2M5RA

Solution structure of holo-acyl carrier protein of leishmania major
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
MNDVLTRVLEVVKNFEKVDASKVTPESHFVKDLGLNSLDVVEVVFAIEQEFILDIPDHDAEKIQSIPDAVEYIAQNPMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Acyl carrier protein
publication title NMR structures of the apo- and holo- forms of the acyl carrier protein of Leishmania major
rcsb
source organism Leishmania major
total genus 19
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2m5rA00
4MRTC 3EJEA 4IZ6A 2KG8A 2KOQA 2N98A 2VSQA 1NQ4A 2KORA 2KOOA 2XZ0D 2QNWA 2FQ1A 2KGCA 4HKGA 4H2YC 2KGDA 4BPFA 2GDYA 2N6ZA 3RG2A 2MR7A 2ROQA 2FQ2A 2FQ0A 4BPHA 1L0HA 1HY8A 5KP8B 2LIWA 2MR8A 5KP7B 1KLPA 4CA3A 2L4BA 2LMLA 2KOPA 3EJDA 5KP6B 1DNYA 1F80D 1AF8A 2KOSA 2LIUA 4PXHB 2JU1A 3NY7B 2CGQA 2CG5B 2KGAA 2CNRA 2DNWA 2AVAA 4H2XC 2FVEA 2PNGA 2AFDA 3GZLA 2LOLA 1ACPA 2L0QA 2XZ1C 1X3OA 2K0XA 2FVFA 2N5IA 2N6YA 2EHTA 2KR5A 2FVAA 1HQBA 2AF8A 2K2QA 2L9FA 2K93A 4H2WC 2KGEA 2KG9A 2KG6A 2EHSA 2JQ4A 2MVVA 2LKIA 4DG9A 1OR5A 2JU2A 2K94A 2FHSC 5EJDA 2AFEA 1VKUA 2MD9A 2FADA 2FACA 2MY5A 2LTEA 4R0MA 3GZMA 1T8KA 3LMOA 2K92A 2FAEA 2N50A 4NEOA 2GDXA 2K0YA 2MVUA 4PWVB 2GDWA 2N5HA 5HVCA 2M5RA 4BPGA 2CQ8A 1DV5A 5HV8A 2MF4A 2L22A 1L0IA 3CE7A 2JGPA 5CZDB 2KWLA 2KW2A 3EJBA 2LL8A 2LPKA 2X2BA
chains in the Genus database with same CATH superfamily
2EFJA 1IMQA 2K0DX 3CCSP 4F37A 1BXIA 1N8RQ 2XZ0D 2EIAA 2FQ1A 4BPFA 2GDYA 1GXHA 3G26A 4PH1A 2QA4P 3LRYA 3Q20A 2GZEA 1HY8A 3G21A 1KLPA 2OTJP 4CA3A 3G29A 3E2DA 2LMLA 5EW5E 2KOPA 3EJDA 5KP6B 1DNYA 5F2NA 1M6EX 1AF8A 1NJIQ 3HZQA 4PXHB 2BHVA 2GZIA 5HGOA 2CGQA 2CG5B 2CNRA 3CCEP 2PNGA 2GYKA 1VQ8P 1W2BO 1ACPA 1UNKA 2ONTA 1X3OA 2K0XA 4GR6A 1AYIA 5F2OA 2EHTA 3B5IA 1HQBA 1VQ4P 2CWOA 2L9FA 2KG9A 2PEMA 2EHSA 2PEOA 1VQNP 2M8LA 2AFEA 1A8OA 1VKUA 2MD9A 3CCMP 4QNBA 2NO8A 2LTEA 1Q81Q 2N50A 1GPJA 2PEJA 2GDWA 3HYBA 4UHPB 2MF4A 1VHNA 1L0IA 2LPKA 2KOQA 2N98A 1D1DA 1EIAA 3CC4P 2KOOA 4QKOA 2M8NA 5BS1A 2QNWA 2KGCA 3H4EA 5HGNA 1K9MQ 2N6ZA 3G6EP 2FQ0A 1L0HA 3CD6P 3DS4A 1Q82Q 2LIWA 2MR8A 3DS0A 1VQ5P 2L4BA 1K8AQ 3G71P 1BAJA 2JYLA 1QVGO 1F80D 2LIUA 1EMVA 2JO0A 1AUMA 3CCJP 1E6JP 3DPHA 4U0CA 2L6EA 2KGAA 2AVAA 1K73Q 4IPYA 3CC2P 2PENA 2PY8A 2AFDA 3CXCO 2LOLA 1YHQP 2PEIA 4XFZA 2P9XA 2N5IA 3I55P 1RNIA 3DS2A 2KR5A 2FVAA 1KQSO 2AF8A 3G1IA 1A43A 2KG6A 2MVVA 2VLQA 3DS3A 3DS1A 1Z6MA 3NTEA 2FADA 2MY5A 2XV6A 4GR2A 4R0MA 3VRLC 2GZFA 1QRJA 3G4SP 5DCKA 1YI2P 3CMAP 2K5XA 1VQKP 2M5RA 1IUQA 2KODA 3CE7A 2KWLA 3CCQP 7CEIA 3EJEA 1UJZA 2VSQA 3WBHA 3P05A 2KORA 1RO0A 2GZGA 4HKGA 1VQ7P 4H2YC 1M1KQ 3H47A 1QVFO 1S72P 1Q86Q 3DTJA 5BS2A 2Z45A 3RG2A 2MR7A 2FQ2A 2OARA 4BPHA 4COCA 1IMPA 5KP8B 1MZ8A 2XT1A 4U0DA 4U0AA 2PEQA 3RG6C 1JJ2O 2KOSA 2JU1A 3NY7B 2JBGA 3CCUP 3M1MA 1ZMBA 4H2XC 3I56P 4M0IA 3CCLP 1YJNP 3G0VA 1VQLP 2E1MA 2N6YA 2BUOA 2VLPA 3DS5A 2JB0A 3B4QA 2LF4A 4H2WC 2XXMA 1VQOP 1YITP 2LKIA 1M6NA 2FHSC 3OW2O 1EOQA 2FACA 2M8PA 3GKLC 1FR2A 3GZMA 3LMOA 2K92A 2GDXA 3GJNA 1RO2A 2K0YA 2MVUA 4PWVB 4U0BA 5HVCA 2EG5A 4BPGA 2CQ8A 2QEXP 2VLOA 1E0HA 2JGPA 4XRQA 5CZDB 2KW2A 2LL8A 4MRTC 2WPTA 2Z44A 2Z46A 4IZ6A 2KG8A 1NQ4A 1M74A 4U0EA 1Q7YQ 1KC8Q 1KD1Q 5HGLA 5I4TG 4U0FA 2KGDA 1VQ9P 1YJ9P 5JPAA 2ROQA 1YIJP 3U43A 1VQPP 5KP7B 2DGYA 2ERHA 2VLNA 5HGMA 2DNWA 3CC7P 5F2KA 2FVEA 3GZLA 2GZJA 2L0QA 2PEKA 3CPWO 2XZ1C 1K30A 2FVFA 3CCRP 3H0DA 1M90Q 3G1GA 4XFYA 2K2QA 2JAZA 4XFXA 2K93A 2KGEA 2OTLP 2JQ4A 3G28A 4DG9A 1OR5A 2JU2A 2K94A 2JYGA 5EJDA 1ZNVA 1VQMP 1CEIA 1VQ6P 3CCVP 1T8KA 4COPA 2FAEA 4NEOA 4XROA 3CMEP 1GXGA 3MGEA 2N5HA 1YJWP 4WYMA 1DV5A 5HV8A 2L22A 4PH0A 3EJBA 2X2BA
chains in the Genus database with same CATH topology
4MRTC 3EJEA 4IZ6A 2KG8A 2KOQA 2N98A 2VSQA 1NQ4A 2KORA 2KOOA 2XZ0D 2QNWA 2FQ1A 2KGCA 4HKGA 4H2YC 2KGDA 4BPFA 2GDYA 2N6ZA 3RG2A 2MR7A 2ROQA 2FQ2A 2FQ0A 4BPHA 1L0HA 1HY8A 5KP8B 2LIWA 2MR8A 5KP7B 1KLPA 4CA3A 2L4BA 2LMLA 2KOPA 3EJDA 5KP6B 1DNYA 1F80D 1AF8A 2KOSA 2LIUA 4PXHB 2JU1A 3NY7B 2CGQA 2CG5B 2KGAA 2CNRA 2DNWA 2AVAA 4H2XC 2FVEA 2PNGA 2AFDA 3GZLA 2LOLA 1ACPA 2L0QA 2XZ1C 1X3OA 2K0XA 2FVFA 2N5IA 2N6YA 2EHTA 2KR5A 2FVAA 1HQBA 2AF8A 2K2QA 2L9FA 2K93A 4H2WC 2KGEA 2KG9A 2KG6A 2EHSA 2JQ4A 2MVVA 2LKIA 4DG9A 1OR5A 2JU2A 2K94A 2FHSC 5EJDA 2AFEA 1VKUA 2MD9A 2FADA 2FACA 2MY5A 2LTEA 4R0MA 3GZMA 1T8KA 3LMOA 2K92A 2FAEA 2N50A 4NEOA 2GDXA 2K0YA 2MVUA 4PWVB 2GDWA 2N5HA 5HVCA 2M5RA 4BPGA 2CQ8A 1DV5A 5HV8A 2MF4A 2L22A 1L0IA 3CE7A 2JGPA 5CZDB 2KWLA 2KW2A 3EJBA 2LL8A 2LPKA 2X2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRT C;  3EJE A;  4IZ6 A;  2KG8 A;  2KOQ A;  2N98 A;  2VSQ A;  1NQ4 A;  2KOR A;  2KOO A;  2XZ0 D;  2QNW A;  2FQ1 A;  2KGC A;  4HKG A;  4H2Y C;  2KGD A;  4BPF A;  2GDY A;  2N6Z A;  3RG2 A;  2MR7 A;  2ROQ A;  2FQ2 A;  2FQ0 A;  4BPH A;  1L0H A;  1HY8 A;  5KP8 B;  2LIW A;  2MR8 A;  5KP7 B;  1KLP A;  4CA3 A;  2L4B A;  2LML A;  2KOP A;  3EJD A;  5KP6 B;  1DNY A;  1F80 D;  1AF8 A;  2KOS A;  2LIU A;  4PXH B;  2JU1 A;  3NY7 B;  2CGQ A;  2CG5 B;  2KGA A;  2CNR A;  2DNW A;  2AVA A;  4H2X C;  2FVE A;  2PNG A;  2AFD A;  3GZL A;  2LOL A;  1ACP A;  2L0Q A;  2XZ1 C;  1X3O A;  2K0X A;  2FVF A;  2N5I A;  2N6Y A;  2EHT A;  2KR5 A;  2FVA A;  1HQB A;  2AF8 A;  2K2Q A;  2L9F A;  2K93 A;  4H2W C;  2KGE A;  2KG9 A;  2KG6 A;  2EHS A;  2JQ4 A;  2MVV A;  2LKI A;  4DG9 A;  1OR5 A;  2JU2 A;  2K94 A;  2FHS C;  5EJD A;  2AFE A;  1VKU A;  2MD9 A;  2FAD A;  2FAC A;  2MY5 A;  2LTE A;  4R0M A;  3GZM A;  1T8K A;  3LMO A;  2K92 A;  2FAE A;  2N50 A;  4NEO A;  2GDX A;  2K0Y A;  2MVU A;  4PWV B;  2GDW A;  2N5H A;  5HVC A;  2M5R A;  4BPG A;  2CQ8 A;  1DV5 A;  5HV8 A;  2MF4 A;  2L22 A;  1L0I A;  3CE7 A;  2JGP A;  5CZD B;  2KWL A;  2KW2 A;  3EJB A;  2LL8 A;  2LPK A;  2X2B A; 
#chains in the Genus database with same CATH topology
 2EFJ A;  1IMQ A;  2K0D X;  3CCS P;  4F37 A;  1BXI A;  1N8R Q;  2XZ0 D;  2EIA A;  2FQ1 A;  4BPF A;  2GDY A;  1GXH A;  3G26 A;  4PH1 A;  2QA4 P;  3LRY A;  3Q20 A;  2GZE A;  1HY8 A;  3G21 A;  1KLP A;  2OTJ P;  4CA3 A;  3G29 A;  3E2D A;  2LML A;  5EW5 E;  2KOP A;  3EJD A;  5KP6 B;  1DNY A;  5F2N A;  1M6E X;  1AF8 A;  1NJI Q;  3HZQ A;  4PXH B;  2BHV A;  2GZI A;  5HGO A;  2CGQ A;  2CG5 B;  2CNR A;  3CCE P;  2PNG A;  2GYK A;  1VQ8 P;  1W2B O;  1ACP A;  1UNK A;  2ONT A;  1X3O A;  2K0X A;  4GR6 A;  1AYI A;  5F2O A;  2EHT A;  3B5I A;  1HQB A;  1VQ4 P;  2CWO A;  2L9F A;  2KG9 A;  2PEM A;  2EHS A;  2PEO A;  1VQN P;  2M8L A;  2AFE A;  1A8O A;  1VKU A;  2MD9 A;  3CCM P;  4QNB A;  2NO8 A;  2LTE A;  1Q81 Q;  2N50 A;  1GPJ A;  2PEJ A;  2GDW A;  3HYB A;  4UHP B;  2MF4 A;  1VHN A;  1L0I A;  2LPK A;  2KOQ A;  2N98 A;  1D1D A;  1EIA A;  3CC4 P;  2KOO A;  4QKO A;  2M8N A;  5BS1 A;  2QNW A;  2KGC A;  3H4E A;  5HGN A;  1K9M Q;  2N6Z A;  3G6E P;  2FQ0 A;  1L0H A;  3CD6 P;  3DS4 A;  1Q82 Q;  2LIW A;  2MR8 A;  3DS0 A;  1VQ5 P;  2L4B A;  1K8A Q;  3G71 P;  1BAJ A;  2JYL A;  1QVG O;  1F80 D;  2LIU A;  1EMV A;  2JO0 A;  1AUM A;  3CCJ P;  1E6J P;  3DPH A;  4U0C A;  2L6E A;  2KGA A;  2AVA A;  1K73 Q;  4IPY A;  3CC2 P;  2PEN A;  2PY8 A;  2AFD A;  3CXC O;  2LOL A;  1YHQ P;  2PEI A;  4XFZ A;  2P9X A;  2N5I A;  3I55 P;  1RNI A;  3DS2 A;  2KR5 A;  2FVA A;  1KQS O;  2AF8 A;  3G1I A;  1A43 A;  2KG6 A;  2MVV A;  2VLQ A;  3DS3 A;  3DS1 A;  1Z6M A;  3NTE A;  2FAD A;  2MY5 A;  2XV6 A;  4GR2 A;  4R0M A;  3VRL C;  2GZF A;  1QRJ A;  3G4S P;  5DCK A;  1YI2 P;  3CMA P;  2K5X A;  1VQK P;  2M5R A;  1IUQ A;  2KOD A;  3CE7 A;  2KWL A;  3CCQ P;  7CEI A;  3EJE A;  1UJZ A;  2VSQ A;  3WBH A;  3P05 A;  2KOR A;  1RO0 A;  2GZG A;  4HKG A;  1VQ7 P;  4H2Y C;  1M1K Q;  3H47 A;  1QVF O;  1S72 P;  1Q86 Q;  3DTJ A;  5BS2 A;  2Z45 A;  3RG2 A;  2MR7 A;  2FQ2 A;  2OAR A;  4BPH A;  4COC A;  1IMP A;  5KP8 B;  1MZ8 A;  2XT1 A;  4U0D A;  4U0A A;  2PEQ A;  3RG6 C;  1JJ2 O;  2KOS A;  2JU1 A;  3NY7 B;  2JBG A;  3CCU P;  3M1M A;  1ZMB A;  4H2X C;  3I56 P;  4M0I A;  3CCL P;  1YJN P;  3G0V A;  1VQL P;  2E1M A;  2N6Y A;  2BUO A;  2VLP A;  3DS5 A;  2JB0 A;  3B4Q A;  2LF4 A;  4H2W C;  2XXM A;  1VQO P;  1YIT P;  2LKI A;  1M6N A;  2FHS C;  3OW2 O;  1EOQ A;  2FAC A;  2M8P A;  3GKL C;  1FR2 A;  3GZM A;  3LMO A;  2K92 A;  2GDX A;  3GJN A;  1RO2 A;  2K0Y A;  2MVU A;  4PWV B;  4U0B A;  5HVC A;  2EG5 A;  4BPG A;  2CQ8 A;  2QEX P;  2VLO A;  1E0H A;  2JGP A;  4XRQ A;  5CZD B;  2KW2 A;  2LL8 A;  4MRT C;  2WPT A;  2Z44 A;  2Z46 A;  4IZ6 A;  2KG8 A;  1NQ4 A;  1M74 A;  4U0E A;  1Q7Y Q;  1KC8 Q;  1KD1 Q;  5HGL A;  5I4T G;  4U0F A;  2KGD A;  1VQ9 P;  1YJ9 P;  5JPA A;  2ROQ A;  1YIJ P;  3U43 A;  1VQP P;  5KP7 B;  2DGY A;  2ERH A;  2VLN A;  5HGM A;  2DNW A;  3CC7 P;  5F2K A;  2FVE A;  3GZL A;  2GZJ A;  2L0Q A;  2PEK A;  3CPW O;  2XZ1 C;  1K30 A;  2FVF A;  3CCR P;  3H0D A;  1M90 Q;  3G1G A;  4XFY A;  2K2Q A;  2JAZ A;  4XFX A;  2K93 A;  2KGE A;  2OTL P;  2JQ4 A;  3G28 A;  4DG9 A;  1OR5 A;  2JU2 A;  2K94 A;  2JYG A;  5EJD A;  1ZNV A;  1VQM P;  1CEI A;  1VQ6 P;  3CCV P;  1T8K A;  4COP A;  2FAE A;  4NEO A;  4XRO A;  3CME P;  1GXG A;  3MGE A;  2N5H A;  1YJW P;  4WYM A;  1DV5 A;  5HV8 A;  2L22 A;  4PH0 A;  3EJB A;  2X2B A; 
#chains in the Genus database with same CATH homology
 4MRT C;  3EJE A;  4IZ6 A;  2KG8 A;  2KOQ A;  2N98 A;  2VSQ A;  1NQ4 A;  2KOR A;  2KOO A;  2XZ0 D;  2QNW A;  2FQ1 A;  2KGC A;  4HKG A;  4H2Y C;  2KGD A;  4BPF A;  2GDY A;  2N6Z A;  3RG2 A;  2MR7 A;  2ROQ A;  2FQ2 A;  2FQ0 A;  4BPH A;  1L0H A;  1HY8 A;  5KP8 B;  2LIW A;  2MR8 A;  5KP7 B;  1KLP A;  4CA3 A;  2L4B A;  2LML A;  2KOP A;  3EJD A;  5KP6 B;  1DNY A;  1F80 D;  1AF8 A;  2KOS A;  2LIU A;  4PXH B;  2JU1 A;  3NY7 B;  2CGQ A;  2CG5 B;  2KGA A;  2CNR A;  2DNW A;  2AVA A;  4H2X C;  2FVE A;  2PNG A;  2AFD A;  3GZL A;  2LOL A;  1ACP A;  2L0Q A;  2XZ1 C;  1X3O A;  2K0X A;  2FVF A;  2N5I A;  2N6Y A;  2EHT A;  2KR5 A;  2FVA A;  1HQB A;  2AF8 A;  2K2Q A;  2L9F A;  2K93 A;  4H2W C;  2KGE A;  2KG9 A;  2KG6 A;  2EHS A;  2JQ4 A;  2MVV A;  2LKI A;  4DG9 A;  1OR5 A;  2JU2 A;  2K94 A;  2FHS C;  5EJD A;  2AFE A;  1VKU A;  2MD9 A;  2FAD A;  2FAC A;  2MY5 A;  2LTE A;  4R0M A;  3GZM A;  1T8K A;  3LMO A;  2K92 A;  2FAE A;  2N50 A;  4NEO A;  2GDX A;  2K0Y A;  2MVU A;  4PWV B;  2GDW A;  2N5H A;  5HVC A;  2M5R A;  4BPG A;  2CQ8 A;  1DV5 A;  5HV8 A;  2MF4 A;  2L22 A;  1L0I A;  3CE7 A;  2JGP A;  5CZD B;  2KWL A;  2KW2 A;  3EJB A;  2LL8 A;  2LPK A;  2X2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...