQ A;  2PAJ A;  2XV6 A;  4H44 C;  3H1I D;  1YIJ P;  1VQK P;  2VLQ A;  2EG5 A;  3L75 D;  4W7Y A;  4JBZ A;  1JY2 P;  5APW A;  5AVX B;  1JM0 A;  2B88 A;  2PP6 A;  3CCR P;  2N9B A;  3N7N A;  1NTM D;  3L73 D;  1URQ C;  1IUQ A;  2FYZ A;  3L70 G;  3BCC G;  2QIW A;  2QM7 A;  2JEE A;  2K3R A;  2JWD A;  5AVW B;  1NVO A;  1PFI A;  1L2P A;  2K0Y A;  1AYI A;  2FYU K;  3G1G A;  2PY8 A;  2ZFC A;  1KYO H;  5CCH D;  5AW0 B;  1Y8A A;  2KWL A;  1L4A A;  1OW6 A;  3DTJ A;  2ITA A;  2HYN A;  3H1H J;  1QGK B;  1E0H A;  1U7J A;  2XU6 A;  2O3J A;  1SQQ K;  3TK1 A;  3HYB A;  2OYI B;  3U43 A;  3M0D A;  2QJP B;  2L9F A;  1MZ8 A;  1T2K C;  3AE3 C;  2R3C A;  1JCC A;  1M7L A;  1GXG A;  1OVR A;  4XFJ A;  1KIL D;  4O9B A;  3VTP C;  3HD7 A;  1IFJ A;  2FXM A;  2GUV A;  2H8P D;  3GMA A;  2VLO A;  5I4T G;  3MGE A;  1S5L E;  1GU4 A;  1L0N D;  1J1D C;  2FYU E;  4H0L D;  3L71 E;  2A45 H;  3H1J J;  2AXC A;  3A3Y B;  1X79 B;  4ASW A;  3MHV A;  1KFM A;  1JMM A;  1LTJ B;  1LT9 C;  1RE4 A;  4U0A A;  3H1K D;  2JB0 A;  4EDF A;  5EW5 E;  1QEX A;  1PEM A;  2FAE A;  2BCC D;  3B5I A;  1SFC D;  2P10 A;  4NPD A;  3NFQ A;  1T6A A;  1IFM A;  1LTA C;  3D71 A;  3CC7 P;  3CXH D;  4I2L C;  1YJW P;  5EFW B;  2FYU G;  3L71 G;  1JB0 J;  1NOH A;  1KQL A;  1H8A A;  3OJA B;  3VMZ A;  1AVY A;  4XFX A;  1ZRT E;  1SP4 A;  2AFD A;  2CG5 B;  1IMQ A;  1EIA A;  1JMB A;  4BPG A;  1NTK J;  1P84 H;  2K88 A;  2MF4 A;  3A0B H;  1CW5 A;  1RH5 B;  1NGM B;  2XKM A;  2KGA A;  2FYN C;  1HBW A;  2LPK A;  1Q7Y Q;  4WVZ A;  3TNU A;  2Y0C A;  1BCC E;  3LMO A;  1YQ4 C;  5CJ4 A;  3U1C A;  1G1J A;  1YIT P;  2R5D A;  1U57 A;  1HJB A;  2HOD A;  1A02 J;  2QEX P;  2E75 D;  5E79 E;  3HE4 A;  1YTZ I;  4WY4 A;  1GW4 A;  1SQP K;  2CNR A;  1VQ8 P;  2KGC A;  2KLV A;  3AE5 C;  3JCU H;  1L0L K;  5APY A;  4WYM A;  2D2C C;  1ZLL A;  1M56 D;  4U3F E;  4UB6 E;  4DT0 A;  1SQX J;  1L4A B;  1GTW A;  4EYY Q;  4I1L A;  2W6J H;  3VMA A;  2E1M A;  2N6Z A;  1BCC G;  4BRY A;  4F37 A;  2BEZ F;  4BWN A;  1J1E B;  1Q2N A;  5GTI E;  1A43 A;  2LIW A;  5HGN A;  1G2C A;  2IZ1 A;  1DNY A;  1CEI A;  2GZE A;  4GR2 A;  2XNX A;  1VQ7 P;  1IZN B;  1K9M Q;  5KJ7 C;  4PV1 D;  2RKL A;  5CBN A;  2LF4 A;  1FJK A;  1CI6 B;  1L0L E;  3TGU J;  2IFN A;  4XFZ A;  5F2K A;  1KV4 A;  1LTG C;  1DEE G;  1E6J P;  1OX3 A;  1Y47 A;  3FGA D;  1NU1 D;  1SQV D;  4QKO A;  2KS1 B;  1JOC A;  3MP7 B;  4U3F G;  2JGP A;  1JY3 P;  3KYQ A;  3EQ2 A;  5AW3 B;  1NAY A;  3PTZ A;  3GHG A;  4U7J A;  3DPH A;  5KAF E;  1VF5 C;  4YXD C;  2FFD B;  2MR8 A;  4UB8 H;  2OYH A;  2Y9Y A;  3KPE A;  2L6E A;  2Z44 A;  3WU2 H;  3AEB C;  2I1K A;  2KZJ A;  3CMA P;  3H1H D;  3C1L A;  2J5U A;  3D70 A;  2LXC B;  2GYK A;  1L0L G;  2KB7 P;  2WTY A;  2IDB A;  5AVR B;  2W27 A;  1PEO A;  4PJ0 H;  3CXH H;  1JNM A;  2K5X A;  3RGU A;  1NTM J;  3E7K A;  1FOS E;  4C7N A;  1VDF A;  1JY2 O;  1GL2 B;  2WSS H;  1VQO P;  2B87 A;  1FZB A;  2J58 A;  1M1J B;  3H1L E;  3QWO C;  2N5H A;  1HF9 A;  3Q2Y A;  1M6E X;  2WIT A;  1MFT A;  2YIU B;  1KYO E;  3H1J D;  1F80 D;  3B5N A;  1EDI A;  1LT9 A;  1Q82 Q;  4KHX A;  5AW6 B;  1EDJ A;  2KSJ A;  1AVO A;  3PHL A;  1IMP A;  3M0D C;  3D6Y A;  3L70 J;  3HUS C;  3BCC J;  2VSQ A;  2E74 C;  2HFE D;  3MUD A;  3SWF A;  3T97 A;  2L4B A;  1M6N A;  1S5L X;  3HD7 C;  4NPE A;  1CSB A;  1NHL A;  2WPS A;  3CX5 I;  4GKG A;  3W68 A;  1JY2 N;  3TYY A;  1FZF A;  2AEF A;  1AFO A;  2KIK A;  1PP9 E;  1KC8 Q;  3DS2 A;  3P8M C;  1AJY A;  1N7L A;  1K04 A;  4OGQ C;  2J59 M;  1OFC X;  1NTK D;  2ZVO B;  5CMZ A;  5BS1 A;  5HGM A;  2BHV A;  1L0I A;  3V5B A;  1BDC A;  2B9B A;  2WWW A;  1KFN A;  1S72 P;  1IC2 A;  2Z46 A;  1S1C X;  4H44 B;  1SQB E;  2BUO A;  4H13 C;  2N6Y A;  3CPW O;  2WSF J;  1XTC C;  3G29 A;  2ERH A;  2JP3 A;  3AEE C;  4RO0 A;  2A45 G;  2L5G B;  2FAD A;  3MGN A;  1URQ B;  3CCQ P;  1IK7 A;  1PP9 G;  2KG9 A;  3CWB E;  1N7S A;  5CCG A;  3RL0 C;  1A02 F;  1P84 E;  2E43 A;  4DJG A;  2QM8 A;  1OVV A;  1T3U A;  3V4W A;  1PPJ D;  3A0B E;  2MD9 A;  1ZXG A;  1ZN5 A;  2C0W A;  1JEK A;  4KT0 J;  2EHS A;  1DIP A;  1NTM K;  3HTK B;  1H0T A;  2XT1 A;  4W7Z A;  4N78 E;  4D6T E;  3V2P A;  2L0Q A;  2JYG A;  1SQX D;  2L22 A;  1ZMB A;  1SQB G;  3L71 J;  1R8E A; 
#chains in the Genus database with same CATH homology
 1M6N A;  1KQS O;  3CCU P;  2M8P A;  1PEQ A;  2CWO A;  1Q7Y Q;  1K73 Q;  2OAR A;  2EFJ A;  1K30 A;  2PEM A;  4U0E A;  2EIA A;  3WBH A;  3I55 P;  2XXM A;  4U0F A;  3DS1 A;  1VQ9 P;  1PEU A;  4COP A;  2ONT A;  1VQL P;  3CXC O;  2DGY A;  1YIT P;  2PEO A;  1VQM P;  4M0I A;  2P9X A;  3G21 A;  3OW2 O;  3DPH A;  1M74 A;  1Q81 Q;  1KC8 Q;  5I4T G;  3DS2 A;  3MGE A;  3CCE P;  1VQN P;  3G26 A;  1N8R Q;  3CC4 P;  3G0V A;  5BS2 A;  2QA4 P;  1W2B O;  2L6E A;  2Z44 A;  2QEX P;  2PEN A;  4XRO A;  1QVF O;  1AUM A;  4U0D A;  4PH0 A;  1VQ4 P;  3DS4 A;  3CC2 P;  3G1I A;  3CMA P;  5BS1 A;  5F2N A;  1K8A Q;  5HGM A;  2BHV A;  1KD1 Q;  3I56 P;  1RO0 A;  3M1M A;  3P05 A;  2PEQ A;  1VQP P;  1YHQ P;  4COC A;  3HZQ A;  5F2O A;  3E2D A;  4U0A A;  1VQ8 P;  1PEO A;  1S72 P;  1EOQ A;  2XV6 A;  3LRY A;  3CCV P;  4IPY A;  2Z46 A;  3CCM P;  1YIJ P;  3DS0 A;  2BUO A;  4U0C A;  1BAJ A;  2JO0 A;  4U0B A;  1VQK P;  2EG5 A;  1PEM A;  3CME P;  3RG6 C;  4WYM A;  4PH1 A;  1QVG O;  1M1K Q;  3CPW O;  1YJ9 P;  1M90 Q;  2Z45 A;  3B5I A;  5HGL A;  3CCS P;  3G29 A;  2PEJ A;  2E1M A;  3CCL P;  4QNB A;  3G28 A;  5DCK A;  1VQO P;  2OTJ P;  1A43 A;  3CCR P;  2M8N A;  1IUQ A;  1Q86 Q;  1JJ2 O;  5HGN A;  2M8L A;  1M6E X;  3G6E P;  3CCQ P;  3CC7 P;  1VQ5 P;  1VQ6 P;  1YJW P;  3H47 A;  1RO2 A;  4GR2 A;  4XRQ A;  1YJN P;  1VQ7 P;  1K9M Q;  1Q82 Q;  1A8O A;  3CCJ P;  5HGO A;  5JPA A;  3NTE A;  3H4E A;  2OTL P;  3VRL C;  1YI2 P;  3H0D A;  4XFX A;  3G1G A;  2PY8 A;  3G4S P;  1QRJ A;  2KOD A;  2LF4 A;  3DS3 A;  1EIA A;  2PEK A;  3DS5 A;  2BQ1 E;  2XT1 A;  2PEI A;  4XFZ A;  5F2K A;  3DTJ A;  2JYL A;  3Q20 A;  1RNI A;  2JYG A;  1D1D A;  3HYB A;  1NJI Q;  1E6J P;  4XFY A;  1ZMB A;  4GR6 A;  3CD6 P;  3G71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...