2M5RA

Solution structure of holo-acyl carrier protein of leishmania major
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MNDVLTRVLEVVKNFEKVDASKVTPESHFVKDLGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structures of the apo- and holo- forms of the acyl carrier protein of Leishmania major
rcsb
source organism Leishmania major
molecule tags Lipid binding protein
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2m5rA00
4NEOA 2KGCA 1T8KA 3NY7B 2N50A 2KORA 2LL8A 3GZMA 2DNWA 4PWVB 3EJBA 2KG9A 2CNRA 2KGEA 2N5HA 3EJDA 2N98A 4BPGA 3RG2A 1L0HA 2QNWA 5EJDA 1VKUA 2CGQA 3EJEA 2KG8A 4HKGA 2MD9A 2FQ0A 2FACA 2CQ8A 2AFEA 4H2YC 2FVFA 3LMOA 4CA3A 4H2XC 2LKIA 4MRTC 1HY8A 2N6YA 2LPKA 2L9FA 1AF8A 2LTEA 2MVUA 2KOPA 2N5IA 2JGPA 2M5RA 2MR8A 4DG9A 1DV5A 2AFDA 2FQ1A 2KGAA 2N6ZA 2KR5A 5HVCA 2MF4A 2L0QA 2AVAA 2JU1A 2L4BA 2KOQA 4BPHA 2MVVA 2FVAA 2GDYA 5CZDB 4H2WC 2ROQA 2VSQA 1ACPA 2AF8A 2JU2A 2KWLA 2KOOA 4R0MA 2PNGA 2XZ1C 2FHSC 1L0IA 5KP6B 2X2BA 2K0XA 1F80D 3GZLA 2KW2A 1OR5A 2FVEA 1HQBA 2GDXA 2EHTA 2CG5B 2KG6A 2LIUA 4IZ6A 2FADA 1X3OA 2MR7A 2K0YA 2FAEA 2LMLA 1NQ4A 2L22A 2LOLA 2GDWA 1DNYA 4BPFA 2FQ2A 2JQ4A 2KGDA 2KOSA 2LIWA 5KP8B 1KLPA 2EHSA 2K93A 3CE7A 5HV8A 2MY5A 2K94A 2K2QA 2XZ0D 5KP7B 4PXHB 2K92A
chains in the Genus database with same CATH superfamily
3MGEA 2M8PA 2JYGA 1T8KA 2N50A 2KORA 1E6JP 2XV6A 2K5XA 2M8LA 1M90Q 2KGEA 2N5HA 2LF4A 2N98A 2QNWA 3G26A 1NJIQ 1FR2A 3I56P 2PEKA 3CCLP 1AUMA 1K30A 1M6EX 1N8RQ 3EJEA 2KG8A 1S72P 5F2OA 4WYMA 4H2YC 1CEIA 3CCSP 2LPKA 1AF8A 2MVUA 3H47A 2N5IA 4UHPB 3HYBA 1BXIA 2XT1A 3B5IA 4DG9A 1UJZA 2BHVA 2AFDA 2KR5A 3E2DA 2GZGA 2JO0A 1EIAA 3G29A 1YIJP 4GR6A 2KOQA 2MVVA 2GDYA 2PEQA 3WBHA 4F37A 1ACPA 2JU2A 2PNGA 2XZ1C 5KP6B 1F80D 2JAZA 3VRLC 1E0HA 2EHTA 2LIUA 2OTJP 4IZ6A 2PEIA 1K9MQ 1DNYA 4QKOA 2JQ4A 1K8AQ 2KOSA 2LIWA 1JJ2O 1KLPA 2EHSA 3G1GA 2JB0A 3B4QA 3M1MA 1W2BO 3Q20A 4COPA 2XZ0D 4PXHB 5EW5E 1VQMP 2QEXP 1VHNA 2QA4P 3DS5A 1ZMBA 1A8OA 1QRJA 3CCEP 3EJBA 3EJDA 3RG2A 2CGQA 1M6NA 1VQNP 5DCKA 1Q7YQ 3CCJP 2Z44A 2FACA 1ZNVA 2CQ8A 1VQ8P 2GZEA 1KQSO 3H0DA 2FVFA 3DS2A 3LMOA 4CA3A 3CCMP 4H2XC 1YHQP 1HY8A 5HGOA 5HGNA 2LTEA 3G6EP 3DS4A 4U0CA 4U0BA 2JGPA 2M5RA 2E1MA 3GJNA 2FQ1A 2FVAA 3CD6P 5JPAA 3HZQA 5F2NA 1BAJA 4R0MA 1Q82Q 2L6EA 4U0FA 2X2BA 2GDXA 4XFYA 3DS1A 2NO8A 2FADA 7CEIA 1NQ4A 2L22A 2LOLA 1VQ5P 2GDWA 1UNKA 5BS1A 1VQ4P 2PEMA 2FQ2A 2K0DX 2KGDA 5F2KA 3CMAP 1GXHA 2K93A 2KODA 3CE7A 2PEOA 4M0IA 1Q81Q 4NEOA 4XFXA 2VLPA 3NTEA 3CC4P 3GZMA 3P05A 1QVGO 4PWVB 2CNRA 1L0HA 5EJDA 2ERHA 4HKGA 2FQ0A 3G1IA 1AYIA 2ONTA 4QNBA 2VLOA 2VLNA 2EG5A 4MRTC 2N6YA 2KOPA 3G21A 4IPYA 3CC2P 3CXCO 2WPTA 2MR8A 3G4SP 1DV5A 1VQ7P 2CWOA 2KGAA 5HVCA 2AVAA 2L4BA 2EIAA 3DS3A 1D1DA 2GZFA 1VQ9P 1RNIA 2VSQA 2AF8A 2KOOA 4XRQA 3RG6C 4XFZA 2K0XA 2BUOA 1OR5A 1HQBA 1YJNP 5BS2A 2CG5B 5HGMA 2MR7A 1GPJA 2FAEA 2PY8A 5I4TG 1YITP 2PENA 3LRYA 1VQOP 3CMEP 1M1KQ 2Z45A 3U43A 5HV8A 2MY5A 2K2QA 5KP7B 3DTJA 2K92A 3CCQP 2GYKA 2KGCA 3G71P 3NY7B 2LL8A 4U0AA 2GZIA 2GZJA 1RO2A 1MZ8A 4COCA 2DNWA 3OW2O 2KG9A 1M74A 3H4EA 4BPGA 1VKUA 1QVFO 1IUQA 1Z6MA 3G0VA 1A43A 2XXMA 2VLQA 1K73Q 4U0EA 1YJWP 1VQKP 2MD9A 3G28A 2AFEA 1YJ9P 3CCUP 2LKIA 2EFJA 3DPHA 2L9FA 3CCVP 1KC8Q 2JBGA 2M8NA 1IMQA 1VQPP 1VQ6P 3CCRP 3GKLC 5HGLA 2N6ZA 2MF4A 2L0QA 2Z46A 2JU1A 4BPHA 5CZDB 4H2WC 3CPWO 1EMVA 2ROQA 2JYLA 2KWLA 1GXGA 1VQLP 2FHSC 1L0IA 3CC7P 4GR2A 3GZLA 2KW2A 1IMPA 2FVEA 1YI2P 1RO0A 2KG6A 2OTLP 1X3OA 3I55P 1KD1Q 2K0YA 4PH0A 2LMLA 2PEJA 1Q86Q 2OARA 4BPFA 2P9XA 5KP8B 2DGYA 3DS0A 2K94A 4PH1A 1EOQA 4XROA 4U0DA
chains in the Genus database with same CATH topology
4NEOA 2KGCA 1T8KA 3NY7B 2N50A 2KORA 2LL8A 3GZMA 2DNWA 4PWVB 3EJBA 2KG9A 2CNRA 2KGEA 2N5HA 3EJDA 2N98A 4BPGA 3RG2A 1L0HA 2QNWA 5EJDA 1VKUA 2CGQA 3EJEA 2KG8A 4HKGA 2MD9A 2FQ0A 2FACA 2CQ8A 2AFEA 4H2YC 2FVFA 3LMOA 4CA3A 4H2XC 2LKIA 4MRTC 1HY8A 2N6YA 2LPKA 2L9FA 1AF8A 2LTEA 2MVUA 2KOPA 2N5IA 2JGPA 2M5RA 2MR8A 4DG9A 1DV5A 2AFDA 2FQ1A 2KGAA 2N6ZA 2KR5A 5HVCA 2MF4A 2L0QA 2AVAA 2JU1A 2L4BA 2KOQA 4BPHA 2MVVA 2FVAA 2GDYA 5CZDB 4H2WC 2ROQA 2VSQA 1ACPA 2AF8A 2JU2A 2KWLA 2KOOA 4R0MA 2PNGA 2XZ1C 2FHSC 1L0IA 5KP6B 2X2BA 2K0XA 1F80D 3GZLA 2KW2A 1OR5A 2FVEA 1HQBA 2GDXA 2EHTA 2CG5B 2KG6A 2LIUA 4IZ6A 2FADA 1X3OA 2MR7A 2K0YA 2FAEA 2LMLA 1NQ4A 2L22A 2LOLA 2GDWA 1DNYA 4BPFA 2FQ2A 2JQ4A 2KGDA 2KOSA 2LIWA 5KP8B 1KLPA 2EHSA 2K93A 3CE7A 5HV8A 2MY5A 2K94A 2K2QA 2XZ0D 5KP7B 4PXHB 2K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEO A;  2KGC A;  1T8K A;  3NY7 B;  2N50 A;  2KOR A;  2LL8 A;  3GZM A;  2DNW A;  4PWV B;  3EJB A;  2KG9 A;  2CNR A;  2KGE A;  2N5H A;  3EJD A;  2N98 A;  4BPG A;  3RG2 A;  1L0H A;  2QNW A;  5EJD A;  1VKU A;  2CGQ A;  3EJE A;  2KG8 A;  4HKG A;  2MD9 A;  2FQ0 A;  2FAC A;  2CQ8 A;  2AFE A;  4H2Y C;  2FVF A;  3LMO A;  4CA3 A;  4H2X C;  2LKI A;  4MRT C;  1HY8 A;  2N6Y A;  2LPK A;  2L9F A;  1AF8 A;  2LTE A;  2MVU A;  2KOP A;  2N5I A;  2JGP A;  2M5R A;  2MR8 A;  4DG9 A;  1DV5 A;  2AFD A;  2FQ1 A;  2KGA A;  2N6Z A;  2KR5 A;  5HVC A;  2MF4 A;  2L0Q A;  2AVA A;  2JU1 A;  2L4B A;  2KOQ A;  4BPH A;  2MVV A;  2FVA A;  2GDY A;  5CZD B;  4H2W C;  2ROQ A;  2VSQ A;  1ACP A;  2AF8 A;  2JU2 A;  2KWL A;  2KOO A;  4R0M A;  2PNG A;  2XZ1 C;  2FHS C;  1L0I A;  5KP6 B;  2X2B A;  2K0X A;  1F80 D;  3GZL A;  2KW2 A;  1OR5 A;  2FVE A;  1HQB A;  2GDX A;  2EHT A;  2CG5 B;  2KG6 A;  2LIU A;  4IZ6 A;  2FAD A;  1X3O A;  2MR7 A;  2K0Y A;  2FAE A;  2LML A;  1NQ4 A;  2L22 A;  2LOL A;  2GDW A;  1DNY A;  4BPF A;  2FQ2 A;  2JQ4 A;  2KGD A;  2KOS A;  2LIW A;  5KP8 B;  1KLP A;  2EHS A;  2K93 A;  3CE7 A;  5HV8 A;  2MY5 A;  2K94 A;  2K2Q A;  2XZ0 D;  5KP7 B;  4PXH B;  2K92 A; 
#chains in the Genus database with same CATH topology
 3MGE A;  2M8P A;  2JYG A;  1T8K A;  2N50 A;  2KOR A;  1E6J P;  2XV6 A;  2K5X A;  2M8L A;  1M90 Q;  2KGE A;  2N5H A;  2LF4 A;  2N98 A;  2QNW A;  3G26 A;  1NJI Q;  1FR2 A;  3I56 P;  2PEK A;  3CCL P;  1AUM A;  1K30 A;  1M6E X;  1N8R Q;  3EJE A;  2KG8 A;  1S72 P;  5F2O A;  4WYM A;  4H2Y C;  1CEI A;  3CCS P;  2LPK A;  1AF8 A;  2MVU A;  3H47 A;  2N5I A;  4UHP B;  3HYB A;  1BXI A;  2XT1 A;  3B5I A;  4DG9 A;  1UJZ A;  2BHV A;  2AFD A;  2KR5 A;  3E2D A;  2GZG A;  2JO0 A;  1EIA A;  3G29 A;  1YIJ P;  4GR6 A;  2KOQ A;  2MVV A;  2GDY A;  2PEQ A;  3WBH A;  4F37 A;  1ACP A;  2JU2 A;  2PNG A;  2XZ1 C;  5KP6 B;  1F80 D;  2JAZ A;  3VRL C;  1E0H A;  2EHT A;  2LIU A;  2OTJ P;  4IZ6 A;  2PEI A;  1K9M Q;  1DNY A;  4QKO A;  2JQ4 A;  1K8A Q;  2KOS A;  2LIW A;  1JJ2 O;  1KLP A;  2EHS A;  3G1G A;  2JB0 A;  3B4Q A;  3M1M A;  1W2B O;  3Q20 A;  4COP A;  2XZ0 D;  4PXH B;  5EW5 E;  1VQM P;  2QEX P;  1VHN A;  2QA4 P;  3DS5 A;  1ZMB A;  1A8O A;  1QRJ A;  3CCE P;  3EJB A;  3EJD A;  3RG2 A;  2CGQ A;  1M6N A;  1VQN P;  5DCK A;  1Q7Y Q;  3CCJ P;  2Z44 A;  2FAC A;  1ZNV A;  2CQ8 A;  1VQ8 P;  2GZE A;  1KQS O;  3H0D A;  2FVF A;  3DS2 A;  3LMO A;  4CA3 A;  3CCM P;  4H2X C;  1YHQ P;  1HY8 A;  5HGO A;  5HGN A;  2LTE A;  3G6E P;  3DS4 A;  4U0C A;  4U0B A;  2JGP A;  2M5R A;  2E1M A;  3GJN A;  2FQ1 A;  2FVA A;  3CD6 P;  5JPA A;  3HZQ A;  5F2N A;  1BAJ A;  4R0M A;  1Q82 Q;  2L6E A;  4U0F A;  2X2B A;  2GDX A;  4XFY A;  3DS1 A;  2NO8 A;  2FAD A;  7CEI A;  1NQ4 A;  2L22 A;  2LOL A;  1VQ5 P;  2GDW A;  1UNK A;  5BS1 A;  1VQ4 P;  2PEM A;  2FQ2 A;  2K0D X;  2KGD A;  5F2K A;  3CMA P;  1GXH A;  2K93 A;  2KOD A;  3CE7 A;  2PEO A;  4M0I A;  1Q81 Q;  4NEO A;  4XFX A;  2VLP A;  3NTE A;  3CC4 P;  3GZM A;  3P05 A;  1QVG O;  4PWV B;  2CNR A;  1L0H A;  5EJD A;  2ERH A;  4HKG A;  2FQ0 A;  3G1I A;  1AYI A;  2ONT A;  4QNB A;  2VLO A;  2VLN A;  2EG5 A;  4MRT C;  2N6Y A;  2KOP A;  3G21 A;  4IPY A;  3CC2 P;  3CXC O;  2WPT A;  2MR8 A;  3G4S P;  1DV5 A;  1VQ7 P;  2CWO A;  2KGA A;  5HVC A;  2AVA A;  2L4B A;  2EIA A;  3DS3 A;  1D1D A;  2GZF A;  1VQ9 P;  1RNI A;  2VSQ A;  2AF8 A;  2KOO A;  4XRQ A;  3RG6 C;  4XFZ A;  2K0X A;  2BUO A;  1OR5 A;  1HQB A;  1YJN P;  5BS2 A;  2CG5 B;  5HGM A;  2MR7 A;  1GPJ A;  2FAE A;  2PY8 A;  5I4T G;  1YIT P;  2PEN A;  3LRY A;  1VQO P;  3CME P;  1M1K Q;  2Z45 A;  3U43 A;  5HV8 A;  2MY5 A;  2K2Q A;  5KP7 B;  3DTJ A;  2K92 A;  3CCQ P;  2GYK A;  2KGC A;  3G71 P;  3NY7 B;  2LL8 A;  4U0A A;  2GZI A;  2GZJ A;  1RO2 A;  1MZ8 A;  4COC A;  2DNW A;  3OW2 O;  2KG9 A;  1M74 A;  3H4E A;  4BPG A;  1VKU A;  1QVF O;  1IUQ A;  1Z6M A;  3G0V A;  1A43 A;  2XXM A;  2VLQ A;  1K73 Q;  4U0E A;  1YJW P;  1VQK P;  2MD9 A;  3G28 A;  2AFE A;  1YJ9 P;  3CCU P;  2LKI A;  2EFJ A;  3DPH A;  2L9F A;  3CCV P;  1KC8 Q;  2JBG A;  2M8N A;  1IMQ A;  1VQP P;  1VQ6 P;  3CCR P;  3GKL C;  5HGL A;  2N6Z A;  2MF4 A;  2L0Q A;  2Z46 A;  2JU1 A;  4BPH A;  5CZD B;  4H2W C;  3CPW O;  1EMV A;  2ROQ A;  2JYL A;  2KWL A;  1GXG A;  1VQL P;  2FHS C;  1L0I A;  3CC7 P;  4GR2 A;  3GZL A;  2KW2 A;  1IMP A;  2FVE A;  1YI2 P;  1RO0 A;  2KG6 A;  2OTL P;  1X3O A;  3I55 P;  1KD1 Q;  2K0Y A;  4PH0 A;  2LML A;  2PEJ A;  1Q86 Q;  2OAR A;  4BPF A;  2P9X A;  5KP8 B;  2DGY A;  3DS0 A;  2K94 A;  4PH1 A;  1EOQ A;  4XRO A;  4U0D A; 
#chains in the Genus database with same CATH homology
 4NEO A;  2KGC A;  1T8K A;  3NY7 B;  2N50 A;  2KOR A;  2LL8 A;  3GZM A;  2DNW A;  4PWV B;  3EJB A;  2KG9 A;  2CNR A;  2KGE A;  2N5H A;  3EJD A;  2N98 A;  4BPG A;  3RG2 A;  1L0H A;  2QNW A;  5EJD A;  1VKU A;  2CGQ A;  3EJE A;  2KG8 A;  4HKG A;  2MD9 A;  2FQ0 A;  2FAC A;  2CQ8 A;  2AFE A;  4H2Y C;  2FVF A;  3LMO A;  4CA3 A;  4H2X C;  2LKI A;  4MRT C;  1HY8 A;  2N6Y A;  2LPK A;  2L9F A;  1AF8 A;  2LTE A;  2MVU A;  2KOP A;  2N5I A;  2JGP A;  2M5R A;  2MR8 A;  4DG9 A;  1DV5 A;  2AFD A;  2FQ1 A;  2KGA A;  2N6Z A;  2KR5 A;  5HVC A;  2MF4 A;  2L0Q A;  2AVA A;  2JU1 A;  2L4B A;  2KOQ A;  4BPH A;  2MVV A;  2FVA A;  2GDY A;  5CZD B;  4H2W C;  2ROQ A;  2VSQ A;  1ACP A;  2AF8 A;  2JU2 A;  2KWL A;  2KOO A;  4R0M A;  2PNG A;  2XZ1 C;  2FHS C;  1L0I A;  5KP6 B;  2X2B A;  2K0X A;  1F80 D;  3GZL A;  2KW2 A;  1OR5 A;  2FVE A;  1HQB A;  2GDX A;  2EHT A;  2CG5 B;  2KG6 A;  2LIU A;  4IZ6 A;  2FAD A;  1X3O A;  2MR7 A;  2K0Y A;  2FAE A;  2LML A;  1NQ4 A;  2L22 A;  2LOL A;  2GDW A;  1DNY A;  4BPF A;  2FQ2 A;  2JQ4 A;  2KGD A;  2KOS A;  2LIW A;  5KP8 B;  1KLP A;  2EHS A;  2K93 A;  3CE7 A;  5HV8 A;  2MY5 A;  2K94 A;  2K2Q A;  2XZ0 D;  5KP7 B;  4PXH B;  2K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...