2M5RA

Solution structure of holo-acyl carrier protein of leishmania major
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MNDVLTRVLEVVKNFEKVDASKVTPESHFVKDLGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structures of the apo- and holo- forms of the acyl carrier protein of Leishmania major
rcsb
source organism Leishmania major
molecule tags Lipid binding protein
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2m5rA00
4BPGA 2FQ1A 1AF8A 1VKUA 2FVAA 2FQ0A 3EJBA 2MR8A 4H2WC 1NQ4A 4H2YC 2KGAA 4CA3A 1OR5A 5HVCA 2K92A 2XZ1C 1L0HA 2LL8A 1ACPA 4DG9A 4BPHA 4PXHB 3RG2A 2LMLA 2KG8A 2K0XA 2MD9A 2CNRA 2KW2A 2FQ2A 2EHTA 4MRTC 3EJDA 2CG5B 4PWVB 4NEOA 2FVFA 2LIWA 2L4BA 1L0IA 2JU1A 2N50A 2MVUA 2CQ8A 2FADA 2KORA 2KOQA 2JQ4A 2M5RA 2N5IA 2AVAA 3GZLA 1T8KA 2VSQA 2AFEA 5KP6B 2FACA 2LTEA 3GZMA 2K94A 2L22A 2JU2A 2N98A 2ROQA 2MVVA 2N6ZA 2K93A 5HV8A 5KP7B 2L0QA 3CE7A 2KWLA 2LKIA 4BPFA 1DNYA 2X2BA 2N6YA 2LIUA 1KLPA 2KOPA 2AF8A 2LPKA 2DNWA 1HY8A 3NY7B 1X3OA 2CGQA 4H2XC 2FVEA 2XZ0D 3EJEA 1F80D 2AFDA 2KOOA 2KG6A 2EHSA 2K0YA 2FHSC 2GDWA 2KGCA 2KR5A 5EJDA 5KP8B 3LMOA 2GDXA 2LOLA 1HQBA 2KG9A 2MF4A 2QNWA 2FAEA 1DV5A 2KOSA 2MY5A 2L9FA 4IZ6A 2KGEA 2K2QA 2PNGA 2N5HA 2KGDA 2GDYA 4R0MA 5CZDB 4HKGA 2JGPA 2MR7A
chains in the Genus database with same CATH superfamily
2QEXP 4BPGA 1VKUA 3G28A 3EJBA 1K30A 4M0IA 1Q86Q 2E1MA 4XROA 1ACPA 4DG9A 3B4QA 4PXHB 2ONTA 2PENA 2P9XA 3CCEP 1IMPA 2K0XA 4UHPB 1VQ4P 2FQ2A 3EJDA 2FVFA 2PEQA 2VLQA 2K0DX 5BS1A 2N50A 2MVUA 2CQ8A 2WPTA 1NJIQ 2M5RA 2JQ4A 2GZIA 3GZLA 1N8RQ 1VQKP 2BUOA 3CMAP 2JO0A 2L22A 3CC2P 1EIAA 5HV8A 5KP7B 3M1MA 4COCA 3CCJP 1S72P 3CCMP 7CEIA 2LIUA 3CCQP 2AF8A 2LPKA 4U0AA 1HY8A 3DTJA 3VRLC 1VQNP 1E6JP 2CGQA 1IUQA 2FVEA 3HZQA 3HYBA 1F80D 2KG6A 2PEOA 2K0YA 1QVFO 2JBGA 2FHSC 2GDWA 2K5XA 1M74A 3RG6C 3WBHA 3P05A 1VQOP 1IMQA 4WYMA 4U0DA 2KG9A 2MF4A 4XFZA 2QNWA 1DV5A 2L9FA 2OTLP 2JGPA 2MR7A 3DS4A 1VQ6P 2CWOA 2DGYA 5F2NA 4GR6A 4PH1A 2GZFA 1AUMA 3B5IA 4H2WC 5HGMA 1VQ5P 1NQ4A 3G21A 4H2YC 2KGAA 4XRQA 3I55P 1OR5A 5HVCA 1VQ7P 2JB0A 1Q7YQ 4PH0A 2XZ1C 5F2KA 3MGEA 1KC8Q 3GKLC 3CMEP 2QA4P 1YJNP 2LMLA 4COPA 1A43A 4GR2A 2EHTA 4MRTC 2CG5B 4PWVB 3U43A 2JU1A 1T8KA 2VSQA 5I4TG 4XFXA 2AFEA 3CC7P 2N98A 1GXHA 3DS1A 2K93A 2L0QA 4QKOA 3CCVP 5DCKA 2KWLA 2LKIA 3NTEA 1DNYA 3GJNA 1RO0A 2PEKA 2DNWA 4U0EA 3DS2A 4H2XC 1GXGA 2OARA 2VLOA 1M6NA 1JJ2O 5KP8B 2GDXA 1K8AQ 2EIAA 1ZNVA 4XFYA 2KOSA 2MY5A 1UJZA 2PNGA 3G1IA 1VQ8P 2VLNA 4IPYA 1YJWP 2FQ1A 1AF8A 2FVAA 2JAZA 1GPJA 2PEMA 2MR8A 3Q20A 2BHVA 5HGNA 5EW5E 3H4EA 2LL8A 3CD6P 1YIJP 1VQLP 1CEIA 4BPHA 1EMVA 1QVGO 3G71P 3H0DA 2KW2A 3G0VA 2M8LA 4NEOA 2LIWA 1YITP 4F37A 1L0IA 3G26A 2KORA 2KOQA 2N5IA 3DS0A 2GZJA 2FACA 3CXCO 2K94A 3LRYA 3CCRP 1QRJA 2JU2A 2MVVA 2PEIA 5F2OA 1VQ9P 1KD1Q 1YHQP 2ERHA 2PEJA 2PY8A 3E2DA 1VQMP 1KLPA 1YJ9P 2KOPA 2JYGA 3OW2O 2GZGA 5HGLA 1VQPP 1K9MQ 5JPAA 2XZ0D 2AFDA 2KOOA 2EFJA 4U0BA 3CC4P 2KR5A 5EJDA 3DS5A 2LOLA 1HQBA 4U0CA 4IZ6A 2KGEA 2K2QA 2XT1A 2N5HA 2KODA 4HKGA 2Z45A 1E0HA 2FQ0A 2XXMA 1W2BO 1AYIA 2M8NA 2M8PA 2Z46A 4CA3A 1FR2A 3DS3A 3CPWO 2K92A 1L0HA 2GYKA 2JYLA 3RG2A 3G6EP 2KG8A 2MD9A 2CNRA 3G4SP 2L4BA 3H47A 1BXIA 1VHNA 1KQSO 2NO8A 2FADA 1YI2P 2AVAA 3G1GA 1M90Q 5HGOA 5KP6B 2LTEA 3I56P 3GZMA 1D1DA 2ROQA 2N6ZA 3CCUP 1M1KQ 2L6EA 3CE7A 2Z44A 4BPFA 1EOQA 1UNKA 2VLPA 1A8OA 2X2BA 4QNBA 2N6YA 3CCLP 1Q82Q 2EG5A 3DPHA 3NY7B 1X3OA 1K73Q 1ZMBA 3EJEA 2EHSA 3G29A 4U0FA 2KGCA 5BS2A 2LF4A 3LMOA 1RNIA 2XV6A 1Q81Q 3CCSP 1M6EX 1MZ8A 2FAEA 2GZEA 1BAJA 2KGDA 2GDYA 4R0MA 5CZDB 1Z6MA 2OTJP 1RO2A
chains in the Genus database with same CATH topology
4BPGA 2FQ1A 1AF8A 1VKUA 2FVAA 2FQ0A 3EJBA 2MR8A 4H2WC 1NQ4A 4H2YC 2KGAA 4CA3A 1OR5A 5HVCA 2K92A 2XZ1C 1L0HA 2LL8A 1ACPA 4DG9A 4BPHA 4PXHB 3RG2A 2LMLA 2KG8A 2K0XA 2MD9A 2CNRA 2KW2A 2FQ2A 2EHTA 4MRTC 3EJDA 2CG5B 4PWVB 4NEOA 2FVFA 2LIWA 2L4BA 1L0IA 2JU1A 2N50A 2MVUA 2CQ8A 2FADA 2KORA 2KOQA 2JQ4A 2M5RA 2N5IA 2AVAA 3GZLA 1T8KA 2VSQA 2AFEA 5KP6B 2FACA 2LTEA 3GZMA 2K94A 2L22A 2JU2A 2N98A 2ROQA 2MVVA 2N6ZA 2K93A 5HV8A 5KP7B 2L0QA 3CE7A 2KWLA 2LKIA 4BPFA 1DNYA 2X2BA 2N6YA 2LIUA 1KLPA 2KOPA 2AF8A 2LPKA 2DNWA 1HY8A 3NY7B 1X3OA 2CGQA 4H2XC 2FVEA 2XZ0D 3EJEA 1F80D 2AFDA 2KOOA 2KG6A 2EHSA 2K0YA 2FHSC 2GDWA 2KGCA 2KR5A 5EJDA 5KP8B 3LMOA 2GDXA 2LOLA 1HQBA 2KG9A 2MF4A 2QNWA 2FAEA 1DV5A 2KOSA 2MY5A 2L9FA 4IZ6A 2KGEA 2K2QA 2PNGA 2N5HA 2KGDA 2GDYA 4R0MA 5CZDB 4HKGA 2JGPA 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BPG A;  2FQ1 A;  1AF8 A;  1VKU A;  2FVA A;  2FQ0 A;  3EJB A;  2MR8 A;  4H2W C;  1NQ4 A;  4H2Y C;  2KGA A;  4CA3 A;  1OR5 A;  5HVC A;  2K92 A;  2XZ1 C;  1L0H A;  2LL8 A;  1ACP A;  4DG9 A;  4BPH A;  4PXH B;  3RG2 A;  2LML A;  2KG8 A;  2K0X A;  2MD9 A;  2CNR A;  2KW2 A;  2FQ2 A;  2EHT A;  4MRT C;  3EJD A;  2CG5 B;  4PWV B;  4NEO A;  2FVF A;  2LIW A;  2L4B A;  1L0I A;  2JU1 A;  2N50 A;  2MVU A;  2CQ8 A;  2FAD A;  2KOR A;  2KOQ A;  2JQ4 A;  2M5R A;  2N5I A;  2AVA A;  3GZL A;  1T8K A;  2VSQ A;  2AFE A;  5KP6 B;  2FAC A;  2LTE A;  3GZM A;  2K94 A;  2L22 A;  2JU2 A;  2N98 A;  2ROQ A;  2MVV A;  2N6Z A;  2K93 A;  5HV8 A;  5KP7 B;  2L0Q A;  3CE7 A;  2KWL A;  2LKI A;  4BPF A;  1DNY A;  2X2B A;  2N6Y A;  2LIU A;  1KLP A;  2KOP A;  2AF8 A;  2LPK A;  2DNW A;  1HY8 A;  3NY7 B;  1X3O A;  2CGQ A;  4H2X C;  2FVE A;  2XZ0 D;  3EJE A;  1F80 D;  2AFD A;  2KOO A;  2KG6 A;  2EHS A;  2K0Y A;  2FHS C;  2GDW A;  2KGC A;  2KR5 A;  5EJD A;  5KP8 B;  3LMO A;  2GDX A;  2LOL A;  1HQB A;  2KG9 A;  2MF4 A;  2QNW A;  2FAE A;  1DV5 A;  2KOS A;  2MY5 A;  2L9F A;  4IZ6 A;  2KGE A;  2K2Q A;  2PNG A;  2N5H A;  2KGD A;  2GDY A;  4R0M A;  5CZD B;  4HKG A;  2JGP A;  2MR7 A; 
#chains in the Genus database with same CATH topology
 2QEX P;  4BPG A;  1VKU A;  3G28 A;  3EJB A;  1K30 A;  4M0I A;  1Q86 Q;  2E1M A;  4XRO A;  1ACP A;  4DG9 A;  3B4Q A;  4PXH B;  2ONT A;  2PEN A;  2P9X A;  3CCE P;  1IMP A;  2K0X A;  4UHP B;  1VQ4 P;  2FQ2 A;  3EJD A;  2FVF A;  2PEQ A;  2VLQ A;  2K0D X;  5BS1 A;  2N50 A;  2MVU A;  2CQ8 A;  2WPT A;  1NJI Q;  2M5R A;  2JQ4 A;  2GZI A;  3GZL A;  1N8R Q;  1VQK P;  2BUO A;  3CMA P;  2JO0 A;  2L22 A;  3CC2 P;  1EIA A;  5HV8 A;  5KP7 B;  3M1M A;  4COC A;  3CCJ P;  1S72 P;  3CCM P;  7CEI A;  2LIU A;  3CCQ P;  2AF8 A;  2LPK A;  4U0A A;  1HY8 A;  3DTJ A;  3VRL C;  1VQN P;  1E6J P;  2CGQ A;  1IUQ A;  2FVE A;  3HZQ A;  3HYB A;  1F80 D;  2KG6 A;  2PEO A;  2K0Y A;  1QVF O;  2JBG A;  2FHS C;  2GDW A;  2K5X A;  1M74 A;  3RG6 C;  3WBH A;  3P05 A;  1VQO P;  1IMQ A;  4WYM A;  4U0D A;  2KG9 A;  2MF4 A;  4XFZ A;  2QNW A;  1DV5 A;  2L9F A;  2OTL P;  2JGP A;  2MR7 A;  3DS4 A;  1VQ6 P;  2CWO A;  2DGY A;  5F2N A;  4GR6 A;  4PH1 A;  2GZF A;  1AUM A;  3B5I A;  4H2W C;  5HGM A;  1VQ5 P;  1NQ4 A;  3G21 A;  4H2Y C;  2KGA A;  4XRQ A;  3I55 P;  1OR5 A;  5HVC A;  1VQ7 P;  2JB0 A;  1Q7Y Q;  4PH0 A;  2XZ1 C;  5F2K A;  3MGE A;  1KC8 Q;  3GKL C;  3CME P;  2QA4 P;  1YJN P;  2LML A;  4COP A;  1A43 A;  4GR2 A;  2EHT A;  4MRT C;  2CG5 B;  4PWV B;  3U43 A;  2JU1 A;  1T8K A;  2VSQ A;  5I4T G;  4XFX A;  2AFE A;  3CC7 P;  2N98 A;  1GXH A;  3DS1 A;  2K93 A;  2L0Q A;  4QKO A;  3CCV P;  5DCK A;  2KWL A;  2LKI A;  3NTE A;  1DNY A;  3GJN A;  1RO0 A;  2PEK A;  2DNW A;  4U0E A;  3DS2 A;  4H2X C;  1GXG A;  2OAR A;  2VLO A;  1M6N A;  1JJ2 O;  5KP8 B;  2GDX A;  1K8A Q;  2EIA A;  1ZNV A;  4XFY A;  2KOS A;  2MY5 A;  1UJZ A;  2PNG A;  3G1I A;  1VQ8 P;  2VLN A;  4IPY A;  1YJW P;  2FQ1 A;  1AF8 A;  2FVA A;  2JAZ A;  1GPJ A;  2PEM A;  2MR8 A;  3Q20 A;  2BHV A;  5HGN A;  5EW5 E;  3H4E A;  2LL8 A;  3CD6 P;  1YIJ P;  1VQL P;  1CEI A;  4BPH A;  1EMV A;  1QVG O;  3G71 P;  3H0D A;  2KW2 A;  3G0V A;  2M8L A;  4NEO A;  2LIW A;  1YIT P;  4F37 A;  1L0I A;  3G26 A;  2KOR A;  2KOQ A;  2N5I A;  3DS0 A;  2GZJ A;  2FAC A;  3CXC O;  2K94 A;  3LRY A;  3CCR P;  1QRJ A;  2JU2 A;  2MVV A;  2PEI A;  5F2O A;  1VQ9 P;  1KD1 Q;  1YHQ P;  2ERH A;  2PEJ A;  2PY8 A;  3E2D A;  1VQM P;  1KLP A;  1YJ9 P;  2KOP A;  2JYG A;  3OW2 O;  2GZG A;  5HGL A;  1VQP P;  1K9M Q;  5JPA A;  2XZ0 D;  2AFD A;  2KOO A;  2EFJ A;  4U0B A;  3CC4 P;  2KR5 A;  5EJD A;  3DS5 A;  2LOL A;  1HQB A;  4U0C A;  4IZ6 A;  2KGE A;  2K2Q A;  2XT1 A;  2N5H A;  2KOD A;  4HKG A;  2Z45 A;  1E0H A;  2FQ0 A;  2XXM A;  1W2B O;  1AYI A;  2M8N A;  2M8P A;  2Z46 A;  4CA3 A;  1FR2 A;  3DS3 A;  3CPW O;  2K92 A;  1L0H A;  2GYK A;  2JYL A;  3RG2 A;  3G6E P;  2KG8 A;  2MD9 A;  2CNR A;  3G4S P;  2L4B A;  3H47 A;  1BXI A;  1VHN A;  1KQS O;  2NO8 A;  2FAD A;  1YI2 P;  2AVA A;  3G1G A;  1M90 Q;  5HGO A;  5KP6 B;  2LTE A;  3I56 P;  3GZM A;  1D1D A;  2ROQ A;  2N6Z A;  3CCU P;  1M1K Q;  2L6E A;  3CE7 A;  2Z44 A;  4BPF A;  1EOQ A;  1UNK A;  2VLP A;  1A8O A;  2X2B A;  4QNB A;  2N6Y A;  3CCL P;  1Q82 Q;  2EG5 A;  3DPH A;  3NY7 B;  1X3O A;  1K73 Q;  1ZMB A;  3EJE A;  2EHS A;  3G29 A;  4U0F A;  2KGC A;  5BS2 A;  2LF4 A;  3LMO A;  1RNI A;  2XV6 A;  1Q81 Q;  3CCS P;  1M6E X;  1MZ8 A;  2FAE A;  2GZE A;  1BAJ A;  2KGD A;  2GDY A;  4R0M A;  5CZD B;  1Z6M A;  2OTJ P;  1RO2 A; 
#chains in the Genus database with same CATH homology
 4BPG A;  2FQ1 A;  1AF8 A;  1VKU A;  2FVA A;  2FQ0 A;  3EJB A;  2MR8 A;  4H2W C;  1NQ4 A;  4H2Y C;  2KGA A;  4CA3 A;  1OR5 A;  5HVC A;  2K92 A;  2XZ1 C;  1L0H A;  2LL8 A;  1ACP A;  4DG9 A;  4BPH A;  4PXH B;  3RG2 A;  2LML A;  2KG8 A;  2K0X A;  2MD9 A;  2CNR A;  2KW2 A;  2FQ2 A;  2EHT A;  4MRT C;  3EJD A;  2CG5 B;  4PWV B;  4NEO A;  2FVF A;  2LIW A;  2L4B A;  1L0I A;  2JU1 A;  2N50 A;  2MVU A;  2CQ8 A;  2FAD A;  2KOR A;  2KOQ A;  2JQ4 A;  2M5R A;  2N5I A;  2AVA A;  3GZL A;  1T8K A;  2VSQ A;  2AFE A;  5KP6 B;  2FAC A;  2LTE A;  3GZM A;  2K94 A;  2L22 A;  2JU2 A;  2N98 A;  2ROQ A;  2MVV A;  2N6Z A;  2K93 A;  5HV8 A;  5KP7 B;  2L0Q A;  3CE7 A;  2KWL A;  2LKI A;  4BPF A;  1DNY A;  2X2B A;  2N6Y A;  2LIU A;  1KLP A;  2KOP A;  2AF8 A;  2LPK A;  2DNW A;  1HY8 A;  3NY7 B;  1X3O A;  2CGQ A;  4H2X C;  2FVE A;  2XZ0 D;  3EJE A;  1F80 D;  2AFD A;  2KOO A;  2KG6 A;  2EHS A;  2K0Y A;  2FHS C;  2GDW A;  2KGC A;  2KR5 A;  5EJD A;  5KP8 B;  3LMO A;  2GDX A;  2LOL A;  1HQB A;  2KG9 A;  2MF4 A;  2QNW A;  2FAE A;  1DV5 A;  2KOS A;  2MY5 A;  2L9F A;  4IZ6 A;  2KGE A;  2K2Q A;  2PNG A;  2N5H A;  2KGD A;  2GDY A;  4R0M A;  5CZD B;  4HKG A;  2JGP A;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...