3CCMP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ccmP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3ccmP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3ccmP02
2OTJP 1Q82Q 1VQ6P 3CCQP 2QA4P 1QVGO 1NJIQ 3CMEP 3CCUP 1W2BO 1JJ2O 3G4SP 1VQMP 3G6EP 1YIJP 3CCEP 1KQSO 1YHQP 2QEXP 3CCJP 1VQLP 1YITP 1KD1Q 1KC8Q 3CXCO 1VQOP 1VQ9P 1YJNP 1QVFO 3CC2P 1VQ5P 1M1KQ 3CC7P 3OW2O 3I56P 1VQ8P 1YJ9P 3CCSP 3G71P 1S72P 3CCLP 3CMAP 1YI2P 1Q7YQ 3CC4P 1Q81Q 3CD6P 2OTLP 3CCRP 1Q86Q 1K8AQ 3CCMP 1VQ4P 3I55P 3CCVP 1YJWP 1VQ7P 1K9MQ 1VQPP 1VQKP 1N8RQ 3CPWO 1VQNP 1K73Q 1M90Q
chains in the Genus database with same CATH superfamily
1J1EB 1KILC 2K0DX 1VQ9P 1OVUA 1VL2A 1VQ8P 2K2QA 2XXMA 3CCRP 4TT3H 3I55P 1N73B 2QJKB 2Y0EA 1NTMG 4CA3A 2W90A 3SWFA 3EJBA 3T97A 2WSCH 4WY4C 2KYVA 2KODA 1ACPA 1FZGA 2KOPA 3P8CD 2L0QA 1VDFA 1H89A 2JB0A 2LPKA 2KLVA 2ZJSE 2X2BA 2KOSA 4K3AA 3KDPB 2WPSA 2QNWA 2R3SA 5KLVJ 3E1RA 3LW5H 2LXCB 5CCGD 4DOJA 1U7JA 3CC2P 1RE4C 2K88A 2K0YA 4RJTA 3KZIH 1LTSC 3MUDA 1NWQA 1JEKA 3CCMP 1GL2C 1G2CB 5BU5A 2WPRA 3HRNA 2MVVA 1HQBA 5F2NA 1SFCD 2BCCJ 1W2BO 1LJ2A 1YIJP 2LXBA 2OQQA 2J59M 2GUVA 3L73G 2V7QH 3H1LE 1QRJA 1VQ5P 4N78E 2G3AA 1BSNA 3D6ZA 3CD6P 2KZJA 2K1AA 1EDJA 1RE3C 5AW1B 2PEQA 2BEQD 4UB6E 5KKZC 2HPCA 2K5XA 2IBZI 3L72G 1JY2N 1KQSO 1KILB 1KD1Q 2P58A 2HODA 1Z56A 2Z5HA 3T97B 3CX5D 1HVVA 4XFZA 1RE3A 3CWBG 4Y28J 1N7SC 3Q5SA 2PFXA 3OA7A 5AW9B 4IFDK 2Q9IA 2PEKA 4QMAA 1IK9A 1FZBA 4ASWA 3L37A 5AW6B 1PPJE 4UB8E 2JWAA 3PJSK 4WY4B 1A43A 2E5YA 4EI2A 3V4WA 1ZW0A 1ZRTD 3Q3DA 2Z4EA 4BXLA 1VQPP 1SQBD 2M8RA 1IFDA 1K73Q 2LKMA 4XE5B 3MZWB 2GYKA 4YXDC 2WTYA 3AEDC 1L0LK 1FC2C 2FQ2A 5GTIH 3H25A 5KP8B 1ZR4A 3G0VA 5AVQB 4R0MA 1SVFA 5I4TG 2YXQB 1BE3D 5CCGA 2J58A 3C8VA 1X9VA 4U7JA 1W5CE 3RK3C 4H44D 2OYIC 2R32A 1GL2B 4HKZH 1L0LE 4GODA 1R5LA 1LP1A 1EXIA 4PJ0E 1KYOH 1Y9BA 2M3BA 1NO4A 2XV5A 4RESB 2AEJA 2W83C 2IYPA 1R5SA 3VMYA 5KAIE 3P8MC 1SFCA 4D6TE 1VKUA 3M9QA 1P84H 1GK4A 2WSEJ 5TISE 2LTEA 3L73E 2EFJA 3R2PA 4U0FA 1VQNP 4JPZB 2KI7B 3L36A 1AFOA 2L9FA 1JB0J 5KKZB 2MD9A 2IBZE 1AQTA 3AE6C 1YJNP 2K37A 2JDIH 3AE3C 1AA0A 5C39A 2PEOA 1N7SB 4YXWH 3AE1C 1LTBC 2KGAA 1NTZD 4IZ6A 1EDKA 3L74D 5EW5E 2KNCB 2PNGA 1DV5A 5F2OA 1WRGA 1LNQA 3DS4A 4I6MC 2FVAA 3VRLC 4DJGA 3CLQA 2P9XA 2DW3A 3VMZA 2BASA 5AVYB 2KOGA 5CJ4A 1BCCJ 2M0BA 2FQ1A 1GXHA 4H44C 1LP1B 3L70E 2AXCA 3H1IG 1NU1K 5KP6B 2DNWA 5AVZB 1SQVD 2N9YB 3S9OA 1ZP0C 1DX7A 1W2EA 1LT9C 3GKLC 1EZVI 2OYHC 2E74C 2E76C 3RK3B 3H1JD 1SQQG 2OYIB 1AV1A 1RH5B 2KG6A 1OMIA 3A0BH 3WU2H 1BDCA 1AVOA 2M8NA 2VLNA 4WWIA 4JQ0D 1DD3A 2H7HA 1D1DA 5APTA 2OYHA 3CI9A 1SQPD 5DJUB 2N6ZA 3L71G 1GU5A 4UHPB 5KJ7A 2NRGA 3NXSA 2KGEA 1EDIA 5KAFH 1NTKE 4ZKPA 1PFIA 2FQ0A 5HV8A 3GZLA 1NTMJ 3A3YB 2MF4A 1KYOI 2K92A 5EFWB 4ZKUA 1E5WA 1SQXG 2YMKA 1IFPA 2ZYDA 4O9BA 1SQBK 1L0ND 1P84I 3E1IA 3KQGA 3WMM0 1KB9I 2IFNA 1GTWA 5AVUB 1NTZG 2JU2A 1T3UA 3V6IA 7CEIA 2FVEA 3G3ZA 3JCUE 2Z46A 1EXJA 2QM7A 4F37A 1OW6A 2FBWC 2KUBA 1EC5A 2E75D 3B5ND 1MFZA 2J5UA 1OVVA 2ZXXA 2GZGA 3VN0A 4XFYA 2KIKA 1M1JA 1H88A 4H44B 1Q7YQ 2A45H 5KP7B 1PIXA 3L73J 1RO0A 2M5AB 1KTMA 3CPWO 1LT9B 1EZVE 2OYHB 2E74B 4BRYA 2E76B 3H1JG 3AEFC 3GW6A 1N7LA 1NAFA 1SQQE 3L72J 3BCCG 2A06E 3M06A 5TJHA 2XNXA 3U1AA 1NKZB 2YO3A 2FYUG 2BQ1E 3CWBJ 3CXHI 2N98A 3DS1A 5KLVE 1PEUA 2IZ0A 5GTHE 1BXIA 3WUUA 1L4AD 1MZ8A 1LWUA 3H1LD 1A02J 1GXGA 4N78D 2NO8A 2AFDA 1JY2P 1KYOE 1BGYG 3EQ2A 3H1HG 4DZOA 1TU3F 2OARA 1K04A 3DPHA 2B9BA 4YPCA 2HG5D 1NOHA 1P84E 2V4HA 3RL0D 1PEOA 1L0NG 1KB9E 2ZVOB 3MGEA 1VQOP 2H8PD 5B5EH 2E75C 3B5NC 1HTLC 2KP8A 5CCHD 1RQUA 5APWA 3AEEC 2GZJA 1JTHA 1GW3A 2RKLA 2ZFCA 3G21A 3L75G 1R8EA 1VQLP 1PPJD 3O8ZA 3O6QA 1J1DC 3B5NA 2GDYA 4NEOA 1IFMA 4KJMA 2JO0A 4EDFA 3F89A 1YTZT 1M8OB 3HD7D 2NPSC 3VMAA 1VQ6P 1NJIQ 3DTJA 2ZVNB 1NTKJ 1PP9D 5HGNA 4H2WC 1YHQP 1URQD 2EG5A 3ITKA 3H0DA 3AE5C 1JY3O 1KZUB 3D71A 2V7QJ 5E79H 3VTPC 1OW8A 4XRQA 1OFCX 4COCA 2KG8A 1L4AC 2JQ4A 2FYNC 2A45I 3TSIA 3BCCE 1L0LD 2Y0DA 3CXHE 5HGOA 3LMOA 3GJNA 3I56P 1FZAA 4D6TD 3TF5A 2QVAA 3RL0C 3A0BE 1L4AA 1D7MA 3WU2E 2OTJP 2FVFA 4GIFA 1AJYA 1S1CX 1JTHB 4A7PA 5CCHC 2O3JA 2R5BA 2IBZD 3LIDA 4H0LC 1YYCA 4COPA 1IFJA 1Q90D 1GD2E 3AEGC 2E75B 3O6QB 5KAFE 3TGUD 3B5NB 2XV6A 2L6EA 1MUUA 3H1IJ 3AECC 5AW2B 1T6AA 1DD4A 2QIWA 1FJPA 5CCHA 3CCJP 1FR2A 3A7OA 1SQQJ 3HD7C 2FXMA 1J1DB 3L75E 3MUDC 1UJZA 2K9JB 1URQC 4XFXA 1ZXGA 3CCQP 2NPSB 2LF4A 1J2JB 3B4QA 3LIEA 4B86A 3HD7A 3L71J 3CXCO 5CJ0A 2AF8A 1PP9G 2HR3A 3HE5B 3Q2YA 3NY7B 3G71P 3L70D 1VHNA 1YQ4C 1X0TA 3N7NA 2W8ZA 5APQA 1URQA 3B4SA 3GF3A 1M6NA 1HWTC 1S4XA 2QG4A 1SQXJ 1L4AB 4C46A 3KYQA 2FYNB 2CG5B 3H1KG 3SFEC 3Q5PA 2AFEA 3B8EB 2W6AA 1BCCE 2RN0A 1QL1A 4U3FD 2KOOA 4W7ZA 3A5TA 3HYBA 2JR8A 1NU1D 2P10A 5M1BA 3W67A 2Q3IA 5AVXB 3U1CA 3CX5H 2WITA 3PLNA 2FXPA 4R4LA 1OWAA 5DJTB 1T8ZA 5B66H 1NTKD 1E79H 1AQ5A 1G1JA 2JO1A 4H0LB 1CEIA 4L73A 3HE4A 3GZMA 3S1KA 1SP4A 3TNUA 1H0TA 1PZQA 2XNDH 3FX0A 1QLED 5AVRB 1KILE 1AVYA 2K9YA 1FZCA 1HH0A 1FDMA 3PH0A 3HD7B 1L0IA 1NTME 1IK7A 1VQ4P 2B87A 3S4RA 4DT0A 1VQ7P 3WUTA 5CCGC 2E43A 5B5EE 3BCCJ 1URQB 2FY8A 1VF5D 1JCCA 4GOEA 3GMAA 4OH8B 1SFCC 3CC4P 1Q86Q 2KGDA 2W6JH 3M91A 3NMDA 3ABVC 4I2LC 3DS2A 2KOQA 1KN7A 3VYIA 1N86A 4XA4A 5AW3B 4ZMDA 1EZVD 2VLPA 1BGYJ 3H1HJ 2OGUA 1YQ3C 1FZEA 2HPCB 3G29A 2N1TD 2ITAA 2N6YA 4OGQD 3USSA 4U3FG 5KJ7D 2C0WA 2HODB 2A06D 2HLOA 2Q3EA 3WBHA 2MJZA 4EIJA 3HE4B 1IO4A 4HH2A 1ZOYC 3OJAB 4U0CA 2N50A 1H0TB 1G1IA 1LTTC 1RF0A 2GDWA 1JM0A 5KLVD 1L2PA 2MVUA 4PXHB 1LT1A 3L75J 2QSIA 1QX8A 3L72E 1L0HA 1EOQA 2K93A 1PGQA 3K5BA 4N6JA 1KYOD 4RO0A 2QA4P 2DGYA 4LLHA 5BVZA 2YKOA 2R44A 3CWBE 1FS0E 1P84D 4GOFA 2BCCD 3V2PA 2CGQA 1KB9D 1KQGB 4PWVB 1AUMA 3TYYA 2ZYAA 1X8YA 2E1MA 3SWKA 3L35A 4KHXA 1SQBG 4PD4H 5APUA 2ONTA 1NGMB 1HBWA 1SFCB 1KQLA 1BE3G 4ZNCA 1OR5A 2XKMA 2JYLA 3G9RA 1NVOA 2M3EA 5KJ7C 2IPPA 1EMVA 1NTKK 4M0IA 4NPFX 4DG9A 1S3JA 1BDDA 2IYOA 1ZMEC 3HTKA 1YJWP 3TK1A 1K9MQ 2YO2A 2N1TA 4KT0J 3RK3E 2C0XA 1AF8A 3D6YA 3KZIE 2N9BA 3SWYA 2PRRA 4H2YC 2O01H 2E5TA 3CXHD 2WWWA 1XTCC 3HUSA 2W6BA 3AEAC 4GT1A 1NQ4A 2XZ0D 1JNMA 4NPDA 3MD0A 1GK6A 2JWDA 3PHLA 3GF7A 2JP3A 5AVVB 2JU1A 3L74G 2N5HA 5KTBA 2KSJA 1EQ7A 3PP5A 1M1JC 2GA1A 2OTKE 2PEJA 3V4QA 5B66E 5AVWB 1BAJA 1YITP 1IC2A 3G28A 3H1KJ 2KGCA 2OTLP 1PL5A 1SQQK 4LGDE 4N3YB 1HF9A 1SQVG 3DS3A 3H1IE 4IOIH 1MKMA 5AVSB 2KG9A 2P7JA 3BATA 5KLVK 5APXA 5AVTB 4AYCA 2FHSC 1FJKA 2AEMA 3V2NA 4PD4I 2Y0CA 3CCLP 1S2EA 1LWUC 5L8RJ 3IR9A 5H2FH 2KR5A 2D2CD 1NH4A 5GTIE 5HGLA 1FOSF 3VP9A 1SQPG 5BU8B 4JBZA 1JMMA 3E7KA 2RH0A 3DS0A 1SQXK 3P05A 1DNYA 1ZN5A 3L71E 1BCCD 4HB1A 1HY8A 1QGKB 1H8AA 4DCKA 5CZDB 3BRVB 3M0DA 1JOCA 3V2RA 1SQXE 2Y9YA 4BPFA 1DH3A 2H88C 4UB8H 1CSBA 2QM8A 2O1JA 3RBXA 1NTZE 3CCVP 2FXOA 1M1JB 2ZYGA 3PTZA 1U7MA 2M8LA 3VMXA 4BRYB 1LTGC 1PGJA 2PP6A 2AEFA 1EIAA 2CWOA 3FWNA 3SFDC 2WPVB 2FYZA 3PRJA 1NTMD 2UWJE 3H6PA 1K30A 3RL0g 2ZT9D 2GZFA 4WB4A 4QKOA 2GZIA 1YBKA 4ASVA 1FU1A 4GDOA 2D2CC 3U43A 4PJ0H 1X22A 4WY4D 3H1JE 1AYIA 3H32A 4PD4E 2I8DA 3G26A 1LWUB 1GU4A 5TISH 2GZEA 1JCDA 3BASA 3CCEP 4IL6H 1IMQA 2MR8A 2YIUC 2G8YA 4PV1D 2WPQA 1GZLA 1ZR2A 2FYUE 3CCSP 1S72P 3W68A 2VLOA 2WT7A 2WZ7A 3KHUA 3H1LG 2PEIA 2YKPA 1M7LA 3L73D 4K35A 4CPGA 1GL2D 2JAZA 4HYTB 3H47A 1K05A 1BSHA 1BGYE 3H1HE 2IFMA 2CPSA 4AQRD 2MKVA 3MIWA 1SQBJ 1L0NE 2Q1KA 1VQKP 3L72D 1KQFB 2B89A 1NHLA 3G4SP 2LR2A 1JO5A 1BE3J 3CWBD 1EDLA 1JY3P 1FE6A 3SSUA 2KB7P 4QNBA 1FBMA 1YJ9P 2ZT9C 1PPJG 2H43A 2FFDC 4U0BA 3EJEA 4I7ZC 1ZMBA 1KILA 3GG2A 3H32B 1N7SD 1LTIC 4XFJA 3V5BA 2YXRB 1RO2A 2GDXA 2H89C 1T2KD 2YMYA 2POHA 3R4YA 3BVHA 2YKQA 2D2CB 2KZIA 2FFDA 3MGNA 2WSFH 4M3LA 4PV1C 2W27A 2WT7B 5KLIC 2XU6A 1E6JP 2AXTH 4WY4A 2Z45A 1LTAC 1VQMP 3N4XA 1S9KE 3Q20A 2Q6QA 2NZ2A 5DCKA 2YIUB 3VOPA 3A0HH 1L0LG 1OXZA 4W7YA 3QH9A 1NTZJ 3AE2C 1WMKA 1X3OA 3L74J 1QEXA 3VP8A 4NPEA 3RBZA 4WYMA 4D6TG 3RL0B 3I5CA 3CMEP 3RK3D 3IFMA 3FXDA 1JJ2O 1RE4A 1M56D 5H2FE 2KSEA 1GW4A 4IL6X 1IZNB 3OW2O 3OAKA 3HZQA 1UIXA 2XZ1C 1GL2A 3Q5RA 4H2XC 1FZCC 4IFMA 1KMIZ 4GR2A 2IBZG 2BHVA 2ZXEB 1NTMK 2JGPA 2FAEA 3JCUH 4TLFA 2O1KA 2WPTA 3TGUG 4MRTC 2Q7CA 5CBOA 1SQVJ 3D70A 4WBAA 3TDKA 1KV4A 3E2DA 3QWOC 1HGZA 3CL3D 3H1JJ 2R5DA 3RG2A 2ZT9B 1A02F 2VRSA 1T2KC 2FFDB 4I7ZB 1S5LH 3C1LA 3EJDA 1RY3A 5AW5B 1QVFO 4H13D 3CC7P 1N7SA 2FYUJ 4OVNF 3II6A 2PAJA 1SQPJ 1NAYA 3G1GA 2VSQA 2PENA 3NTNA 2KNCA 2IDBA 4BPGA 4EOTA 1OVRA 4L74A 3L70G 3RK2D 1PEQA 1PP9E 1VPCA 4PV1B 2EHTA 5KLIB 3G6EP 3NTEA 3H1ID 2QJPC 1RF0C 3B5IA 5HVCA 4JYCA 4RKUJ 1UNKA 5AW7B 1HJBA 5GTHH 2JEEA 2Y9ZA 1SQQD 1L0NJ 1K8AQ 5CHXA 3H1KE 2O01J 4Y99C 4HKGA 1T3JA 1NU1G 1M90Q 3M9BA 2KW2A 3TNUB 2FADA 2E74D 2L91A 2E76D 2IZ1A 3UIAA 4PH1A 1M74A 3GHGC 3AE9C 3GLMA 5E79E 2EIAA 1MFTA 1PV3A 3KPEA 3L71D 1KB9H 1NTKG 2OYIA 4IL6E 4U0EA 1FZCB 4L76A 2EHSA 3LRYA 1ZLLA 1MZ9A 2AVAA 2O01N 2B87B 4U0AA 2Z5IA 3A2AA 3CX5I 3GHGA 5CBNA 1SQXD 1NYHA 2XZRA 2KK7A 3TGUE 1DEEG 1Y8AA 2WMMA 2WSSH 1FAVA 3EFFK 2JKVA 1JY3N 1VF5C 2QJYC 1PGOA 4H13C 2BUOA 2L22A 3AE4C 1RHZB 3MP7B 1USEA 4GR6A 4MN4C 3P8CE 1HGVA 3RG6C 2HYNA 3RK2C 3EWKA 2M5RA 2KS1A 3BRTB 2LKIA 2N1TC 2B88A 2RMZA 2KORA 2KXPB 3EFGA 3H1LJ 1S5LX 3CE7A 1WT6A 2I1JA 4OGQC 1EZVG 2ZAEB 2QJPB 1HJ0A 1IFIA 3CXHH 5F2KA 2KWLA 2QRXA 3HUSC 3RGUA 2MY5A 1T8KA 4PD4D 4Y99B 1LGHB 3L4FA 2FKWB 1RQVA 2A06G 4U3FE 3BCCD 5AW0B 2JYGA 1KC8Q 1NU1E 1F80D 2M5AA 1GPJA 1LT9A 3GHGB 3M9HA 3CMAP 5KLVG 2AXTE 2FYUD 2I1KA 4I1LA 2QE7H 4C7NA 3A0HE 3JSVC 1M6EX 2WSEH 3P7KA 2SPZA 3KXDA 3JC22 1M57D 2KLUA 2GM4A 5APSA 2P1JA 1BGYD 3CX5E 3H1HD 4BPHA 3B71A 1IJDB 2BCCG 3IAOA 3H4EA 5APYA 1KFMA 3FWLA 2K94A 1PP9J 2E42A 1USDA 2HFED 2WQYC 1CI6A 2BEZF 3CCUP 1VF5B 2LIWA 2QJYB 4H13B 2KS1B 2PEMA 1IFNA 3AEBC 2ERHA 2YNYA 5EJDA 2IX7C 1ZRTE 5HGMA 4LC1A 2C9LY 3RK2B 1SQBE 4AUWA 1JY2O 2L5GB 2JJLA 1OZHA 2PGDA 3L75D 1L0LJ 2MR7A 1X79B 3IN6A 5K5GB 4JYBA 3HTKB 1QL2A 1HUCA 1Y47A 1MV8A 2N1TB 4D6TJ 3F5HA 4BWNA 1LTJC 1BE3E 4OGQB 1S5LE 1PEMA 1KFNA 2OYOA 2LMLA 1E0HA 1OX3A 1N8RQ 1M1KQ 3HUSB 3IF4A 1RF1C 2CNRA 3MHVA 2L4BA 5JPAA 4C7NB 3AE7C 2K0XA 2NPSD 1LTJA 5AW8B 1GDTA 3M0DC 4UB6H 1S9KD 3TGUJ 1RNIA 4R4MA 2VLQA 4W80A 1OIPA 1KORA 1N2DC 2CQ8A 1FZFA 1RF1A 2CK3H 1NTZK 4PH0A 1Q2NA 4JF7A 3G1IA 4XROA 2FACA 1CI6B 3P32A 1IMPA 1Q81Q 3MTUE 3L74E 1J1EC 1FDIA 2XT1A 3V2QA 2BCCE 3NFQA 1NKNA 2GUSA 3L70J 1KLPA 1GMJA 2LIUA 1KILD 1SQVK 1JMBA 3U59A 5BS2A 2WSCJ 1IUQA 3FGAD 2C9NY 4H0LD 1YTZI 1PGPA 4EYYQ 1N73C 3DS5A 2QJKC 1Q82Q 1OW7A 1ZV8A 1SLQA 4U3FJ 1UIIA 4OWFA 2WSFJ 3AE8C 3C9IA 4IPYA 1NU1J 1SS1A 4GKGA 2Z44A 1SQVE 2WVRA 1LTJB 3LW5J 5APVA 2LL8A 4WVZA 3FXEA 1N73A 2JBGA 2FYUK 4U0DA 1SQPK 5KAIH 3M1MA 1U57A 3WUVA 1QVGO 5CMZA 2K3RA 1RF1B 2XDJA 3ZDMA 1ZNVA 4HJGH 2PY8A 2K9JA 2M8PA 4Z1MH 2A45G 1SQPE 2NPSA 4YTPC 2N5IA 1FOSE 1A8OA 1BCCG 1FDOA 2P2UA 5BS1A 2P67A 4IFFA 1XTGB 3H1KD 1Z6MA 1L0NK 2LOLA 3M0AA 3HE5A 4C7RA 2QEXP 2CPBA 5AW4B 3Q1MA 2Q5UA 1DEBA 2R3CA 1G2CA 1JUNA 1DIPA 4L75A 2ROQA 1YI2P 1CZQA 1CW5A
chains in the Genus database with same CATH topology
1K30A 2XT1A 4COCA 3DS3A 1VQNP 2PEQA 2BUOA 2BQ1E 3CCUP 2JYLA 3DS1A 2PEMA 1KQSO 1PEUA 4GR6A 1RO2A 1KD1Q 5HGOA 1VQ9P 1YJNP 1QVFO 3G29A 3CC7P 4M0IA 3RG6C 3I56P 1VQ8P 3HYBA 3G1GA 5HGMA 3CCLP 4XFZA 2PENA 2XXMA 5BS2A 3CCRP 1IUQA 3I55P 1YJWP 2PEOA 3G26A 1K9MQ 2OARA 3WBHA 3DPHA 3DS5A 2OTJP 1Q82Q 1PEQA 5HGLA 2PEKA 4U0CA 1E6JP 2Z45A 3G6EP 3NTEA 5F2OA 1VQMP 3CCEP 1PEOA 4IPYA 3DS0A 3Q20A 2Z44A 2KODA 3B5IA 3DS4A 3MGEA 3P05A 5DCKA 1VQOP 1A43A 1PEMA 4COPA 3CCSP 1S72P 3VRLC 2Z46A 5F2KA 1K8AQ 2P9XA 2XV6A 4U0DA 2PEIA 1EOQA 2L6EA 1VQPP 1N8RQ 1M1KQ 1K73Q 1M90Q 4WYMA 3M1MA 1QVGO 2QA4P 2DGYA 3CMEP 1JJ2O 5JPAA 3G21A 3H47A 4PH1A 3CCJP 1VQLP 1M74A 2JYGA 1KC8Q 3G0VA 4XFYA 3CC2P 2PY8A 1RNIA 2EIAA 5I4TG 3OW2O 3HZQA 2M8PA 3CMAP 1Q7YQ 4GR2A 3CCMP 2BHVA 1VQ4P 3CCVP 1RO0A 1AUMA 2JO0A 4U0EA 2PEJA 1A8OA 1VQ7P 5BS1A 1VQKP 3CPWO 3LRYA 4PH0A 4XFXA 2E1MA 1VQ6P 3CCQP 5F2NA 1NJIQ 3DTJA 3G1IA 4XROA 1W2BO 2LF4A 2M8LA 3G4SP 1YIJP 1M6EX 5HGNA 4U0AA 1YHQP 1BAJA 2QEXP 1YITP 2EG5A 3CXCO 3H0DA 2M8NA 1QRJA 1EIAA 1VQ5P 3E2DA 3G28A 2CWOA 4QNBA 1YJ9P 3G71P 2ONTA 3CD6P 1YI2P 3CC4P 2OTLP 1Q81Q 3H4EA 1D1DA 1Q86Q 3DS2A 2EFJA 4U0BA 1ZMBA 4U0FA 1M6NA 4XRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ P;  1Q82 Q;  1VQ6 P;  3CCQ P;  2QA4 P;  1QVG O;  1NJI Q;  3CME P;  3CCU P;  1W2B O;  1JJ2 O;  3G4S P;  1VQM P;  3G6E P;  1YIJ P;  3CCE P;  1KQS O;  1YHQ P;  2QEX P;  3CCJ P;  1VQL P;  1YIT P;  1KD1 Q;  1KC8 Q;  3CXC O;  1VQO P;  1VQ9 P;  1YJN P;  1QVF O;  3CC2 P;  1VQ5 P;  1M1K Q;  3CC7 P;  3OW2 O;  3I56 P;  1VQ8 P;  1YJ9 P;  3CCS P;  3G71 P;  1S72 P;  3CCL P;  3CMA P;  1YI2 P;  1Q7Y Q;  3CC4 P;  1Q81 Q;  3CD6 P;  2OTL P;  3CCR P;  1Q86 Q;  1K8A Q;  3CCM P;  1VQ4 P;  3I55 P;  3CCV P;  1YJW P;  1VQ7 P;  1K9M Q;  1VQP P;  1VQK P;  1N8R Q;  3CPW O;  1VQN P;  1K73 Q;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1J1E B;  1KIL C;  2K0D X;  1VQ9 P;  1OVU A;  1VL2 A;  1VQ8 P;  2K2Q A;  2XXM A;  3CCR P;  4TT3 H;  3I55 P;  1N73 B;  2QJK B;  2Y0E A;  1NTM G;  4CA3 A;  2W90 A;  3SWF A;  3EJB A;  3T97 A;  2WSC H;  4WY4 C;  2KYV A;  2KOD A;  1ACP A;  1FZG A;  2KOP A;  3P8C D;  2L0Q A;  1VDF A;  1H89 A;  2JB0 A;  2LPK A;  2KLV A;  2ZJS E;  2X2B A;  2KOS A;  4K3A A;  3KDP B;  2WPS A;  2QNW A;  2R3S A;  5KLV J;  3E1R A;  3LW5 H;  2LXC B;  5CCG D;  4DOJ A;  1U7J A;  3CC2 P;  1RE4 C;  2K88 A;  2K0Y A;  4RJT A;  3KZI H;  1LTS C;  3MUD A;  1NWQ A;  1JEK A;  3CCM P;  1GL2 C;  1G2C B;  5BU5 A;  2WPR A;  3HRN A;  2MVV A;  1HQB A;  5F2N A;  1SFC D;  2BCC J;  1W2B O;  1LJ2 A;  1YIJ P;  2LXB A;  2OQQ A;  2J59 M;  2GUV A;  3L73 G;  2V7Q H;  3H1L E;  1QRJ A;  1VQ5 P;  4N78 E;  2G3A A;  1BSN A;  3D6Z A;  3CD6 P;  2KZJ A;  2K1A A;  1EDJ A;  1RE3 C;  5AW1 B;  2PEQ A;  2BEQ D;  4UB6 E;  5KKZ C;  2HPC A;  2K5X A;  2IBZ I;  3L72 G;  1JY2 N;  1KQS O;  1KIL B;  1KD1 Q;  2P58 A;  2HOD A;  1Z56 A;  2Z5H A;  3T97 B;  3CX5 D;  1HVV A;  4XFZ A;  1RE3 A;  3CWB G;  4Y28 J;  1N7S C;  3Q5S A;  2PFX A;  3OA7 A;  5AW9 B;  4IFD K;  2Q9I A;  2PEK A;  4QMA A;  1IK9 A;  1FZB A;  4ASW A;  3L37 A;  5AW6 B;  1PPJ E;  4UB8 E;  2JWA A;  3PJS K;  4WY4 B;  1A43 A;  2E5Y A;  4EI2 A;  3V4W A;  1ZW0 A;  1ZRT D;  3Q3D A;  2Z4E A;  4BXL A;  1VQP P;  1SQB D;  2M8R A;  1IFD A;  1K73 Q;  2LKM A;  4XE5 B;  3MZW B;  2GYK A;  4YXD C;  2WTY A;  3AED C;  1L0L K;  1FC2 C;  2FQ2 A;  5GTI H;  3H25 A;  5KP8 B;  1ZR4 A;  3G0V A;  5AVQ B;  4R0M A;  1SVF A;  5I4T G;  2YXQ B;  1BE3 D;  5CCG A;  2J58 A;  3C8V A;  1X9V A;  4U7J A;  1W5C E;  3RK3 C;  4H44 D;  2OYI C;  2R32 A;  1GL2 B;  4HKZ H;  1L0L E;  4GOD A;  1R5L A;  1LP1 A;  1EXI A;  4PJ0 E;  1KYO H;  1Y9B A;  2M3B A;  1NO4 A;  2XV5 A;  4RES B;  2AEJ A;  2W83 C;  2IYP A;  1R5S A;  3VMY A;  5KAI E;  3P8M C;  1SFC A;  4D6T E;  1VKU A;  3M9Q A;  1P84 H;  1GK4 A;  2WSE J;  5TIS E;  2LTE A;  3L73 E;  2EFJ A;  3R2P A;  4U0F A;  1VQN P;  4JPZ B;  2KI7 B;  3L36 A;  1AFO A;  2L9F A;  1JB0 J;  5KKZ B;  2MD9 A;  2IBZ E;  1AQT A;  3AE6 C;  1YJN P;  2K37 A;  2JDI H;  3AE3 C;  1AA0 A;  5C39 A;  2PEO A;  1N7S B;  4YXW H;  3AE1 C;  1LTB C;  2KGA A;  1NTZ D;  4IZ6 A;  1EDK A;  3L74 D;  5EW5 E;  2KNC B;  2PNG A;  1DV5 A;  5F2O A;  1WRG A;  1LNQ A;  3DS4 A;  4I6M C;  2FVA A;  3VRL C;  4DJG A;  3CLQ A;  2P9X A;  2DW3 A;  3VMZ A;  2BAS A;  5AVY B;  2KOG A;  5CJ4 A;  1BCC J;  2M0B A;  2FQ1 A;  1GXH A;  4H44 C;  1LP1 B;  3L70 E;  2AXC A;  3H1I G;  1NU1 K;  5KP6 B;  2DNW A;  5AVZ B;  1SQV D;  2N9Y B;  3S9O A;  1ZP0 C;  1DX7 A;  1W2E A;  1LT9 C;  3GKL C;  1EZV I;  2OYH C;  2E74 C;  2E76 C;  3RK3 B;  3H1J D;  1SQQ G;  2OYI B;  1AV1 A;  1RH5 B;  2KG6 A;  1OMI A;  3A0B H;  3WU2 H;  1BDC A;  1AVO A;  2M8N A;  2VLN A;  4WWI A;  4JQ0 D;  1DD3 A;  2H7H A;  1D1D A;  5APT A;  2OYH A;  3CI9 A;  1SQP D;  5DJU B;  2N6Z A;  3L71 G;  1GU5 A;  4UHP B;  5KJ7 A;  2NRG A;  3NXS A;  2KGE A;  1EDI A;  5KAF H;  1NTK E;  4ZKP A;  1PFI A;  2FQ0 A;  5HV8 A;  3GZL A;  1NTM J;  3A3Y B;  2MF4 A;  1KYO I;  2K92 A;  5EFW B;  4ZKU A;  1E5W A;  1SQX G;  2YMK A;  1IFP A;  2ZYD A;  4O9B A;  1SQB K;  1L0N D;  1P84 I;  3E1I A;  3KQG A;  3WMM 0;  1KB9 I;  2IFN A;  1GTW A;  5AVU B;  1NTZ G;  2JU2 A;  1T3U A;  3V6I A;  7CEI A;  2FVE A;  3G3Z A;  3JCU E;  2Z46 A;  1EXJ A;  2QM7 A;  4F37 A;  1OW6 A;  2FBW C;  2KUB A;  1EC5 A;  2E75 D;  3B5N D;  1MFZ A;  2J5U A;  1OVV A;  2ZXX A;  2GZG A;  3VN0 A;  4XFY A;  2KIK A;  1M1J A;  1H88 A;  4H44 B;  1Q7Y Q;  2A45 H;  5KP7 B;  1PIX A;  3L73 J;  1RO0 A;  2M5A B;  1KTM A;  3CPW O;  1LT9 B;  1EZV E;  2OYH B;  2E74 B;  4BRY A;  2E76 B;  3H1J G;  3AEF C;  3GW6 A;  1N7L A;  1NAF A;  1SQQ E;  3L72 J;  3BCC G;  2A06 E;  3M06 A;  5TJH A;  2XNX A;  3U1A A;  1NKZ B;  2YO3 A;  2FYU G;  2BQ1 E;  3CWB J;  3CXH I;  2N98 A;  3DS1 A;  5KLV E;  1PEU A;  2IZ0 A;  5GTH E;  1BXI A;  3WUU A;  1L4A D;  1MZ8 A;  1LWU A;  3H1L D;  1A02 J;  1GXG A;  4N78 D;  2NO8 A;  2AFD A;  1JY2 P;  1KYO E;  1BGY G;  3EQ2 A;  3H1H G;  4DZO A;  1TU3 F;  2OAR A;  1K04 A;  3DPH A;  2B9B A;  4YPC A;  2HG5 D;  1NOH A;  1P84 E;  2V4H A;  3RL0 D;  1PEO A;  1L0N G;  1KB9 E;  2ZVO B;  3MGE A;  1VQO P;  2H8P D;  5B5E H;  2E75 C;  3B5N C;  1HTL C;  2KP8 A;  5CCH D;  1RQU A;  5APW A;  3AEE C;  2GZJ A;  1JTH A;  1GW3 A;  2RKL A;  2ZFC A;  3G21 A;  3L75 G;  1R8E A;  1VQL P;  1PPJ D;  3O8Z A;  3O6Q A;  1J1D C;  3B5N A;  2GDY A;  4NEO A;  1IFM A;  4KJM A;  2JO0 A;  4EDF A;  3F89 A;  1YTZ T;  1M8O B;  3HD7 D;  2NPS C;  3VMA A;  1VQ6 P;  1NJI Q;  3DTJ A;  2ZVN B;  1NTK J;  1PP9 D;  5HGN A;  4H2W C;  1YHQ P;  1URQ D;  2EG5 A;  3ITK A;  3H0D A;  3AE5 C;  1JY3 O;  1KZU B;  3D71 A;  2V7Q J;  5E79 H;  3VTP C;  1OW8 A;  4XRQ A;  1OFC X;  4COC A;  2KG8 A;  1L4A C;  2JQ4 A;  2FYN C;  2A45 I;  3TSI A;  3BCC E;  1L0L D;  2Y0D A;  3CXH E;  5HGO A;  3LMO A;  3GJN A;  3I56 P;  1FZA A;  4D6T D;  3TF5 A;  2QVA A;  3RL0 C;  3A0B E;  1L4A A;  1D7M A;  3WU2 E;  2OTJ P;  2FVF A;  4GIF A;  1AJY A;  1S1C X;  1JTH B;  4A7P A;  5CCH C;  2O3J A;  2R5B A;  2IBZ D;  3LID A;  4H0L C;  1YYC A;  4COP A;  1IFJ A;  1Q90 D;  1GD2 E;  3AEG C;  2E75 B;  3O6Q B;  5KAF E;  3TGU D;  3B5N B;  2XV6 A;  2L6E A;  1MUU A;  3H1I J;  3AEC C;  5AW2 B;  1T6A A;  1DD4 A;  2QIW A;  1FJP A;  5CCH A;  3CCJ P;  1FR2 A;  3A7O A;  1SQQ J;  3HD7 C;  2FXM A;  1J1D B;  3L75 E;  3MUD C;  1UJZ A;  2K9J B;  1URQ C;  4XFX A;  1ZXG A;  3CCQ P;  2NPS B;  2LF4 A;  1J2J B;  3B4Q A;  3LIE A;  4B86 A;  3HD7 A;  3L71 J;  3CXC O;  5CJ0 A;  2AF8 A;  1PP9 G;  2HR3 A;  3HE5 B;  3Q2Y A;  3NY7 B;  3G71 P;  3L70 D;  1VHN A;  1YQ4 C;  1X0T A;  3N7N A;  2W8Z A;  5APQ A;  1URQ A;  3B4S A;  3GF3 A;  1M6N A;  1HWT C;  1S4X A;  2QG4 A;  1SQX J;  1L4A B;  4C46 A;  3KYQ A;  2FYN B;  2CG5 B;  3H1K G;  3SFE C;  3Q5P A;  2AFE A;  3B8E B;  2W6A A;  1BCC E;  2RN0 A;  1QL1 A;  4U3F D;  2KOO A;  4W7Z A;  3A5T A;  3HYB A;  2JR8 A;  1NU1 D;  2P10 A;  5M1B A;  3W67 A;  2Q3I A;  5AVX B;  3U1C A;  3CX5 H;  2WIT A;  3PLN A;  2FXP A;  4R4L A;  1OWA A;  5DJT B;  1T8Z A;  5B66 H;  1NTK D;  1E79 H;  1AQ5 A;  1G1J A;  2JO1 A;  4H0L B;  1CEI A;  4L73 A;  3HE4 A;  3GZM A;  3S1K A;  1SP4 A;  3TNU A;  1H0T A;  1PZQ A;  2XND H;  3FX0 A;  1QLE D;  5AVR B;  1KIL E;  1AVY A;  2K9Y A;  1FZC A;  1HH0 A;  1FDM A;  3PH0 A;  3HD7 B;  1L0I A;  1NTM E;  1IK7 A;  1VQ4 P;  2B87 A;  3S4R A;  4DT0 A;  1VQ7 P;  3WUT A;  5CCG C;  2E43 A;  5B5E E;  3BCC J;  1URQ B;  2FY8 A;  1VF5 D;  1JCC A;  4GOE A;  3GMA A;  4OH8 B;  1SFC C;  3CC4 P;  1Q86 Q;  2KGD A;  2W6J H;  3M91 A;  3NMD A;  3ABV C;  4I2L C;  3DS2 A;  2KOQ A;  1KN7 A;  3VYI A;  1N86 A;  4XA4 A;  5AW3 B;  4ZMD A;  1EZV D;  2VLP A;  1BGY J;  3H1H J;  2OGU A;  1YQ3 C;  1FZE A;  2HPC B;  3G29 A;  2N1T D;  2ITA A;  2N6Y A;  4OGQ D;  3USS A;  4U3F G;  5KJ7 D;  2C0W A;  2HOD B;  2A06 D;  2HLO A;  2Q3E A;  3WBH A;  2MJZ A;  4EIJ A;  3HE4 B;  1IO4 A;  4HH2 A;  1ZOY C;  3OJA B;  4U0C A;  2N50 A;  1H0T B;  1G1I A;  1LTT C;  1RF0 A;  2GDW A;  1JM0 A;  5KLV D;  1L2P A;  2MVU A;  4PXH B;  1LT1 A;  3L75 J;  2QSI A;  1QX8 A;  3L72 E;  1L0H A;  1EOQ A;  2K93 A;  1PGQ A;  3K5B A;  4N6J A;  1KYO D;  4RO0 A;  2QA4 P;  2DGY A;  4LLH A;  5BVZ A;  2YKO A;  2R44 A;  3CWB E;  1FS0 E;  1P84 D;  4GOF A;  2BCC D;  3V2P A;  2CGQ A;  1KB9 D;  1KQG B;  4PWV B;  1AUM A;  3TYY A;  2ZYA A;  1X8Y A;  2E1M A;  3SWK A;  3L35 A;  4KHX A;  1SQB G;  4PD4 H;  5APU A;  2ONT A;  1NGM B;  1HBW A;  1SFC B;  1KQL A;  1BE3 G;  4ZNC A;  1OR5 A;  2XKM A;  2JYL A;  3G9R A;  1NVO A;  2M3E A;  5KJ7 C;  2IPP A;  1EMV A;  1NTK K;  4M0I A;  4NPF X;  4DG9 A;  1S3J A;  1BDD A;  2IYO A;  1ZME C;  3HTK A;  1YJW P;  3TK1 A;  1K9M Q;  2YO2 A;  2N1T A;  4KT0 J;  3RK3 E;  2C0X A;  1AF8 A;  3D6Y A;  3KZI E;  2N9B A;  3SWY A;  2PRR A;  4H2Y C;  2O01 H;  2E5T A;  3CXH D;  2WWW A;  1XTC C;  3HUS A;  2W6B A;  3AEA C;  4GT1 A;  1NQ4 A;  2XZ0 D;  1JNM A;  4NPD A;  3MD0 A;  1GK6 A;  2JWD A;  3PHL A;  3GF7 A;  2JP3 A;  5AVV B;  2JU1 A;  3L74 G;  2N5H A;  5KTB A;  2KSJ A;  1EQ7 A;  3PP5 A;  1M1J C;  2GA1 A;  2OTK E;  2PEJ A;  3V4Q A;  5B66 E;  5AVW B;  1BAJ A;  1YIT P;  1IC2 A;  3G28 A;  3H1K J;  2KGC A;  2OTL P;  1PL5 A;  1SQQ K;  4LGD E;  4N3Y B;  1HF9 A;  1SQV G;  3DS3 A;  3H1I E;  4IOI H;  1MKM A;  5AVS B;  2KG9 A;  2P7J A;  3BAT A;  5KLV K;  5APX A;  5AVT B;  4AYC A;  2FHS C;  1FJK A;  2AEM A;  3V2N A;  4PD4 I;  2Y0C A;  3CCL P;  1S2E A;  1LWU C;  5L8R J;  3IR9 A;  5H2F H;  2KR5 A;  2D2C D;  1NH4 A;  5GTI E;  5HGL A;  1FOS F;  3VP9 A;  1SQP G;  5BU8 B;  4JBZ A;  1JMM A;  3E7K A;  2RH0 A;  3DS0 A;  1SQX K;  3P05 A;  1DNY A;  1ZN5 A;  3L71 E;  1BCC D;  4HB1 A;  1HY8 A;  1QGK B;  1H8A A;  4DCK A;  5CZD B;  3BRV B;  3M0D A;  1JOC A;  3V2R A;  1SQX E;  2Y9Y A;  4BPF A;  1DH3 A;  2H88 C;  4UB8 H;  1CSB A;  2QM8 A;  2O1J A;  3RBX A;  1NTZ E;  3CCV P;  2FXO A;  1M1J B;  2ZYG A;  3PTZ A;  1U7M A;  2M8L A;  3VMX A;  4BRY B;  1LTG C;  1PGJ A;  2PP6 A;  2AEF A;  1EIA A;  2CWO A;  3FWN A;  3SFD C;  2WPV B;  2FYZ A;  3PRJ A;  1NTM D;  2UWJ E;  3H6P A;  1K30 A;  3RL0 g;  2ZT9 D;  2GZF A;  4WB4 A;  4QKO A;  2GZI A;  1YBK A;  4ASV A;  1FU1 A;  4GDO A;  2D2C C;  3U43 A;  4PJ0 H;  1X22 A;  4WY4 D;  3H1J E;  1AYI A;  3H32 A;  4PD4 E;  2I8D A;  3G26 A;  1LWU B;  1GU4 A;  5TIS H;  2GZE A;  1JCD A;  3BAS A;  3CCE P;  4IL6 H;  1IMQ A;  2MR8 A;  2YIU C;  2G8Y A;  4PV1 D;  2WPQ A;  1GZL A;  1ZR2 A;  2FYU E;  3CCS P;  1S72 P;  3W68 A;  2VLO A;  2WT7 A;  2WZ7 A;  3KHU A;  3H1L G;  2PEI A;  2YKP A;  1M7L A;  3L73 D;  4K35 A;  4CPG A;  1GL2 D;  2JAZ A;  4HYT B;  3H47 A;  1K05 A;  1BSH A;  1BGY E;  3H1H E;  2IFM A;  2CPS A;  4AQR D;  2MKV A;  3MIW A;  1SQB J;  1L0N E;  2Q1K A;  1VQK P;  3L72 D;  1KQF B;  2B89 A;  1NHL A;  3G4S P;  2LR2 A;  1JO5 A;  1BE3 J;  3CWB D;  1EDL A;  1JY3 P;  1FE6 A;  3SSU A;  2KB7 P;  4QNB A;  1FBM A;  1YJ9 P;  2ZT9 C;  1PPJ G;  2H43 A;  2FFD C;  4U0B A;  3EJE A;  4I7Z C;  1ZMB A;  1KIL A;  3GG2 A;  3H32 B;  1N7S D;  1LTI C;  4XFJ A;  3V5B A;  2YXR B;  1RO2 A;  2GDX A;  2H89 C;  1T2K D;  2YMY A;  2POH A;  3R4Y A;  3BVH A;  2YKQ A;  2D2C B;  2KZI A;  2FFD A;  3MGN A;  2WSF H;  4M3L A;  4PV1 C;  2W27 A;  2WT7 B;  5KLI C;  2XU6 A;  1E6J P;  2AXT H;  4WY4 A;  2Z45 A;  1LTA C;  1VQM P;  3N4X A;  1S9K E;  3Q20 A;  2Q6Q A;  2NZ2 A;  5DCK A;  2YIU B;  3VOP A;  3A0H H;  1L0L G;  1OXZ A;  4W7Y A;  3QH9 A;  1NTZ J;  3AE2 C;  1WMK A;  1X3O A;  3L74 J;  1QEX A;  3VP8 A;  4NPE A;  3RBZ A;  4WYM A;  4D6T G;  3RL0 B;  3I5C A;  3CME P;  3RK3 D;  3IFM A;  3FXD A;  1JJ2 O;  1RE4 A;  1M56 D;  5H2F E;  2KSE A;  1GW4 A;  4IL6 X;  1IZN B;  3OW2 O;  3OAK A;  3HZQ A;  1UIX A;  2XZ1 C;  1GL2 A;  3Q5R A;  4H2X C;  1FZC C;  4IFM A;  1KMI Z;  4GR2 A;  2IBZ G;  2BHV A;  2ZXE B;  1NTM K;  2JGP A;  2FAE A;  3JCU H;  4TLF A;  2O1K A;  2WPT A;  3TGU G;  4MRT C;  2Q7C A;  5CBO A;  1SQV J;  3D70 A;  4WBA A;  3TDK A;  1KV4 A;  3E2D A;  3QWO C;  1HGZ A;  3CL3 D;  3H1J J;  2R5D A;  3RG2 A;  2ZT9 B;  1A02 F;  2VRS A;  1T2K C;  2FFD B;  4I7Z B;  1S5L H;  3C1L A;  3EJD A;  1RY3 A;  5AW5 B;  1QVF O;  4H13 D;  3CC7 P;  1N7S A;  2FYU J;  4OVN F;  3II6 A;  2PAJ A;  1SQP J;  1NAY A;  3G1G A;  2VSQ A;  2PEN A;  3NTN A;  2KNC A;  2IDB A;  4BPG A;  4EOT A;  1OVR A;  4L74 A;  3L70 G;  3RK2 D;  1PEQ A;  1PP9 E;  1VPC A;  4PV1 B;  2EHT A;  5KLI B;  3G6E P;  3NTE A;  3H1I D;  2QJP C;  1RF0 C;  3B5I A;  5HVC A;  4JYC A;  4RKU J;  1UNK A;  5AW7 B;  1HJB A;  5GTH H;  2JEE A;  2Y9Z A;  1SQQ D;  1L0N J;  1K8A Q;  5CHX A;  3H1K E;  2O01 J;  4Y99 C;  4HKG A;  1T3J A;  1NU1 G;  1M90 Q;  3M9B A;  2KW2 A;  3TNU B;  2FAD A;  2E74 D;  2L91 A;  2E76 D;  2IZ1 A;  3UIA A;  4PH1 A;  1M74 A;  3GHG C;  3AE9 C;  3GLM A;  5E79 E;  2EIA A;  1MFT A;  1PV3 A;  3KPE A;  3L71 D;  1KB9 H;  1NTK G;  2OYI A;  4IL6 E;  4U0E A;  1FZC B;  4L76 A;  2EHS A;  3LRY A;  1ZLL A;  1MZ9 A;  2AVA A;  2O01 N;  2B87 B;  4U0A A;  2Z5I A;  3A2A A;  3CX5 I;  3GHG A;  5CBN A;  1SQX D;  1NYH A;  2XZR A;  2KK7 A;  3TGU E;  1DEE G;  1Y8A A;  2WMM A;  2WSS H;  1FAV A;  3EFF K;  2JKV A;  1JY3 N;  1VF5 C;  2QJY C;  1PGO A;  4H13 C;  2BUO A;  2L22 A;  3AE4 C;  1RHZ B;  3MP7 B;  1USE A;  4GR6 A;  4MN4 C;  3P8C E;  1HGV A;  3RG6 C;  2HYN A;  3RK2 C;  3EWK A;  2M5R A;  2KS1 A;  3BRT B;  2LKI A;  2N1T C;  2B88 A;  2RMZ A;  2KOR A;  2KXP B;  3EFG A;  3H1L J;  1S5L X;  3CE7 A;  1WT6 A;  2I1J A;  4OGQ C;  1EZV G;  2ZAE B;  2QJP B;  1HJ0 A;  1IFI A;  3CXH H;  5F2K A;  2KWL A;  2QRX A;  3HUS C;  3RGU A;  2MY5 A;  1T8K A;  4PD4 D;  4Y99 B;  1LGH B;  3L4F A;  2FKW B;  1RQV A;  2A06 G;  4U3F E;  3BCC D;  5AW0 B;  2JYG A;  1KC8 Q;  1NU1 E;  1F80 D;  2M5A A;  1GPJ A;  1LT9 A;  3GHG B;  3M9H A;  3CMA P;  5KLV G;  2AXT E;  2FYU D;  2I1K A;  4I1L A;  2QE7 H;  4C7N A;  3A0H E;  3JSV C;  1M6E X;  2WSE H;  3P7K A;  2SPZ A;  3KXD A;  3JC2 2;  1M57 D;  2KLU A;  2GM4 A;  5APS A;  2P1J A;  1BGY D;  3CX5 E;  3H1H D;  4BPH A;  3B71 A;  1IJD B;  2BCC G;  3IAO A;  3H4E A;  5APY A;  1KFM A;  3FWL A;  2K94 A;  1PP9 J;  2E42 A;  1USD A;  2HFE D;  2WQY C;  1CI6 A;  2BEZ F;  3CCU P;  1VF5 B;  2LIW A;  2QJY B;  4H13 B;  2KS1 B;  2PEM A;  1IFN A;  3AEB C;  2ERH A;  2YNY A;  5EJD A;  2IX7 C;  1ZRT E;  5HGM A;  4LC1 A;  2C9L Y;  3RK2 B;  1SQB E;  4AUW A;  1JY2 O;  2L5G B;  2JJL A;  1OZH A;  2PGD A;  3L75 D;  1L0L J;  2MR7 A;  1X79 B;  3IN6 A;  5K5G B;  4JYB A;  3HTK B;  1QL2 A;  1HUC A;  1Y47 A;  1MV8 A;  2N1T B;  4D6T J;  3F5H A;  4BWN A;  1LTJ C;  1BE3 E;  4OGQ B;  1S5L E;  1PEM A;  1KFN A;  2OYO A;  2LML A;  1E0H A;  1OX3 A;  1N8R Q;  1M1K Q;  3HUS B;  3IF4 A;  1RF1 C;  2CNR A;  3MHV A;  2L4B A;  5JPA A;  4C7N B;  3AE7 C;  2K0X A;  2NPS D;  1LTJ A;  5AW8 B;  1GDT A;  3M0D C;  4UB6 H;  1S9K D;  3TGU J;  1RNI A;  4R4M A;  2VLQ A;  4W80 A;  1OIP A;  1KOR A;  1N2D C;  2CQ8 A;  1FZF A;  1RF1 A;  2CK3 H;  1NTZ K;  4PH0 A;  1Q2N A;  4JF7 A;  3G1I A;  4XRO A;  2FAC A;  1CI6 B;  3P32 A;  1IMP A;  1Q81 Q;  3MTU E;  3L74 E;  1J1E C;  1FDI A;  2XT1 A;  3V2Q A;  2BCC E;  3NFQ A;  1NKN A;  2GUS A;  3L70 J;  1KLP A;  1GMJ A;  2LIU A;  1KIL D;  1SQV K;  1JMB A;  3U59 A;  5BS2 A;  2WSC J;  1IUQ A;  3FGA D;  2C9N Y;  4H0L D;  1YTZ I;  1PGP A;  4EYY Q;  1N73 C;  3DS5 A;  2QJK C;  1Q82 Q;  1OW7 A;  1ZV8 A;  1SLQ A;  4U3F J;  1UII A;  4OWF A;  2WSF J;  3AE8 C;  3C9I A;  4IPY A;  1NU1 J;  1SS1 A;  4GKG A;  2Z44 A;  1SQV E;  2WVR A;  1LTJ B;  3LW5 J;  5APV A;  2LL8 A;  4WVZ A;  3FXE A;  1N73 A;  2JBG A;  2FYU K;  4U0D A;  1SQP K;  5KAI H;  3M1M A;  1U57 A;  3WUV A;  1QVG O;  5CMZ A;  2K3R A;  1RF1 B;  2XDJ A;  3ZDM A;  1ZNV A;  4HJG H;  2PY8 A;  2K9J A;  2M8P A;  4Z1M H;  2A45 G;  1SQP E;  2NPS A;  4YTP C;  2N5I A;  1FOS E;  1A8O A;  1BCC G;  1FDO A;  2P2U A;  5BS1 A;  2P67 A;  4IFF A;  1XTG B;  3H1K D;  1Z6M A;  1L0N K;  2LOL A;  3M0A A;  3HE5 A;  4C7R A;  2QEX P;  2CPB A;  5AW4 B;  3Q1M A;  2Q5U A;  1DEB A;  2R3C A;  1G2C A;  1JUN A;  1DIP A;  4L75 A;  2ROQ A;  1YI2 P;  1CZQ A;  1CW5 A; 
#chains in the Genus database with same CATH homology
 1K30 A;  2XT1 A;  4COC A;  3DS3 A;  1VQN P;  2PEQ A;  2BUO A;  2BQ1 E;  3CCU P;  2JYL A;  3DS1 A;  2PEM A;  1KQS O;  1PEU A;  4GR6 A;  1RO2 A;  1KD1 Q;  5HGO A;  1VQ9 P;  1YJN P;  1QVF O;  3G29 A;  3CC7 P;  4M0I A;  3RG6 C;  3I56 P;  1VQ8 P;  3HYB A;  3G1G A;  5HGM A;  3CCL P;  4XFZ A;  2PEN A;  2XXM A;  5BS2 A;  3CCR P;  1IUQ A;  3I55 P;  1YJW P;  2PEO A;  3G26 A;  1K9M Q;  2OAR A;  3WBH A;  3DPH A;  3DS5 A;  2OTJ P;  1Q82 Q;  1PEQ A;  5HGL A;  2PEK A;  4U0C A;  1E6J P;  2Z45 A;  3G6E P;  3NTE A;  5F2O A;  1VQM P;  3CCE P;  1PEO A;  4IPY A;  3DS0 A;  3Q20 A;  2Z44 A;  2KOD A;  3B5I A;  3DS4 A;  3MGE A;  3P05 A;  5DCK A;  1VQO P;  1A43 A;  1PEM A;  4COP A;  3CCS P;  1S72 P;  3VRL C;  2Z46 A;  5F2K A;  1K8A Q;  2P9X A;  2XV6 A;  4U0D A;  2PEI A;  1EOQ A;  2L6E A;  1VQP P;  1N8R Q;  1M1K Q;  1K73 Q;  1M90 Q;  4WYM A;  3M1M A;  1QVG O;  2QA4 P;  2DGY A;  3CME P;  1JJ2 O;  5JPA A;  3G21 A;  3H47 A;  4PH1 A;  3CCJ P;  1VQL P;  1M74 A;  2JYG A;  1KC8 Q;  3G0V A;  4XFY A;  3CC2 P;  2PY8 A;  1RNI A;  2EIA A;  5I4T G;  3OW2 O;  3HZQ A;  2M8P A;  3CMA P;  1Q7Y Q;  4GR2 A;  3CCM P;  2BHV A;  1VQ4 P;  3CCV P;  1RO0 A;  1AUM A;  2JO0 A;  4U0E A;  2PEJ A;  1A8O A;  1VQ7 P;  5BS1 A;  1VQK P;  3CPW O;  3LRY A;  4PH0 A;  4XFX A;  2E1M A;  1VQ6 P;  3CCQ P;  5F2N A;  1NJI Q;  3DTJ A;  3G1I A;  4XRO A;  1W2B O;  2LF4 A;  2M8L A;  3G4S P;  1YIJ P;  1M6E X;  5HGN A;  4U0A A;  1YHQ P;  1BAJ A;  2QEX P;  1YIT P;  2EG5 A;  3CXC O;  3H0D A;  2M8N A;  1QRJ A;  1EIA A;  1VQ5 P;  3E2D A;  3G28 A;  2CWO A;  4QNB A;  1YJ9 P;  3G71 P;  2ONT A;  3CD6 P;  1YI2 P;  3CC4 P;  2OTL P;  1Q81 Q;  3H4E A;  1D1D A;  1Q86 Q;  3DS2 A;  2EFJ A;  4U0B A;  1ZMB A;  4U0F A;  1M6N A;  4XRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...