3CCMP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccmP02
3CCJP 1KC8Q 1QVGO 3CCQP 3CC4P 1JJ2O 1VQ7P 1VQOP 2QA4P 3G4SP 1VQNP 1K8AQ 1VQ4P 3I55P 1YITP 3I56P 1VQ5P 1Q86Q 1Q81Q 1VQ6P 1YI2P 3CD6P 3CPWO 1NJIQ 3OW2O 1KD1Q 3CMAP 3CXCO 1VQ8P 2OTLP 1KQSO 2QEXP 3CCVP 3CCLP 1K9MQ 1VQMP 1YJ9P 1YJNP 1M90Q 3CCSP 3CMEP 3G6EP 1YHQP 1VQLP 3CC7P 3CCRP 1Q82Q 3CCEP 1YJWP 1Q7YQ 1M1KQ 1YIJP 1W2BO 3CCUP 1VQPP 3G71P 3CCMP 1K73Q 1N8RQ 3CC2P 1S72P 1QVFO 2OTJP 1VQKP 1VQ9P
chains in the Genus database with same CATH superfamily
2V7QJ 1NQ4A 2Y9ZA 3FWLA 4WYMA 3WU2E 2LTEA 5AVVB 5CCHD 3UIAA 2YKQA 1LTGC 2N50A 1SQBE 3P8CE 3CC7P 3E1IA 4H0LB 1M6EX 1N2DC 1RF0A 3NTEA 1QL2A 2ZVOB 2UWJE 1KC8Q 1FOSE 5AVZB 4JYCA 5KP6B 1IJDB 1ZMBA 5BU5A 1P84E 3VN0A 1FZGA 3N7NA 2E75B 1JO5A 1Y9BA 1PZQA 4XE5B 2IBZE 1L4AC 3KHUA 3HUSA 1A02J 1VF5C 2R3SA 3PJSK 2KSJA 5KJ7A 4BPGA 5HV8A 3CCJP 1HBWA 2K9JB 1MFTA 2QM7A 2P9XA 2Q7CA 4XROA 2A45H 5AW2B 2BEZF 2H7HA 4N6JA 3L70J 4BPHA 3CXHH 5AW6B 4H0LC 1VHNA 1W5CE 2XV6A 1BDDA 3G21A 3AE8C 2DGYA 1G1IA 1BGYE 3C9IA 3AE6C 1RNIA 3PP5A 2QEXP 4Z1MH 2E75C 1ZNVA 1URQA 5CJ0A 3U1AA 1ZR2A 1F80D 1NU1D 2AXTE 2M8RA 2M3EA 2BCCG 2QRXA 1RF1A 2QA4P 4WVZA 2N6ZA 3CX5H 2PGDA 3Q20A 3CWBG 2AFEA 1FZEA 3CPWO 2FYZA 1BE3G 1OIPA 3V2PA 1GK4A 1NTMD 1LT9B 5AVTB 1JMBA 4GR6A 3H0DA 4W7YA 1M1JA 2CNRA 2JYLA 1NTKD 2KIKA 5AVYB 1M6NA 3E1RA 1L0LK 2W6BA 3USSA 1HTLC 1PP9D 4WY4A 1SVFA 1KB9E 1FDOA 4RO0A 3L74D 2XKMA 4O9BA 3L72J 1M8OB 2FACA 1H0TB 3TGUD 1UJZA 4H44B 2AEFA 2LR2A 1LT9C 2KI7B 4LGDE 1SQVJ 5APUA 1SP4A 3IF4A 3E2DA 2JO0A 1PEOA 1NU1E 4R0MA 4YTPC 2KG8A 1GW3A 1IC2A 2IBZG 2GUSA 1OR5A 4QKOA 2WMMA 4IZ6A 1FZAA 1LTBC 1NTME 1PEMA 4I6MC 2KG9A 1SQBJ 1HUCA 4HB1A 3B5NB 3DS0A 2WTYA 2PEQA 2P7JA 2OARA 3CX5D 4HH2A 1NTKE 2CPSA 4IL6H 1HY8A 2Z45A 1Z56A 4XRQA 2NRGA 3CMEP 3DTJA 1OW7A 1PP9E 3G3ZA 2KW2A 1JNMA 3AE4C 4H44C 2K9JA 1BGYG 1L0ND 1ZXGA 4KJMA 1JY2O 1Q86Q 1USEA 2KOGA 4ZMDA 2RH0A 3F89A 1OW8A 3L74E 1X0TA 3MHVA 2KR5A 1IFMA 3HYBA 1M56D 1LTAC 2Q3IA 3I5CA 2KK7A 3BASA 1SQQD 3L75D 4HJGH 5DCKA 3TGUE 1Y47A 4UB6H 3CXHE 3B5NC 3W68A 2LPKA 4XFZA 5AW8B 1M90Q 2ZT9C 2LKIA 2WPTA 2CGQA 1IZNB 1PEQA 2N1TD 1KYOH 3CC4P 1T8ZA 1YBKA 5APXA 5KP8B 3AE5C 3H1KJ 1N73B 1EXJA 1WMKA 1AJYA 1KORA 2FYUK 1GXGA 1HWTC 3H1LE 1SQXK 1LT9A 2NO8A 3CX5E 2BASA 3CCRP 3EJDA 3BRVB 3TDKA 1KTMA 1GL2D 3SWYA 5CCHA 3H1IJ 2KNCA 1Q90D 1JM0A 2JWAA 3RK3B 1N7SB 5B66E 2MR8A 1KV4A 2OYHC 1NWQA 5AW3B 3NTNA 4KT0J 2GM4A 2LOLA 4L74A 1K9MQ 2KOQA 1AYIA 1EC5A 1M74A 2OYIA 2A06D 3M91A 1NU1G 1DX7A 3VRLC 3HRNA 4C7NB 2C9LY 3L35A 1SQQE 1NKZB 2XNXA 2YNYA 3G1GA 1N73C 1TU3F 3C8VA 5JPAA 3V2RA 4JF7A 2ZJSE 1H0TA 2FXPA 4C46A 2P1JA 3BVHA 1NTMG 3A0HH 3U59A 2K0XA 3HE4A 1S3JA 2QJPB 3KYQA 3II6A 3G29A 2WVRA 3HE5B 3M0DC 1NTKG 3DS3A 3L73E 1LTTC 1YQ3C 3NMDA 1NKNA 3DS2A 1FC2C 2QNWA 2JB0A 1LT1A 1XTGB 3RGUA 5CMZA 2Z44A 2E76D 2N9BA 3AEAC 2WZ7A 1KYOD 1VQ5P 3L74G 1GTWA 1IFPA 4GOEA 4HKZH 2QJKB 1X3OA 1WRGA 1R5SA 2AEMA 2MJZA 4EDFA 2POHA 1S72P 3HUSB 3TGUG 4EOTA 2O1JA 4IL6E 4XFJA 3D70A 5KLVK 4XFYA 2QJPC 1A8OA 1MZ9A 3L70E 3LRYA 4PWVB 3A5TA 1ACPA 2FXMA 1BCCJ 3DS1A 3FXEA 3B4SA 3L72D 1L4AD 3LMOA 1W2BO 1VQPP 1VF5D 5APQA 1DV5A 2CK3H 1N86A 1X9VA 3Q2YA 5AW9B 1RF0C 2KGEA 1SQVD 4JBZA 5AVSB 1HGZA 2E74C 2YO2A 2IYPA 4U0FA 1IFDA 2RMZA 2K9YA 1JUNA 3HUSC 1S5LH 1N73A 3EWKA 2BHVA 5KJ7C 1L0NG 1SQBD 2GDWA 2HFED 3P8CD 1KYOE 1P84I 1YYCA 2M3BA 3RG2A 2EHSA 1XTCC 1K73Q 1U57A 3S4RA 2IBZI 3GKLC 1NTZK 3G0VA 3PLNA 3RL0B 1NYHA 1M1JB 4NPFX 5CCGC 2FAEA 3W67A 1N7SA 1CSBA 2PEKA 4ZKUA 1SQQG 3L75G 1EZVD 1YTZT 1HQBA 1RE4A 1KILB 2WPRA 3CXCO 3VTPC 1ZV8A 1NVOA 4HYTB 4WY4B 2WSCH 2L9FA 3AE1C 1RHZB 2KP8A 2E42A 3L72E 1NAYA 5TJHA 5GTIE 1NTZJ 4C7NA 2WITA 1L0LE 1SFCD 2ZAEB 3HTKB 1FAVA 1OXZA 2JP3A 2BQ1E 3PHLA 2CPBA 3KXDA 3CC2P 1H88A 2JAZA 4M3LA 5BS2A 1W2EA 3GZMA 1DD4A 3HE5A 1AUMA 3RL0C 1M1JC 3K5BA 3A0HE 1Q81Q 1LGHB 1GDTA 4YPCA 2C0XA 1PL5A 1QEXA 2GZGA 3H1KD 1SQPK 2QVAA 1YJNP 2G3AA 2LXBA 1NHLA 4WY4C 3L73J 2A06G 1VQOP 2ZXEB 3IAOA 3AE7C 3L4FA 2MVUA 1EZVE 3WBHA 3GMAA 3AEDC 3MP7B 3P32A 2K92A 1OVVA 2LKMA 3G26A 2WPQA 3Q5PA 1X22A 2NPSD 5HGOA 1KB9I 1KQLA 4PD4H 1K8AQ 1UIIA 4K35A 2H89C 2I1KA 4IOIH 1GU5A 2MR7A 5KP7B 3RK2D 2IZ0A 5CCGA 1KB9D 3O6QB 3M9HA 1H8AA 3HD7B 2KWLA 3H4EA 2FQ1A 1T3UA 4PJ0H 1T2KD 2C0WA 1PGPA 1S2EA 3SSUA 2FFDA 3P05A 3CCVP 2HLOA 1YTZI 3ITKA 2Q6QA 4UB8H 3MGEA 3H1KE 4AYCA 2VLQA 1AQTA 2KLUA 4F37A 2K88A 3AE9C 3H32A 2FYNB 3B5ND 2O01J 5KAFH 2L22A 3H1IE 2KG6A 1S5LE 3GF7A 2L91A 2ZT9D 1AV1A 4U0AA 3L72G 1DNYA 5CBOA 2PY8A 4GR2A 2KNCB 2FYUE 1IMQA 5BS1A 3H1HJ 3TYYA 4PH0A 1KILA 4W7ZA 1SQXE 1BXIA 1IK7A 3KZIH 1SQVG 3KQGA 1KLPA 3M1MA 2Z46A 1JCCA 3DS4A 3RL0g 1L0IA 2OYIB 4D6TE 4L75A 2GZIA 2A45I 2KXPB 5F2KA 1YQ4C 1JCDA 1GD2E 1DD3A 1KN7A 3HTKA 1CEIA 2FYNC 3CXHI 1VPCA 1SQBG 1HJBA 4EIJA 1RO2A 1IMPA 1L0LJ 1Q2NA 2FXOA 3CWBJ 1SS1A 1JY2P 1JB0J 2YIUB 3JSVC 3CXHD 3HE4B 4R4LA 3GHGA 5H2FH 2Z5IA 1IFNA 1RH5B 5CCHC 1X79B 4IFDK 1EZVG 1AA0A 1JMMA 5KTBA 1NGMB 2FVEA 1NO4A 1RE3C 2VLPA 3RBXA 1ZW0A 3CX5I 2P58A 1VQKP 3VP9A 2JEEA 3IR9A 4NEOA 2OYIC 3H1LD 3P7KA 2N5IA 1GXHA 5TISH 4M0IA 1EDIA 3EFFK 3B71A 3V2QA 1E6JP 4U0EA 4RJTA 1YJWP 3EJBA 4N78E 4PV1D 2PAJA 1BCCE 2IFMA 2IFNA 1VQ6P 3DPHA 4BPFA 4L73A 4OGQB 3FWNA 2VSQA 5K5GB 1VQMP 2XZ0D 3H1KG 1K04A 3O6QA 4PD4E 4U0CA 3HD7A 2MD9A 2K93A 2H88C 4W80A 5AVWB 5KLVE 2BEQD 2ZYGA 3M06A 3VMZA 1IFIA 2L6EA 3BCCJ 1E79H 2FKWB 1FZCA 1Y8AA 3ABVC 4CA3A 1PGOA 2O01H 4PJ0E 4DCKA 1PGQA 2XT1A 1M1KQ 1SFCA 3PTZA 4YXDC 3L71J 2FVFA 3GZLA 1EOQA 5HVCA 4UB8E 1YITP 3L73D 2M8PA 3V6IA 2GZJA 4OGQC 2E74D 3RBZA 1JOCA 5HGNA 2IYOA 2KODA 5KLIB 2EFJA 1LWUB 1LTJB 2H43A 5KAFE 2PEOA 5E79H 2KOPA 1IK9A 2JO1A 1QL1A 3G4SP 3H1JJ 2QM8A 1KD1Q 3R4YA 2P67A 2M8NA 1J1EB 1RE3A 1BSNA 3Q5RA 2ZYDA 2H8PD 5HGLA 2FYUJ 1NTZE 5KAIH 1EDLA 2B87B 1SQXJ 2WSFJ 1FS0E 2MVVA 4ZNCA 5AW5B 4TT3H 3L70D 2B88A 1ZR4A 2XZ1C 2AF8A 2AEJA 1X8YA 5CBNA 5AW1B 4D6TJ 1DH3A 2FQ2A 1KQFB 3P8MC 1Q82Q 3NY7B 1QLED 2WSCJ 3M9BA 5EJDA 4GOFA 2CWOA 4BRYB 3CE7A 5KLIC 1URQD 2P2UA 1LTJC 1FJKA 3I55P 2E5YA 3F5HA 2D2CD 3RK3C 1N7SC 1NU1K 3LW5J 3TSIA 5H2FE 3G28A 1LTIC 1J1EC 1FDIA 1RE4C 1KYOI 2J58A 3CCEP 1PP9G 1RQUA 2GDXA 1VQ9P 1FZBA 4A7PA 3E7KA 1JJ2O 1NAFA 5APSA 4U3FJ 4YXWH 1SQPE 2AVAA 3L37A 1UIXA 2K94A 5F2OA 1IFJA 3QH9A 2Y0CA 3H1HD 1KMIZ 2YXQB 4K3AA 4U7JA 2N1TB 2XNDH 4COPA 3PH0A 5TISE 2A45G 2C9NY 4WY4D 3CCQP 1FJPA 1AVYA 1DEBA 2LL8A 2PRRA 1PIXA 5B5EH 2Z5HA 4XFXA 4GKGA 2W8ZA 3B5IA 1RO0A 5L8RJ 1GL2B 1ZN5A 1YHQP 1VQLP 3Q3DA 1U7JA 3CI9A 3AEGC 5KKZB 1MZ8A 1L0LD 2MKVA 4WBAA 1T6AA 1KZUB 5KLVJ 3H1LG 1USDA 1FE6A 2FFDB 1R5LA 2R44A 2WSSH 4UB6E 1K30A 2KYVA 2QJKC 1U7MA 3Q5SA 4H0LD 3WUUA 2PFXA 3H32B 1VQNP 2I8DA 2SPZA 2YXRB 2FHSC 1MUUA 4HKGA 4U0BA 1EZVI 2E75D 2K3RA 4JQ0D 2Q5UA 3H1HE 5APVA 1LWUA 1JY3O 1LTJA 2QJYB 1IUQA 2WSFH 4XA4A 5APWA 2HODB 2K0YA 3D71A 1FR2A 1VQ4P 1LP1A 1N7LA 5DJTB 1L0NK 1MFZA 2B87A 2QE7H 2FFDC 5HGMA 2YMYA 1EMVA 1CZQA 2E76B 2JU1A 2JGPA 5APTA 5AVRB 2Y9YA 5KAIE 2JQ4A 3D6YA 1A43A 2W6AA 1AQ5A 1JEKA 3A3YB 3CWBE 4CPGA 5GTHH 3L73G 1E0HA 3LW5H 3BCCD 3V4WA 1HGVA 1JY2N 4BRYA 3CL3D 5EW5E 2N5HA 1CI6B 2KGCA 3GHGB 3WUTA 3WMM0 3L71D 2WPSA 2MY5A 4N3YB 1L4AB 2B89A 2ZYAA 1KILC 4QMAA 2R5DA 3MD0A 3MUDA 3KPEA 1FU1A 2E76C 4KHXA 3L70G 1EQ7A 4IL6X 1JTHB 5C39A 3S9OA 2E43A 3H1ID 2VRSA 2KB7P 1M57D 3G1IA 1S1CX 2GUVA 3H1JD 1QGKB 2L0QA 3JCUH 2R32A 2Q9IA 3TK1A 2N1TA 4TLFA 1SQPJ 3FGAD 3CCMP 4IFFA 2FYUD 2YKOA 1SQXD 1HVVA 4H13B 2YMKA 2WSEJ 3GHGC 1ZRTE 4EI2A 1GL2A 3V4QA 4OVNF 1G2CB 1PFIA 2VLNA 5DJUB 3H47A 4D6TD 4WWIA 1VDFA 5B5EE 3BCCE 3PRJA 4UHPB 2KORA 2EIAA 4H44D 4AUWA 2JWDA 3B8EB 2K2QA 2GA1A 1KQSO 1FZCB 3WUVA 1PPJD 3L71E 3H1HG 4RESB 2M5RA 4BXLA 1PGJA 3R2PA 2WWWA 1J1DB 2M5AA 2OYOA 1OW6A 3M0AA 3SWFA 1GPJA 2X2BA 1SFCB 3IN6A 1VL2A 4NPDA 4H2YC 2M8LA 2LMLA 4DJGA 4H13C 4QNBA 1E5WA 4U3FD 3U1CA 4EYYQ 1AVOA 3H6PA 3H1JE 2B9BA 4B86A 2PEIA 2QG4A 2HODA 4H2XC 3TNUB 1L0LG 3HD7C 3EQ2A 3HZQA 3TF5A 1OVUA 1M7LA 2KOSA 3CLQA 4OGQD 2WPVB 1FZCC 3SFDC 4N78D 5B66H 3MTUE 2O1KA 4PD4I 1BCCD 3GW6A 2R3CA 1J1DC 3D6ZA 1CW5A 3L36A 3NFQA 2E5TA 2KGAA 1SFCC 4PD4D 1ZMEC 3T97B 1G1JA 4Y99B 2BCCJ 5KLVD 1SQVK 2HYNA 3CCUP 2FY8A 1HF9A 1KFNA 1PPJE 2NPSB 5GTHE 1R8EA 1BE3J 2N9YB 5BVZA 3EJEA 1GU4A 2V7QH 1CI6A 1OFCX 2IPPA 5CZDB 2KS1B 2KUBA 3RK2B 2FADA 4BWNA 1L4AA 2HG5D 3VMYA 1ZOYC 2BUOA 2ITAA 4ZKPA 2GDYA 2M0BA 2W6JH 3H25A 1RQVA 1SQBK 3MGNA 4U3FE 2HPCA 3OJAB 2QIWA 2KGDA 4H2WC 4MRTC 3G9RA 1L2PA 1JTHA 2J5UA 2ONTA 1T8KA 2K1AA 3B4QA 5AW7B 2GZFA 3RK3D 1N7SD 2WSEH 2PNGA 1MKMA 2LF4A 1GW4A 1NOHA 1D1DA 3BCCG 3A0BH 2W83C 7CEIA 4Y99C 2Q1KA 3GG2A 2XDJA 4LLHA 2WT7B 3JCUE 2NPSC 2P10A 1S4XA 1NH4A 2L4BA 2YIUC 5F2NA 2W27A 1EXIA 1AFOA 1JY3N 3CMAP 3L71G 2ZT9B 1G2CA 1NTZD 3RK2C 4IPYA 2AFDA 4GT1A 3G71P 1OX3A 1HH0A 4WB4A 1ZLLA 1T2KC 3FX0A 4JYBA 2ERHA 3H1IG 4GIFA 3H1JG 3G6EP 1BSHA 3ZDMA 1HJ0A 1S5LX 5AW0B 3BRTB 2E1MA 2OTLP 2DW3A 1EDJA 1FDMA 2OYHB 2FYUG 3AE3C 2LXCB 1SQXG 3I56P 3A2AA 1OMIA 3KDPB 2XZRA 1LTSC 2ROQA 2IX7C 1BGYJ 3GF3A 1DEEG 5APYA 3RK3E 2PEJA 1H89A 1IO4A 4D6TG 3TNUA 2XXMA 1SQPD 2JU2A 2RN0A 2CG5B 2GZEA 5KJ7D 2K5XA 3O8ZA 2N98A 5CJ4A 1LP1B 2XU6A 4L76A 2FQ0A 1UNKA 4U0DA 4OH8B 1PPJG 1GZLA 2ZXXA 2IZ1A 5CHXA 3KZIE 1LNQA 4I1LA 5CCGD 2Y0EA 4I7ZB 4JPZB 3U43A 1OVRA 5EFWB 2NZ2A 2YKPA 1L0NE 3T97A 2PEMA 3V5BA 5GTIH 3QWOC 4R4MA 4U3FG 2JBGA 4PV1B 2K0DX 1KFMA 1Q7YQ 2NPSA 1MV8A 2OTJP 1L0HA 1S9KD 4C7RA 2Y0DA 4I2LC 2Q3EA 1LWUC 3MZWB 1AF8A 2KZIA 2KS1A 2O01N 1ZP0C 3L75E 2OTKE 2I1JA 4IFMA 1EIAA 1RY3A 3WU2H 1N8RQ 2MF4A 2CQ8A 1PEUA 1BCCG 1K05A 2K37A 1VQ7P 1A02F 1GK6A 1NTMK 3GLMA 3RL0D 1BDCA 2EG5A 2AXCA 4I7ZC 4MN4C 1D7MA 4ASVA 2W90A 2JYGA 4NPEA 2EHTA 1GMJA 1SLQA 1KILD 1NTKK 1NU1J 3LIEA 3RG6C 5AW4B 3S1KA 1QVFO 1PV3A 5KLVG 1P84H 2XV5A 2WT7A 2JR8A 3B5NA 2LIUA 2JDIH 4PV1C 3N4XA 1QVGO 2HR3A 2OQQA 2FVAA 3A0BE 4OWFA 2R5BA 2E74B 3OW2O 1NTMJ 2QSIA 1JY3P 2KOOA 4DT0A 3VMAA 1QRJA 2KSEA 2G8YA 1YJ9P 3FXDA 1QX8A 1OWAA 2BCCD 1NTKJ 3JC22 4GODA 3CWBD 2A06E 3BATA 3MUDC 1S9KE 1BE3D 5BU8B 1PP9J 1YI2P 3Q1MA 3V2NA 3CCLP 1LJ2A 2O3JA 3VP8A 3MIWA 3OA7A 3L74J 2JKVA 3VOPA 2M5AB 3OAKA 4DZOA 2OYHA 2N1TC 3GJNA 4DOJA 5I4TG 1DIPA 3CD6P 2L5GB 1NJIQ 1VQ8P 3TGUJ 4RKUJ 1Z6MA 2N6YA 2AXTH 1NTZG 5M1BA 3VYIA 2OGUA 1KQGB 2J59M 1YIJP 1URQB 2KLVA 1GL2C 2JJLA 3A7OA 3C1LA 3EFGA 1KILE 1BAJA 1T3JA 2D2CB 2GYKA 1RF1B 5KKZC 4LC1A 2Z4EA 3VMXA 4H13D 5AVXB 4Y28J 5E79E 1EDKA 3DS5A 3SFEC 3AEFC 2YO3A 4DG9A 3H1LJ 1WT6A 3IFMA 3M0DA 1P84D 3AEBC 3HD7D 2DNWA 1ZRTD 2BCCE 3AEEC 1FBMA 2VLOA 5AVUB 2IBZD 2IDBA 2V4HA 1SQQK 2ZFCA 1BE3E 1KB9H 3NXSA 3AE2C 3CCSP 2WQYC 3LIDA 2KZJA 4COCA 1L0NJ 2RKLA 2PP6A 4PH1A 1URQC 4PXHB 3AECC 4GDOA 2QJYC 2LIWA 1SQPG 3SWKA 2D2CC 4ASWA 1RF1C 4AQRD 1OZHA 1SQVE 1FZFA 3M9QA 2ZVNB 1VF5B 2FBWC 1SQQJ 3L75J 2PENA 1J2JB 1FOSF 1VKUA 5AVQB 2HPCB 1BGYD
chains in the Genus database with same CATH topology
1PEMA 1JJ2O 1EOQA 4XFYA 2QA4P 3DS0A 4WYMA 1A8OA 1VQ4P 5I4TG 1YITP 2PEQA 3Q20A 3LRYA 2M8PA 2OARA 3CPWO 1NJIQ 3CD6P 5F2OA 1VQ8P 3P05A 3CCVP 1W2BO 3DS1A 2Z45A 1K9MQ 4XRQA 3CMEP 1EIAA 3G6EP 3CC7P 3H47A 5HGNA 4GR6A 3DTJA 3MGEA 1YIJP 1M74A 5HGMA 3CCUP 1M6EX 3H0DA 2KODA 4COPA 3NTEA 1VQPP 2EFJA 1N8RQ 3CC2P 2E1MA 1VQKP 2OTLP 1PEUA 1BAJA 2PEOA 1KC8Q 5BS2A 2EIAA 2JYLA 3CCQP 1VQ7P 1AUMA 3VRLC 3G4SP 1ZMBA 1A43A 1Q86Q 3I56P 1Q81Q 2EG5A 1M6NA 1KD1Q 3G1GA 4M0IA 1KQSO 2M8NA 4XFXA 3B5IA 1RO0A 2BUOA 2JYGA 5JPAA 3HYBA 1YJNP 5HGLA 1E6JP 4U0EA 3DS5A 1YHQP 1VQLP 2PEJA 4U0AA 3RG6C 1YJWP 1QVFO 2PY8A 4U0FA 4GR2A 2XXMA 3CCJP 1QVGO 5DCKA 3G29A 1VQOP 2ONTA 2M8LA 5BS1A 2BHVA 1VQ6P 3DPHA 4PH0A 4XFZA 3OW2O 3DS3A 2P9XA 4QNBA 3M1MA 2Z46A 1QRJA 4XROA 3WBHA 2LF4A 1VQMP 1YJ9P 4U0DA 1M90Q 3CCSP 4U0CA 1D1DA 2BQ1E 3DS4A 1Q82Q 1K73Q 1K30A 4COCA 2PEIA 3DS2A 3G0VA 1PEQA 3G26A 4PH1A 2CWOA 2XV6A 3CC4P 2PEKA 3G21A 5HGOA 2Z44A 2JO0A 3E2DA 1VQNP 2DGYA 1K8AQ 1PEOA 5F2KA 3I55P 5F2NA 3HZQA 1VQ5P 2L6EA 1YI2P 3CMAP 1RNIA 3G1IA 3CXCO 2QEXP 3CCLP 4IPYA 2PEMA 3G28A 1RO2A 4U0BA 3CCRP 3CCEP 2PENA 1Q7YQ 2XT1A 1M1KQ 2OTJP 3G71P 3CCMP 1S72P 3H4EA 1VQ9P 1IUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  1KC8 Q;  1QVG O;  3CCQ P;  3CC4 P;  1JJ2 O;  1VQ7 P;  1VQO P;  2QA4 P;  3G4S P;  1VQN P;  1K8A Q;  1VQ4 P;  3I55 P;  1YIT P;  3I56 P;  1VQ5 P;  1Q86 Q;  1Q81 Q;  1VQ6 P;  1YI2 P;  3CD6 P;  3CPW O;  1NJI Q;  3OW2 O;  1KD1 Q;  3CMA P;  3CXC O;  1VQ8 P;  2OTL P;  1KQS O;  2QEX P;  3CCV P;  3CCL P;  1K9M Q;  1VQM P;  1YJ9 P;  1YJN P;  1M90 Q;  3CCS P;  3CME P;  3G6E P;  1YHQ P;  1VQL P;  3CC7 P;  3CCR P;  1Q82 Q;  3CCE P;  1YJW P;  1Q7Y Q;  1M1K Q;  1YIJ P;  1W2B O;  3CCU P;  1VQP P;  3G71 P;  3CCM P;  1K73 Q;  1N8R Q;  3CC2 P;  1S72 P;  1QVF O;  2OTJ P;  1VQK P;  1VQ9 P; 
#chains in the Genus database with same CATH topology
 2V7Q J;  1NQ4 A;  2Y9Z A;  3FWL A;  4WYM A;  3WU2 E;  2LTE A;  5AVV B;  5CCH D;  3UIA A;  2YKQ A;  1LTG C;  2N50 A;  1SQB E;  3P8C E;  3CC7 P;  3E1I A;  4H0L B;  1M6E X;  1N2D C;  1RF0 A;  3NTE A;  1QL2 A;  2ZVO B;  2UWJ E;  1KC8 Q;  1FOS E;  5AVZ B;  4JYC A;  5KP6 B;  1IJD B;  1ZMB A;  5BU5 A;  1P84 E;  3VN0 A;  1FZG A;  3N7N A;  2E75 B;  1JO5 A;  1Y9B A;  1PZQ A;  4XE5 B;  2IBZ E;  1L4A C;  3KHU A;  3HUS A;  1A02 J;  1VF5 C;  2R3S A;  3PJS K;  2KSJ A;  5KJ7 A;  4BPG A;  5HV8 A;  3CCJ P;  1HBW A;  2K9J B;  1MFT A;  2QM7 A;  2P9X A;  2Q7C A;  4XRO A;  2A45 H;  5AW2 B;  2BEZ F;  2H7H A;  4N6J A;  3L70 J;  4BPH A;  3CXH H;  5AW6 B;  4H0L C;  1VHN A;  1W5C E;  2XV6 A;  1BDD A;  3G21 A;  3AE8 C;  2DGY A;  1G1I A;  1BGY E;  3C9I A;  3AE6 C;  1RNI A;  3PP5 A;  2QEX P;  4Z1M H;  2E75 C;  1ZNV A;  1URQ A;  5CJ0 A;  3U1A A;  1ZR2 A;  1F80 D;  1NU1 D;  2AXT E;  2M8R A;  2M3E A;  2BCC G;  2QRX A;  1RF1 A;  2QA4 P;  4WVZ A;  2N6Z A;  3CX5 H;  2PGD A;  3Q20 A;  3CWB G;  2AFE A;  1FZE A;  3CPW O;  2FYZ A;  1BE3 G;  1OIP A;  3V2P A;  1GK4 A;  1NTM D;  1LT9 B;  5AVT B;  1JMB A;  4GR6 A;  3H0D A;  4W7Y A;  1M1J A;  2CNR A;  2JYL A;  1NTK D;  2KIK A;  5AVY B;  1M6N A;  3E1R A;  1L0L K;  2W6B A;  3USS A;  1HTL C;  1PP9 D;  4WY4 A;  1SVF A;  1KB9 E;  1FDO A;  4RO0 A;  3L74 D;  2XKM A;  4O9B A;  3L72 J;  1M8O B;  2FAC A;  1H0T B;  3TGU D;  1UJZ A;  4H44 B;  2AEF A;  2LR2 A;  1LT9 C;  2KI7 B;  4LGD E;  1SQV J;  5APU A;  1SP4 A;  3IF4 A;  3E2D A;  2JO0 A;  1PEO A;  1NU1 E;  4R0M A;  4YTP C;  2KG8 A;  1GW3 A;  1IC2 A;  2IBZ G;  2GUS A;  1OR5 A;  4QKO A;  2WMM A;  4IZ6 A;  1FZA A;  1LTB C;  1NTM E;  1PEM A;  4I6M C;  2KG9 A;  1SQB J;  1HUC A;  4HB1 A;  3B5N B;  3DS0 A;  2WTY A;  2PEQ A;  2P7J A;  2OAR A;  3CX5 D;  4HH2 A;  1NTK E;  2CPS A;  4IL6 H;  1HY8 A;  2Z45 A;  1Z56 A;  4XRQ A;  2NRG A;  3CME P;  3DTJ A;  1OW7 A;  1PP9 E;  3G3Z A;  2KW2 A;  1JNM A;  3AE4 C;  4H44 C;  2K9J A;  1BGY G;  1L0N D;  1ZXG A;  4KJM A;  1JY2 O;  1Q86 Q;  1USE A;  2KOG A;  4ZMD A;  2RH0 A;  3F89 A;  1OW8 A;  3L74 E;  1X0T A;  3MHV A;  2KR5 A;  1IFM A;  3HYB A;  1M56 D;  1LTA C;  2Q3I A;  3I5C A;  2KK7 A;  3BAS A;  1SQQ D;  3L75 D;  4HJG H;  5DCK A;  3TGU E;  1Y47 A;  4UB6 H;  3CXH E;  3B5N C;  3W68 A;  2LPK A;  4XFZ A;  5AW8 B;  1M90 Q;  2ZT9 C;  2LKI A;  2WPT A;  2CGQ A;  1IZN B;  1PEQ A;  2N1T D;  1KYO H;  3CC4 P;  1T8Z A;  1YBK A;  5APX A;  5KP8 B;  3AE5 C;  3H1K J;  1N73 B;  1EXJ A;  1WMK A;  1AJY A;  1KOR A;  2FYU K;  1GXG A;  1HWT C;  3H1L E;  1SQX K;  1LT9 A;  2NO8 A;  3CX5 E;  2BAS A;  3CCR P;  3EJD A;  3BRV B;  3TDK A;  1KTM A;  1GL2 D;  3SWY A;  5CCH A;  3H1I J;  2KNC A;  1Q90 D;  1JM0 A;  2JWA A;  3RK3 B;  1N7S B;  5B66 E;  2MR8 A;  1KV4 A;  2OYH C;  1NWQ A;  5AW3 B;  3NTN A;  4KT0 J;  2GM4 A;  2LOL A;  4L74 A;  1K9M Q;  2KOQ A;  1AYI A;  1EC5 A;  1M74 A;  2OYI A;  2A06 D;  3M91 A;  1NU1 G;  1DX7 A;  3VRL C;  3HRN A;  4C7N B;  2C9L Y;  3L35 A;  1SQQ E;  1NKZ B;  2XNX A;  2YNY A;  3G1G A;  1N73 C;  1TU3 F;  3C8V A;  5JPA A;  3V2R A;  4JF7 A;  2ZJS E;  1H0T A;  2FXP A;  4C46 A;  2P1J A;  3BVH A;  1NTM G;  3A0H H;  3U59 A;  2K0X A;  3HE4 A;  1S3J A;  2QJP B;  3KYQ A;  3II6 A;  3G29 A;  2WVR A;  3HE5 B;  3M0D C;  1NTK G;  3DS3 A;  3L73 E;  1LTT C;  1YQ3 C;  3NMD A;  1NKN A;  3DS2 A;  1FC2 C;  2QNW A;  2JB0 A;  1LT1 A;  1XTG B;  3RGU A;  5CMZ A;  2Z44 A;  2E76 D;  2N9B A;  3AEA C;  2WZ7 A;  1KYO D;  1VQ5 P;  3L74 G;  1GTW A;  1IFP A;  4GOE A;  4HKZ H;  2QJK B;  1X3O A;  1WRG A;  1R5S A;  2AEM A;  2MJZ A;  4EDF A;  2POH A;  1S72 P;  3HUS B;  3TGU G;  4EOT A;  2O1J A;  4IL6 E;  4XFJ A;  3D70 A;  5KLV K;  4XFY A;  2QJP C;  1A8O A;  1MZ9 A;  3L70 E;  3LRY A;  4PWV B;  3A5T A;  1ACP A;  2FXM A;  1BCC J;  3DS1 A;  3FXE A;  3B4S A;  3L72 D;  1L4A D;  3LMO A;  1W2B O;  1VQP P;  1VF5 D;  5APQ A;  1DV5 A;  2CK3 H;  1N86 A;  1X9V A;  3Q2Y A;  5AW9 B;  1RF0 C;  2KGE A;  1SQV D;  4JBZ A;  5AVS B;  1HGZ A;  2E74 C;  2YO2 A;  2IYP A;  4U0F A;  1IFD A;  2RMZ A;  2K9Y A;  1JUN A;  3HUS C;  1S5L H;  1N73 A;  3EWK A;  2BHV A;  5KJ7 C;  1L0N G;  1SQB D;  2GDW A;  2HFE D;  3P8C D;  1KYO E;  1P84 I;  1YYC A;  2M3B A;  3RG2 A;  2EHS A;  1XTC C;  1K73 Q;  1U57 A;  3S4R A;  2IBZ I;  3GKL C;  1NTZ K;  3G0V A;  3PLN A;  3RL0 B;  1NYH A;  1M1J B;  4NPF X;  5CCG C;  2FAE A;  3W67 A;  1N7S A;  1CSB A;  2PEK A;  4ZKU A;  1SQQ G;  3L75 G;  1EZV D;  1YTZ T;  1HQB A;  1RE4 A;  1KIL B;  2WPR A;  3CXC O;  3VTP C;  1ZV8 A;  1NVO A;  4HYT B;  4WY4 B;  2WSC H;  2L9F A;  3AE1 C;  1RHZ B;  2KP8 A;  2E42 A;  3L72 E;  1NAY A;  5TJH A;  5GTI E;  1NTZ J;  4C7N A;  2WIT A;  1L0L E;  1SFC D;  2ZAE B;  3HTK B;  1FAV A;  1OXZ A;  2JP3 A;  2BQ1 E;  3PHL A;  2CPB A;  3KXD A;  3CC2 P;  1H88 A;  2JAZ A;  4M3L A;  5BS2 A;  1W2E A;  3GZM A;  1DD4 A;  3HE5 A;  1AUM A;  3RL0 C;  1M1J C;  3K5B A;  3A0H E;  1Q81 Q;  1LGH B;  1GDT A;  4YPC A;  2C0X A;  1PL5 A;  1QEX A;  2GZG A;  3H1K D;  1SQP K;  2QVA A;  1YJN P;  2G3A A;  2LXB A;  1NHL A;  4WY4 C;  3L73 J;  2A06 G;  1VQO P;  2ZXE B;  3IAO A;  3AE7 C;  3L4F A;  2MVU A;  1EZV E;  3WBH A;  3GMA A;  3AED C;  3MP7 B;  3P32 A;  2K92 A;  1OVV A;  2LKM A;  3G26 A;  2WPQ A;  3Q5P A;  1X22 A;  2NPS D;  5HGO A;  1KB9 I;  1KQL A;  4PD4 H;  1K8A Q;  1UII A;  4K35 A;  2H89 C;  2I1K A;  4IOI H;  1GU5 A;  2MR7 A;  5KP7 B;  3RK2 D;  2IZ0 A;  5CCG A;  1KB9 D;  3O6Q B;  3M9H A;  1H8A A;  3HD7 B;  2KWL A;  3H4E A;  2FQ1 A;  1T3U A;  4PJ0 H;  1T2K D;  2C0W A;  1PGP A;  1S2E A;  3SSU A;  2FFD A;  3P05 A;  3CCV P;  2HLO A;  1YTZ I;  3ITK A;  2Q6Q A;  4UB8 H;  3MGE A;  3H1K E;  4AYC A;  2VLQ A;  1AQT A;  2KLU A;  4F37 A;  2K88 A;  3AE9 C;  3H32 A;  2FYN B;  3B5N D;  2O01 J;  5KAF H;  2L22 A;  3H1I E;  2KG6 A;  1S5L E;  3GF7 A;  2L91 A;  2ZT9 D;  1AV1 A;  4U0A A;  3L72 G;  1DNY A;  5CBO A;  2PY8 A;  4GR2 A;  2KNC B;  2FYU E;  1IMQ A;  5BS1 A;  3H1H J;  3TYY A;  4PH0 A;  1KIL A;  4W7Z A;  1SQX E;  1BXI A;  1IK7 A;  3KZI H;  1SQV G;  3KQG A;  1KLP A;  3M1M A;  2Z46 A;  1JCC A;  3DS4 A;  3RL0 g;  1L0I A;  2OYI B;  4D6T E;  4L75 A;  2GZI A;  2A45 I;  2KXP B;  5F2K A;  1YQ4 C;  1JCD A;  1GD2 E;  1DD3 A;  1KN7 A;  3HTK A;  1CEI A;  2FYN C;  3CXH I;  1VPC A;  1SQB G;  1HJB A;  4EIJ A;  1RO2 A;  1IMP A;  1L0L J;  1Q2N A;  2FXO A;  3CWB J;  1SS1 A;  1JY2 P;  1JB0 J;  2YIU B;  3JSV C;  3CXH D;  3HE4 B;  4R4L A;  3GHG A;  5H2F H;  2Z5I A;  1IFN A;  1RH5 B;  5CCH C;  1X79 B;  4IFD K;  1EZV G;  1AA0 A;  1JMM A;  5KTB A;  1NGM B;  2FVE A;  1NO4 A;  1RE3 C;  2VLP A;  3RBX A;  1ZW0 A;  3CX5 I;  2P58 A;  1VQK P;  3VP9 A;  2JEE A;  3IR9 A;  4NEO A;  2OYI C;  3H1L D;  3P7K A;  2N5I A;  1GXH A;  5TIS H;  4M0I A;  1EDI A;  3EFF K;  3B71 A;  3V2Q A;  1E6J P;  4U0E A;  4RJT A;  1YJW P;  3EJB A;  4N78 E;  4PV1 D;  2PAJ A;  1BCC E;  2IFM A;  2IFN A;  1VQ6 P;  3DPH A;  4BPF A;  4L73 A;  4OGQ B;  3FWN A;  2VSQ A;  5K5G B;  1VQM P;  2XZ0 D;  3H1K G;  1K04 A;  3O6Q A;  4PD4 E;  4U0C A;  3HD7 A;  2MD9 A;  2K93 A;  2H88 C;  4W80 A;  5AVW B;  5KLV E;  2BEQ D;  2ZYG A;  3M06 A;  3VMZ A;  1IFI A;  2L6E A;  3BCC J;  1E79 H;  2FKW B;  1FZC A;  1Y8A A;  3ABV C;  4CA3 A;  1PGO A;  2O01 H;  4PJ0 E;  4DCK A;  1PGQ A;  2XT1 A;  1M1K Q;  1SFC A;  3PTZ A;  4YXD C;  3L71 J;  2FVF A;  3GZL A;  1EOQ A;  5HVC A;  4UB8 E;  1YIT P;  3L73 D;  2M8P A;  3V6I A;  2GZJ A;  4OGQ C;  2E74 D;  3RBZ A;  1JOC A;  5HGN A;  2IYO A;  2KOD A;  5KLI B;  2EFJ A;  1LWU B;  1LTJ B;  2H43 A;  5KAF E;  2PEO A;  5E79 H;  2KOP A;  1IK9 A;  2JO1 A;  1QL1 A;  3G4S P;  3H1J J;  2QM8 A;  1KD1 Q;  3R4Y A;  2P67 A;  2M8N A;  1J1E B;  1RE3 A;  1BSN A;  3Q5R A;  2ZYD A;  2H8P D;  5HGL A;  2FYU J;  1NTZ E;  5KAI H;  1EDL A;  2B87 B;  1SQX J;  2WSF J;  1FS0 E;  2MVV A;  4ZNC A;  5AW5 B;  4TT3 H;  3L70 D;  2B88 A;  1ZR4 A;  2XZ1 C;  2AF8 A;  2AEJ A;  1X8Y A;  5CBN A;  5AW1 B;  4D6T J;  1DH3 A;  2FQ2 A;  1KQF B;  3P8M C;  1Q82 Q;  3NY7 B;  1QLE D;  2WSC J;  3M9B A;  5EJD A;  4GOF A;  2CWO A;  4BRY B;  3CE7 A;  5KLI C;  1URQ D;  2P2U A;  1LTJ C;  1FJK A;  3I55 P;  2E5Y A;  3F5H A;  2D2C D;  3RK3 C;  1N7S C;  1NU1 K;  3LW5 J;  3TSI A;  5H2F E;  3G28 A;  1LTI C;  1J1E C;  1FDI A;  1RE4 C;  1KYO I;  2J58 A;  3CCE P;  1PP9 G;  1RQU A;  2GDX A;  1VQ9 P;  1FZB A;  4A7P A;  3E7K A;  1JJ2 O;  1NAF A;  5APS A;  4U3F J;  4YXW H;  1SQP E;  2AVA A;  3L37 A;  1UIX A;  2K94 A;  5F2O A;  1IFJ A;  3QH9 A;  2Y0C A;  3H1H D;  1KMI Z;  2YXQ B;  4K3A A;  4U7J A;  2N1T B;  2XND H;  4COP A;  3PH0 A;  5TIS E;  2A45 G;  2C9N Y;  4WY4 D;  3CCQ P;  1FJP A;  1AVY A;  1DEB A;  2LL8 A;  2PRR A;  1PIX A;  5B5E H;  2Z5H A;  4XFX A;  4GKG A;  2W8Z A;  3B5I A;  1RO0 A;  5L8R J;  1GL2 B;  1ZN5 A;  1YHQ P;  1VQL P;  3Q3D A;  1U7J A;  3CI9 A;  3AEG C;  5KKZ B;  1MZ8 A;  1L0L D;  2MKV A;  4WBA A;  1T6A A;  1KZU B;  5KLV J;  3H1L G;  1USD A;  1FE6 A;  2FFD B;  1R5L A;  2R44 A;  2WSS H;  4UB6 E;  1K30 A;  2KYV A;  2QJK C;  1U7M A;  3Q5S A;  4H0L D;  3WUU A;  2PFX A;  3H32 B;  1VQN P;  2I8D A;  2SPZ A;  2YXR B;  2FHS C;  1MUU A;  4HKG A;  4U0B A;  1EZV I;  2E75 D;  2K3R A;  4JQ0 D;  2Q5U A;  3H1H E;  5APV A;  1LWU A;  1JY3 O;  1LTJ A;  2QJY B;  1IUQ A;  2WSF H;  4XA4 A;  5APW A;  2HOD B;  2K0Y A;  3D71 A;  1FR2 A;  1VQ4 P;  1LP1 A;  1N7L A;  5DJT B;  1L0N K;  1MFZ A;  2B87 A;  2QE7 H;  2FFD C;  5HGM A;  2YMY A;  1EMV A;  1CZQ A;  2E76 B;  2JU1 A;  2JGP A;  5APT A;  5AVR B;  2Y9Y A;  5KAI E;  2JQ4 A;  3D6Y A;  1A43 A;  2W6A A;  1AQ5 A;  1JEK A;  3A3Y B;  3CWB E;  4CPG A;  5GTH H;  3L73 G;  1E0H A;  3LW5 H;  3BCC D;  3V4W A;  1HGV A;  1JY2 N;  4BRY A;  3CL3 D;  5EW5 E;  2N5H A;  1CI6 B;  2KGC A;  3GHG B;  3WUT A;  3WMM 0;  3L71 D;  2WPS A;  2MY5 A;  4N3Y B;  1L4A B;  2B89 A;  2ZYA A;  1KIL C;  4QMA A;  2R5D A;  3MD0 A;  3MUD A;  3KPE A;  1FU1 A;  2E76 C;  4KHX A;  3L70 G;  1EQ7 A;  4IL6 X;  1JTH B;  5C39 A;  3S9O A;  2E43 A;  3H1I D;  2VRS A;  2KB7 P;  1M57 D;  3G1I A;  1S1C X;  2GUV A;  3H1J D;  1QGK B;  2L0Q A;  3JCU H;  2R32 A;  2Q9I A;  3TK1 A;  2N1T A;  4TLF A;  1SQP J;  3FGA D;  3CCM P;  4IFF A;  2FYU D;  2YKO A;  1SQX D;  1HVV A;  4H13 B;  2YMK A;  2WSE J;  3GHG C;  1ZRT E;  4EI2 A;  1GL2 A;  3V4Q A;  4OVN F;  1G2C B;  1PFI A;  2VLN A;  5DJU B;  3H47 A;  4D6T D;  4WWI A;  1VDF A;  5B5E E;  3BCC E;  3PRJ A;  4UHP B;  2KOR A;  2EIA A;  4H44 D;  4AUW A;  2JWD A;  3B8E B;  2K2Q A;  2GA1 A;  1KQS O;  1FZC B;  3WUV A;  1PPJ D;  3L71 E;  3H1H G;  4RES B;  2M5R A;  4BXL A;  1PGJ A;  3R2P A;  2WWW A;  1J1D B;  2M5A A;  2OYO A;  1OW6 A;  3M0A A;  3SWF A;  1GPJ A;  2X2B A;  1SFC B;  3IN6 A;  1VL2 A;  4NPD A;  4H2Y C;  2M8L A;  2LML A;  4DJG A;  4H13 C;  4QNB A;  1E5W A;  4U3F D;  3U1C A;  4EYY Q;  1AVO A;  3H6P A;  3H1J E;  2B9B A;  4B86 A;  2PEI A;  2QG4 A;  2HOD A;  4H2X C;  3TNU B;  1L0L G;  3HD7 C;  3EQ2 A;  3HZQ A;  3TF5 A;  1OVU A;  1M7L A;  2KOS A;  3CLQ A;  4OGQ D;  2WPV B;  1FZC C;  3SFD C;  4N78 D;  5B66 H;  3MTU E;  2O1K A;  4PD4 I;  1BCC D;  3GW6 A;  2R3C A;  1J1D C;  3D6Z A;  1CW5 A;  3L36 A;  3NFQ A;  2E5T A;  2KGA A;  1SFC C;  4PD4 D;  1ZME C;  3T97 B;  1G1J A;  4Y99 B;  2BCC J;  5KLV D;  1SQV K;  2HYN A;  3CCU P;  2FY8 A;  1HF9 A;  1KFN A;  1PPJ E;  2NPS B;  5GTH E;  1R8E A;  1BE3 J;  2N9Y B;  5BVZ A;  3EJE A;  1GU4 A;  2V7Q H;  1CI6 A;  1OFC X;  2IPP A;  5CZD B;  2KS1 B;  2KUB A;  3RK2 B;  2FAD A;  4BWN A;  1L4A A;  2HG5 D;  3VMY A;  1ZOY C;  2BUO A;  2ITA A;  4ZKP A;  2GDY A;  2M0B A;  2W6J H;  3H25 A;  1RQV A;  1SQB K;  3MGN A;  4U3F E;  2HPC A;  3OJA B;  2QIW A;  2KGD A;  4H2W C;  4MRT C;  3G9R A;  1L2P A;  1JTH A;  2J5U A;  2ONT A;  1T8K A;  2K1A A;  3B4Q A;  5AW7 B;  2GZF A;  3RK3 D;  1N7S D;  2WSE H;  2PNG A;  1MKM A;  2LF4 A;  1GW4 A;  1NOH A;  1D1D A;  3BCC G;  3A0B H;  2W83 C;  7CEI A;  4Y99 C;  2Q1K A;  3GG2 A;  2XDJ A;  4LLH A;  2WT7 B;  3JCU E;  2NPS C;  2P10 A;  1S4X A;  1NH4 A;  2L4B A;  2YIU C;  5F2N A;  2W27 A;  1EXI A;  1AFO A;  1JY3 N;  3CMA P;  3L71 G;  2ZT9 B;  1G2C A;  1NTZ D;  3RK2 C;  4IPY A;  2AFD A;  4GT1 A;  3G71 P;  1OX3 A;  1HH0 A;  4WB4 A;  1ZLL A;  1T2K C;  3FX0 A;  4JYB A;  2ERH A;  3H1I G;  4GIF A;  3H1J G;  3G6E P;  1BSH A;  3ZDM A;  1HJ0 A;  1S5L X;  5AW0 B;  3BRT B;  2E1M A;  2OTL P;  2DW3 A;  1EDJ A;  1FDM A;  2OYH B;  2FYU G;  3AE3 C;  2LXC B;  1SQX G;  3I56 P;  3A2A A;  1OMI A;  3KDP B;  2XZR A;  1LTS C;  2ROQ A;  2IX7 C;  1BGY J;  3GF3 A;  1DEE G;  5APY A;  3RK3 E;  2PEJ A;  1H89 A;  1IO4 A;  4D6T G;  3TNU A;  2XXM A;  1SQP D;  2JU2 A;  2RN0 A;  2CG5 B;  2GZE A;  5KJ7 D;  2K5X A;  3O8Z A;  2N98 A;  5CJ4 A;  1LP1 B;  2XU6 A;  4L76 A;  2FQ0 A;  1UNK A;  4U0D A;  4OH8 B;  1PPJ G;  1GZL A;  2ZXX A;  2IZ1 A;  5CHX A;  3KZI E;  1LNQ A;  4I1L A;  5CCG D;  2Y0E A;  4I7Z B;  4JPZ B;  3U43 A;  1OVR A;  5EFW B;  2NZ2 A;  2YKP A;  1L0N E;  3T97 A;  2PEM A;  3V5B A;  5GTI H;  3QWO C;  4R4M A;  4U3F G;  2JBG A;  4PV1 B;  2K0D X;  1KFM A;  1Q7Y Q;  2NPS A;  1MV8 A;  2OTJ P;  1L0H A;  1S9K D;  4C7R A;  2Y0D A;  4I2L C;  2Q3E A;  1LWU C;  3MZW B;  1AF8 A;  2KZI A;  2KS1 A;  2O01 N;  1ZP0 C;  3L75 E;  2OTK E;  2I1J A;  4IFM A;  1EIA A;  1RY3 A;  3WU2 H;  1N8R Q;  2MF4 A;  2CQ8 A;  1PEU A;  1BCC G;  1K05 A;  2K37 A;  1VQ7 P;  1A02 F;  1GK6 A;  1NTM K;  3GLM A;  3RL0 D;  1BDC A;  2EG5 A;  2AXC A;  4I7Z C;  4MN4 C;  1D7M A;  4ASV A;  2W90 A;  2JYG A;  4NPE A;  2EHT A;  1GMJ A;  1SLQ A;  1KIL D;  1NTK K;  1NU1 J;  3LIE A;  3RG6 C;  5AW4 B;  3S1K A;  1QVF O;  1PV3 A;  5KLV G;  1P84 H;  2XV5 A;  2WT7 A;  2JR8 A;  3B5N A;  2LIU A;  2JDI H;  4PV1 C;  3N4X A;  1QVG O;  2HR3 A;  2OQQ A;  2FVA A;  3A0B E;  4OWF A;  2R5B A;  2E74 B;  3OW2 O;  1NTM J;  2QSI A;  1JY3 P;  2KOO A;  4DT0 A;  3VMA A;  1QRJ A;  2KSE A;  2G8Y A;  1YJ9 P;  3FXD A;  1QX8 A;  1OWA A;  2BCC D;  1NTK J;  3JC2 2;  4GOD A;  3CWB D;  2A06 E;  3BAT A;  3MUD C;  1S9K E;  1BE3 D;  5BU8 B;  1PP9 J;  1YI2 P;  3Q1M A;  3V2N A;  3CCL P;  1LJ2 A;  2O3J A;  3VP8 A;  3MIW A;  3OA7 A;  3L74 J;  2JKV A;  3VOP A;  2M5A B;  3OAK A;  4DZO A;  2OYH A;  2N1T C;  3GJN A;  4DOJ A;  5I4T G;  1DIP A;  3CD6 P;  2L5G B;  1NJI Q;  1VQ8 P;  3TGU J;  4RKU J;  1Z6M A;  2N6Y A;  2AXT H;  1NTZ G;  5M1B A;  3VYI A;  2OGU A;  1KQG B;  2J59 M;  1YIJ P;  1URQ B;  2KLV A;  1GL2 C;  2JJL A;  3A7O A;  3C1L A;  3EFG A;  1KIL E;  1BAJ A;  1T3J A;  2D2C B;  2GYK A;  1RF1 B;  5KKZ C;  4LC1 A;  2Z4E A;  3VMX A;  4H13 D;  5AVX B;  4Y28 J;  5E79 E;  1EDK A;  3DS5 A;  3SFE C;  3AEF C;  2YO3 A;  4DG9 A;  3H1L J;  1WT6 A;  3IFM A;  3M0D A;  1P84 D;  3AEB C;  3HD7 D;  2DNW A;  1ZRT D;  2BCC E;  3AEE C;  1FBM A;  2VLO A;  5AVU B;  2IBZ D;  2IDB A;  2V4H A;  1SQQ K;  2ZFC A;  1BE3 E;  1KB9 H;  3NXS A;  3AE2 C;  3CCS P;  2WQY C;  3LID A;  2KZJ A;  4COC A;  1L0N J;  2RKL A;  2PP6 A;  4PH1 A;  1URQ C;  4PXH B;  3AEC C;  4GDO A;  2QJY C;  2LIW A;  1SQP G;  3SWK A;  2D2C C;  4ASW A;  1RF1 C;  4AQR D;  1OZH A;  1SQV E;  1FZF A;  3M9Q A;  2ZVN B;  1VF5 B;  2FBW C;  1SQQ J;  3L75 J;  2PEN A;  1J2J B;  1FOS F;  1VKU A;  5AVQ B;  2HPC B;  1BGY D; 
#chains in the Genus database with same CATH homology
 1PEM A;  1JJ2 O;  1EOQ A;  4XFY A;  2QA4 P;  3DS0 A;  4WYM A;  1A8O A;  1VQ4 P;  5I4T G;  1YIT P;  2PEQ A;  3Q20 A;  3LRY A;  2M8P A;  2OAR A;  3CPW O;  1NJI Q;  3CD6 P;  5F2O A;  1VQ8 P;  3P05 A;  3CCV P;  1W2B O;  3DS1 A;  2Z45 A;  1K9M Q;  4XRQ A;  3CME P;  1EIA A;  3G6E P;  3CC7 P;  3H47 A;  5HGN A;  4GR6 A;  3DTJ A;  3MGE A;  1YIJ P;  1M74 A;  5HGM A;  3CCU P;  1M6E X;  3H0D A;  2KOD A;  4COP A;  3NTE A;  1VQP P;  2EFJ A;  1N8R Q;  3CC2 P;  2E1M A;  1VQK P;  2OTL P;  1PEU A;  1BAJ A;  2PEO A;  1KC8 Q;  5BS2 A;  2EIA A;  2JYL A;  3CCQ P;  1VQ7 P;  1AUM A;  3VRL C;  3G4S P;  1ZMB A;  1A43 A;  1Q86 Q;  3I56 P;  1Q81 Q;  2EG5 A;  1M6N A;  1KD1 Q;  3G1G A;  4M0I A;  1KQS O;  2M8N A;  4XFX A;  3B5I A;  1RO0 A;  2BUO A;  2JYG A;  5JPA A;  3HYB A;  1YJN P;  5HGL A;  1E6J P;  4U0E A;  3DS5 A;  1YHQ P;  1VQL P;  2PEJ A;  4U0A A;  3RG6 C;  1YJW P;  1QVF O;  2PY8 A;  4U0F A;  4GR2 A;  2XXM A;  3CCJ P;  1QVG O;  5DCK A;  3G29 A;  1VQO P;  2ONT A;  2M8L A;  5BS1 A;  2BHV A;  1VQ6 P;  3DPH A;  4PH0 A;  4XFZ A;  3OW2 O;  3DS3 A;  2P9X A;  4QNB A;  3M1M A;  2Z46 A;  1QRJ A;  4XRO A;  3WBH A;  2LF4 A;  1VQM P;  1YJ9 P;  4U0D A;  1M90 Q;  3CCS P;  4U0C A;  1D1D A;  2BQ1 E;  3DS4 A;  1Q82 Q;  1K73 Q;  1K30 A;  4COC A;  2PEI A;  3DS2 A;  3G0V A;  1PEQ A;  3G26 A;  4PH1 A;  2CWO A;  2XV6 A;  3CC4 P;  2PEK A;  3G21 A;  5HGO A;  2Z44 A;  2JO0 A;  3E2D A;  1VQN P;  2DGY A;  1K8A Q;  1PEO A;  5F2K A;  3I55 P;  5F2N A;  3HZQ A;  1VQ5 P;  2L6E A;  1YI2 P;  3CMA P;  1RNI A;  3G1I A;  3CXC O;  2QEX P;  3CCL P;  4IPY A;  2PEM A;  3G28 A;  1RO2 A;  4U0B A;  3CCR P;  3CCE P;  2PEN A;  1Q7Y Q;  2XT1 A;  1M1K Q;  2OTJ P;  3G71 P;  3CCM P;  1S72 P;  3H4E A;  1VQ9 P;  1IUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...