2M5RA

Solution structure of holo-acyl carrier protein of leishmania major
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'MNDVLTRVLEVVKNFEKVDASKVTPESHFVKDLGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structures of the apo- and holo- forms of the acyl carrier protein of Leishmania major
rcsb
source organism Leishmania major
molecule tags Lipid binding protein
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2m5rA00
2LOLA 2KGAA 2LKIA 2JGPA 1L0HA 2KWLA 2K92A 4H2XC 2N5HA 3LMOA 2FQ0A 2LL8A 2CGQA 4PWVB 4BPGA 3EJBA 2KOSA 2GDWA 1KLPA 4IZ6A 3RG2A 1AF8A 5KP8B 2LIWA 2CG5B 2AVAA 2GDXA 2L4BA 2FACA 2VSQA 4HKGA 2MD9A 2MR8A 2CNRA 2QNWA 2FHSC 3CE7A 2JU1A 2FVEA 4MRTC 1DV5A 2L22A 1OR5A 2FADA 2N6ZA 2AFEA 2KGCA 2K0YA 2LTEA 1NQ4A 2M5RA 2N6YA 5CZDB 5KP6B 2FVAA 2AF8A 4BPHA 2L0QA 2FAEA 2MVUA 2DNWA 2GDYA 2KOOA 5EJDA 2FVFA 1F80D 2KW2A 2MY5A 4H2YC 2K2QA 5KP7B 2EHTA 1HQBA 5HVCA 4CA3A 1HY8A 2LMLA 4BPFA 3GZMA 2MR7A 2KGDA 4H2WC 3NY7B 3EJEA 2JQ4A 2MVVA 1L0IA 3EJDA 2N98A 3GZLA 1DNYA 2KGEA 2K0XA 1X3OA 2N5IA 1T8KA 2CQ8A 2FQ2A 2LIUA 2KG6A 2KR5A 2XZ0D 2K93A 2K94A 2KOPA 2XZ1C 4PXHB 2KG9A 2KORA 2FQ1A 2AFDA 2KOQA 2LPKA 2JU2A 1ACPA 2L9FA 2X2BA 2N50A 2EHSA 2KG8A 2PNGA 5HV8A 2ROQA 4DG9A 4NEOA 1VKUA 2MF4A 4R0MA
chains in the Genus database with same CATH superfamily
1M90Q 2JGPA 5HGMA 2KWLA 4BPGA 2BHVA 1KLPA 3G4SP 4IZ6A 3CCMP 2Z44A 2CG5B 2ERHA 3G1GA 1ZMBA 3G6EP 2PEOA 2JU1A 1DV5A 3DS2A 3I56P 4U0CA 1RNIA 3CMAP 3G28A 3WBHA 2EFJA 2AF8A 1YHQP 4IPYA 1D1DA 2L0QA 4QNBA 2GDYA 2FVFA 1KC8Q 2MY5A 1YIJP 3U43A 4H2YC 2K2QA 2PEIA 5HVCA 2MR7A 1VQLP 4H2WC 3NY7B 3MGEA 1EMVA 1Z6MA 2GZJA 5F2NA 1ZNVA 2GZFA 4WYMA 2KGEA 1VHNA 1YJ9P 1VQKP 4XFYA 2KG6A 5F2OA 4U0EA 1M6NA 2K93A 2KOPA 4PXHB 2KG9A 2KORA 1A43A 1VQPP 2JYGA 2KOQA 2LPKA 1ACPA 1MZ8A 2N50A 2QEXP 4DG9A 3H47A 5EJDA 4R0MA 1GPJA 2KODA 2LOLA 2KGAA 2LKIA 2ONTA 1QRJA 2PY8A 1IUQA 2LF4A 2FQ0A 2BUOA 5HGNA 1KD1Q 3EJBA 1Q7YQ 3CC2P 2GDWA 3LRYA 3CCLP 1YJNP 2VLOA 1BAJA 4U0FA 2L4BA 1Q86Q 3GJNA 3CC7P 2WPTA 3CPWO 3H0DA 2MR8A 2VLPA 2M8LA 2FHSC 3CE7A 2M8NA 1KQSO 1QVFO 2L6EA 4MRTC 5BS1A 1VQ7P 2AFEA 2KGCA 2K0YA 2LTEA 1NQ4A 3OW2O 5KP6B 2FVAA 3NTEA 4BPHA 2FAEA 2MVUA 3H4EA 3HYBA 1JJ2O 2KW2A 1NJIQ 2EHTA 1AUMA 1HY8A 4U0DA 4XFXA 2Z45A 1S72P 2PENA 2OTJP 1W2BO 3CMEP 2MVVA 2N98A 3VRLC 4XRQA 2JYLA 2JO0A 1T8KA 2CQ8A 2PEMA 2FQ2A 1UJZA 3CCRP 4XFZA 3G26A 2XZ1C 1E0HA 3DS5A 4U0BA 2PEQA 2FQ1A 2CWOA 2OTLP 2GZEA 2EG5A 5HGLA 2X2BA 2EHSA 4PH1A 3E2DA 3DS1A 7CEIA 1YJWP 1VKUA 4H2XC 2K92A 2N5HA 3LMOA 2CGQA 1K73Q 5KP8B 3G71P 3Q20A 1VQOP 2VSQA 4HKGA 1UNKA 2MD9A 4COCA 2L22A 1OR5A 3DS3A 2PEJA 4QKOA 3CCEP 3CCJP 1VQNP 2N6YA 5CZDB 1VQ5P 2EIAA 5F2KA 1AYIA 2JAZA 1BXIA 4GR2A 1FR2A 2Z46A 5JPAA 1EIAA 1Q82Q 3G0VA 4BPFA 1N8RQ 2JB0A 3CC4P 2KGDA 1K9MQ 3EJEA 3CXCO 3CCVP 3EJDA 2DGYA 3GZLA 1VQ8P 1VQ6P 3CCUP 2LIUA 3M1MA 2XZ0D 3CCQP 2GZIA 2L9FA 1YITP 3HZQA 1K8AQ 2KG8A 2PNGA 3DPHA 5KP7B 2MF4A 5EW5E 1VQMP 1L0HA 5BS2A 1M1KQ 3I55P 2LL8A 4PWVB 2JBGA 2KOSA 3G21A 3RG2A 4M0IA 1AF8A 2P9XA 3RG6C 2VLNA 2LIWA 2K0DX 2AVAA 3GKLC 1M74A 2GDXA 2FACA 2XT1A 4UHPB 2CNRA 3P05A 1VQ4P 1VQ9P 2QNWA 1GXHA 3G29A 2FVEA 2FADA 2N6ZA 1K30A 2M5RA 2GYKA 5HGOA 3B4QA 4U0AA 1M6EX 3G1IA 2DNWA 1Q81Q 2K5XA 2PEKA 2NO8A 2KOOA 1QVGO 1F80D 5I4TG 1CEIA 1RO2A 2M8PA 1HQBA 4COPA 4CA3A 1IMQA 3DS4A 2LMLA 3GZMA 2XV6A 5DCKA 4GR6A 3DTJA 2E1MA 2JQ4A 3DS0A 1L0IA 1DNYA 2K0XA 1X3OA 2N5IA 3CD6P 3CCSP 2QA4P 1EOQA 1YI2P 2KR5A 1GXGA 2K94A 2GZGA 4PH0A 2VLQA 3B5IA 2AFDA 4XROA 2XXMA 1A8OA 2JU2A 1E6JP 5HV8A 1RO0A 2ROQA 2OARA 1IMPA 4NEOA 4F37A
chains in the Genus database with same CATH topology
2LOLA 2KGAA 2LKIA 2JGPA 1L0HA 2KWLA 2K92A 4H2XC 2N5HA 3LMOA 2FQ0A 2LL8A 2CGQA 4PWVB 4BPGA 3EJBA 2KOSA 2GDWA 1KLPA 4IZ6A 3RG2A 1AF8A 5KP8B 2LIWA 2CG5B 2AVAA 2GDXA 2L4BA 2FACA 2VSQA 4HKGA 2MD9A 2MR8A 2CNRA 2QNWA 2FHSC 3CE7A 2JU1A 2FVEA 4MRTC 1DV5A 2L22A 1OR5A 2FADA 2N6ZA 2AFEA 2KGCA 2K0YA 2LTEA 1NQ4A 2M5RA 2N6YA 5CZDB 5KP6B 2FVAA 2AF8A 4BPHA 2L0QA 2FAEA 2MVUA 2DNWA 2GDYA 2KOOA 5EJDA 2FVFA 1F80D 2KW2A 2MY5A 4H2YC 2K2QA 5KP7B 2EHTA 1HQBA 5HVCA 4CA3A 1HY8A 2LMLA 4BPFA 3GZMA 2MR7A 2KGDA 4H2WC 3NY7B 3EJEA 2JQ4A 2MVVA 1L0IA 3EJDA 2N98A 3GZLA 1DNYA 2KGEA 2K0XA 1X3OA 2N5IA 1T8KA 2CQ8A 2FQ2A 2LIUA 2KG6A 2KR5A 2XZ0D 2K93A 2K94A 2KOPA 2XZ1C 4PXHB 2KG9A 2KORA 2FQ1A 2AFDA 2KOQA 2LPKA 2JU2A 1ACPA 2L9FA 2X2BA 2N50A 2EHSA 2KG8A 2PNGA 5HV8A 2ROQA 4DG9A 4NEOA 1VKUA 2MF4A 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOL A;  2KGA A;  2LKI A;  2JGP A;  1L0H A;  2KWL A;  2K92 A;  4H2X C;  2N5H A;  3LMO A;  2FQ0 A;  2LL8 A;  2CGQ A;  4PWV B;  4BPG A;  3EJB A;  2KOS A;  2GDW A;  1KLP A;  4IZ6 A;  3RG2 A;  1AF8 A;  5KP8 B;  2LIW A;  2CG5 B;  2AVA A;  2GDX A;  2L4B A;  2FAC A;  2VSQ A;  4HKG A;  2MD9 A;  2MR8 A;  2CNR A;  2QNW A;  2FHS C;  3CE7 A;  2JU1 A;  2FVE A;  4MRT C;  1DV5 A;  2L22 A;  1OR5 A;  2FAD A;  2N6Z A;  2AFE A;  2KGC A;  2K0Y A;  2LTE A;  1NQ4 A;  2M5R A;  2N6Y A;  5CZD B;  5KP6 B;  2FVA A;  2AF8 A;  4BPH A;  2L0Q A;  2FAE A;  2MVU A;  2DNW A;  2GDY A;  2KOO A;  5EJD A;  2FVF A;  1F80 D;  2KW2 A;  2MY5 A;  4H2Y C;  2K2Q A;  5KP7 B;  2EHT A;  1HQB A;  5HVC A;  4CA3 A;  1HY8 A;  2LML A;  4BPF A;  3GZM A;  2MR7 A;  2KGD A;  4H2W C;  3NY7 B;  3EJE A;  2JQ4 A;  2MVV A;  1L0I A;  3EJD A;  2N98 A;  3GZL A;  1DNY A;  2KGE A;  2K0X A;  1X3O A;  2N5I A;  1T8K A;  2CQ8 A;  2FQ2 A;  2LIU A;  2KG6 A;  2KR5 A;  2XZ0 D;  2K93 A;  2K94 A;  2KOP A;  2XZ1 C;  4PXH B;  2KG9 A;  2KOR A;  2FQ1 A;  2AFD A;  2KOQ A;  2LPK A;  2JU2 A;  1ACP A;  2L9F A;  2X2B A;  2N50 A;  2EHS A;  2KG8 A;  2PNG A;  5HV8 A;  2ROQ A;  4DG9 A;  4NEO A;  1VKU A;  2MF4 A;  4R0M A; 
#chains in the Genus database with same CATH topology
 1M90 Q;  2JGP A;  5HGM A;  2KWL A;  4BPG A;  2BHV A;  1KLP A;  3G4S P;  4IZ6 A;  3CCM P;  2Z44 A;  2CG5 B;  2ERH A;  3G1G A;  1ZMB A;  3G6E P;  2PEO A;  2JU1 A;  1DV5 A;  3DS2 A;  3I56 P;  4U0C A;  1RNI A;  3CMA P;  3G28 A;  3WBH A;  2EFJ A;  2AF8 A;  1YHQ P;  4IPY A;  1D1D A;  2L0Q A;  4QNB A;  2GDY A;  2FVF A;  1KC8 Q;  2MY5 A;  1YIJ P;  3U43 A;  4H2Y C;  2K2Q A;  2PEI A;  5HVC A;  2MR7 A;  1VQL P;  4H2W C;  3NY7 B;  3MGE A;  1EMV A;  1Z6M A;  2GZJ A;  5F2N A;  1ZNV A;  2GZF A;  4WYM A;  2KGE A;  1VHN A;  1YJ9 P;  1VQK P;  4XFY A;  2KG6 A;  5F2O A;  4U0E A;  1M6N A;  2K93 A;  2KOP A;  4PXH B;  2KG9 A;  2KOR A;  1A43 A;  1VQP P;  2JYG A;  2KOQ A;  2LPK A;  1ACP A;  1MZ8 A;  2N50 A;  2QEX P;  4DG9 A;  3H47 A;  5EJD A;  4R0M A;  1GPJ A;  2KOD A;  2LOL A;  2KGA A;  2LKI A;  2ONT A;  1QRJ A;  2PY8 A;  1IUQ A;  2LF4 A;  2FQ0 A;  2BUO A;  5HGN A;  1KD1 Q;  3EJB A;  1Q7Y Q;  3CC2 P;  2GDW A;  3LRY A;  3CCL P;  1YJN P;  2VLO A;  1BAJ A;  4U0F A;  2L4B A;  1Q86 Q;  3GJN A;  3CC7 P;  2WPT A;  3CPW O;  3H0D A;  2MR8 A;  2VLP A;  2M8L A;  2FHS C;  3CE7 A;  2M8N A;  1KQS O;  1QVF O;  2L6E A;  4MRT C;  5BS1 A;  1VQ7 P;  2AFE A;  2KGC A;  2K0Y A;  2LTE A;  1NQ4 A;  3OW2 O;  5KP6 B;  2FVA A;  3NTE A;  4BPH A;  2FAE A;  2MVU A;  3H4E A;  3HYB A;  1JJ2 O;  2KW2 A;  1NJI Q;  2EHT A;  1AUM A;  1HY8 A;  4U0D A;  4XFX A;  2Z45 A;  1S72 P;  2PEN A;  2OTJ P;  1W2B O;  3CME P;  2MVV A;  2N98 A;  3VRL C;  4XRQ A;  2JYL A;  2JO0 A;  1T8K A;  2CQ8 A;  2PEM A;  2FQ2 A;  1UJZ A;  3CCR P;  4XFZ A;  3G26 A;  2XZ1 C;  1E0H A;  3DS5 A;  4U0B A;  2PEQ A;  2FQ1 A;  2CWO A;  2OTL P;  2GZE A;  2EG5 A;  5HGL A;  2X2B A;  2EHS A;  4PH1 A;  3E2D A;  3DS1 A;  7CEI A;  1YJW P;  1VKU A;  4H2X C;  2K92 A;  2N5H A;  3LMO A;  2CGQ A;  1K73 Q;  5KP8 B;  3G71 P;  3Q20 A;  1VQO P;  2VSQ A;  4HKG A;  1UNK A;  2MD9 A;  4COC A;  2L22 A;  1OR5 A;  3DS3 A;  2PEJ A;  4QKO A;  3CCE P;  3CCJ P;  1VQN P;  2N6Y A;  5CZD B;  1VQ5 P;  2EIA A;  5F2K A;  1AYI A;  2JAZ A;  1BXI A;  4GR2 A;  1FR2 A;  2Z46 A;  5JPA A;  1EIA A;  1Q82 Q;  3G0V A;  4BPF A;  1N8R Q;  2JB0 A;  3CC4 P;  2KGD A;  1K9M Q;  3EJE A;  3CXC O;  3CCV P;  3EJD A;  2DGY A;  3GZL A;  1VQ8 P;  1VQ6 P;  3CCU P;  2LIU A;  3M1M A;  2XZ0 D;  3CCQ P;  2GZI A;  2L9F A;  1YIT P;  3HZQ A;  1K8A Q;  2KG8 A;  2PNG A;  3DPH A;  5KP7 B;  2MF4 A;  5EW5 E;  1VQM P;  1L0H A;  5BS2 A;  1M1K Q;  3I55 P;  2LL8 A;  4PWV B;  2JBG A;  2KOS A;  3G21 A;  3RG2 A;  4M0I A;  1AF8 A;  2P9X A;  3RG6 C;  2VLN A;  2LIW A;  2K0D X;  2AVA A;  3GKL C;  1M74 A;  2GDX A;  2FAC A;  2XT1 A;  4UHP B;  2CNR A;  3P05 A;  1VQ4 P;  1VQ9 P;  2QNW A;  1GXH A;  3G29 A;  2FVE A;  2FAD A;  2N6Z A;  1K30 A;  2M5R A;  2GYK A;  5HGO A;  3B4Q A;  4U0A A;  1M6E X;  3G1I A;  2DNW A;  1Q81 Q;  2K5X A;  2PEK A;  2NO8 A;  2KOO A;  1QVG O;  1F80 D;  5I4T G;  1CEI A;  1RO2 A;  2M8P A;  1HQB A;  4COP A;  4CA3 A;  1IMQ A;  3DS4 A;  2LML A;  3GZM A;  2XV6 A;  5DCK A;  4GR6 A;  3DTJ A;  2E1M A;  2JQ4 A;  3DS0 A;  1L0I A;  1DNY A;  2K0X A;  1X3O A;  2N5I A;  3CD6 P;  3CCS P;  2QA4 P;  1EOQ A;  1YI2 P;  2KR5 A;  1GXG A;  2K94 A;  2GZG A;  4PH0 A;  2VLQ A;  3B5I A;  2AFD A;  4XRO A;  2XXM A;  1A8O A;  2JU2 A;  1E6J P;  5HV8 A;  1RO0 A;  2ROQ A;  2OAR A;  1IMP A;  4NEO A;  4F37 A; 
#chains in the Genus database with same CATH homology
 2LOL A;  2KGA A;  2LKI A;  2JGP A;  1L0H A;  2KWL A;  2K92 A;  4H2X C;  2N5H A;  3LMO A;  2FQ0 A;  2LL8 A;  2CGQ A;  4PWV B;  4BPG A;  3EJB A;  2KOS A;  2GDW A;  1KLP A;  4IZ6 A;  3RG2 A;  1AF8 A;  5KP8 B;  2LIW A;  2CG5 B;  2AVA A;  2GDX A;  2L4B A;  2FAC A;  2VSQ A;  4HKG A;  2MD9 A;  2MR8 A;  2CNR A;  2QNW A;  2FHS C;  3CE7 A;  2JU1 A;  2FVE A;  4MRT C;  1DV5 A;  2L22 A;  1OR5 A;  2FAD A;  2N6Z A;  2AFE A;  2KGC A;  2K0Y A;  2LTE A;  1NQ4 A;  2M5R A;  2N6Y A;  5CZD B;  5KP6 B;  2FVA A;  2AF8 A;  4BPH A;  2L0Q A;  2FAE A;  2MVU A;  2DNW A;  2GDY A;  2KOO A;  5EJD A;  2FVF A;  1F80 D;  2KW2 A;  2MY5 A;  4H2Y C;  2K2Q A;  5KP7 B;  2EHT A;  1HQB A;  5HVC A;  4CA3 A;  1HY8 A;  2LML A;  4BPF A;  3GZM A;  2MR7 A;  2KGD A;  4H2W C;  3NY7 B;  3EJE A;  2JQ4 A;  2MVV A;  1L0I A;  3EJD A;  2N98 A;  3GZL A;  1DNY A;  2KGE A;  2K0X A;  1X3O A;  2N5I A;  1T8K A;  2CQ8 A;  2FQ2 A;  2LIU A;  2KG6 A;  2KR5 A;  2XZ0 D;  2K93 A;  2K94 A;  2KOP A;  2XZ1 C;  4PXH B;  2KG9 A;  2KOR A;  2FQ1 A;  2AFD A;  2KOQ A;  2LPK A;  2JU2 A;  1ACP A;  2L9F A;  2X2B A;  2N50 A;  2EHS A;  2KG8 A;  2PNG A;  5HV8 A;  2ROQ A;  4DG9 A;  4NEO A;  1VKU A;  2MF4 A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...