2QNWA

Toxoplasma gondii apicoplast-targeted acyl carrier protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
SDDRPLLERVKDVVADQLGVDRARINPESNFIKDLDADSLDSVELVMAFEEKFGVSIPDEEASKIATVQDALSYIEKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Toxoplasma gondii apicoplast-targeted acyl carrier protein.
rcsb
source organism Toxoplasma gondii
molecule tags Signaling protein
total genus 27
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2qnwA00
2LTEA 4R0MA 2JU1A 2CNRA 2LOLA 3NY7B 2MF4A 4H2XC 5EJDA 2N50A 2FAEA 4BPFA 2M5RA 2FQ0A 2K0YA 2KGEA 3EJDA 4HKGA 2KOQA 1L0HA 2AF8A 2KG9A 1OR5A 2FHSC 2EHSA 1KLPA 2K2QA 2KGAA 1ACPA 4IZ6A 2KWLA 1DV5A 1HY8A 2XZ0D 2K92A 2N6ZA 2X2BA 1F80D 5KP6B 2FACA 2XZ1C 2L4BA 4H2WC 5KP7B 1VKUA 2MVVA 3EJBA 2LIUA 2QNWA 2K94A 2FVEA 2N5HA 2EHTA 2ROQA 2CQ8A 2KGDA 2K0XA 1X3OA 2L0QA 4H2YC 2CGQA 4NEOA 4MRTC 1HQBA 2CG5B 1DNYA 4BPHA 5KP8B 2LPKA 2MR7A 2FQ1A 5HV8A 2DNWA 4DG9A 3RG2A 2N5IA 2N6YA 2LKIA 2LMLA 2AFEA 2MR8A 2KORA 1T8KA 2KOOA 1L0IA 2L22A 2AFDA 1NQ4A 2FQ2A 2FVAA 2KOSA 2MVUA 2PNGA 2KW2A 3CE7A 3GZMA 3LMOA 2VSQA 2K93A 5CZDB 4PWVB 2AVAA 2JU2A 2JGPA 2LL8A 4PXHB 3GZLA 2FADA 2LIWA 2GDYA 2MD9A 2GDXA 2N98A 3EJEA 2KG6A 1AF8A 5HVCA 2FVFA 2GDWA 2KGCA 2JQ4A 2KOPA 2L9FA 4BPGA 4CA3A 2MY5A 2KG8A 2KR5A
chains in the Genus database with same CATH superfamily
1ZNVA 4PH1A 4U0BA 3G0VA 3DS0A 3CXCO 2KGEA 2ONTA 1L0HA 2FHSC 2QEXP 1KD1Q 4F37A 3CMAP 3B4QA 1HY8A 2XZ0D 2K92A 1GPJA 1E0HA 3DS3A 2M8LA 1VQNP 3G6EP 3DTJA 3GKLC 1KQSO 5KP7B 3GJNA 2BUOA 2QNWA 2K94A 1RO0A 4XFXA 2KGDA 2K0XA 1X3OA 2BHVA 4XRQA 4GR2A 1RNIA 1HQBA 1A43A 3CMEP 2LF4A 2MR7A 2DNWA 3CCSP 2N5IA 3HZQA 1YITP 2AFEA 1M90Q 2L22A 1NQ4A 2AFDA 3DS1A 2FQ2A 1YIJP 1W2BO 2MVUA 2PNGA 2KW2A 1D1DA 4U0CA 3Q20A 5F2OA 5CZDB 3CCRP 2K0DX 1YJ9P 1QVFO 1Q7YQ 3E2DA 2KG6A 1VQLP 4UHPB 2GDWA 2QA4P 2KOPA 1QRJA 2L9FA 3P05A 1Z6MA 3H0DA 3U43A 5F2NA 2LTEA 2VLOA 3NY7B 5F2KA 2GZFA 4U0FA 2Z45A 5BS2A 1M6NA 4U0EA 2K0YA 3EJDA 3M1MA 1UJZA 2GZIA 4HKGA 2AF8A 1OR5A 2EHSA 1KLPA 4IZ6A 2KWLA 1YJWP 3G71P 1VQ6P 3H4EA 5BS1A 1S72P 3CC2P 2X2BA 1VQ9P 2JO0A 1VQPP 5KP6B 3VRLC 4WYMA 1VQKP 3CC4P 1UNKA 2M8NA 2LIUA 1YI2P 2ROQA 2CQ8A 1A8OA 1AYIA 1K8AQ 2CG5B 2GZEA 1IMPA 3CCMP 2GZGA 1GXGA 1Q81Q 2DGYA 2N6YA 3MGEA 2PEOA 2LMLA 3NTEA 2PEMA 3HYBA 2FVAA 1CEIA 1Q82Q 2PEIA 3LMOA 1VHNA 3OW2O 2VSQA 1VQ5P 2K93A 4M0IA 2JGPA 3G1GA 2LL8A 4PXHB 3H47A 2OTLP 1ZMBA 1BAJA 3B5IA 2GDYA 2OARA 1AF8A 5HVCA 1AUMA 1QVGO 4XFZA 4CA3A 4QKOA 2KG8A 1NJIQ 4GR6A 2CNRA 2LOLA 1YHQP 2JAZA 5EJDA 3WBHA 2M5RA 2NO8A 4PH0A 2KOQA 2XV6A 1IUQA 2KG9A 2XT1A 3LRYA 2OTJP 1ACPA 1DV5A 2PEKA 1IMQA 2N6ZA 1F80D 2XXMA 1K30A 2K5XA 1VQ7P 2XZ1C 2L4BA 2PY8A 1VKUA 2CWOA 2EG5A 3G28A 2N5HA 2EHTA 4H2YC 1VQ8P 2CGQA 1DNYA 4BPHA 5EW5E 5KP8B 3CCVP 3G21A 2LPKA 2FQ1A 1EIAA 5HGNA 5I4TG 4DG9A 1EOQA 3RG2A 2LKIA 2KODA 3I56P 3CCJP 2MR8A 2KORA 1T8KA 1L0IA 2KOSA 3CE7A 3GZMA 1YJNP 4COPA 2JYGA 4PWVB 2JU2A 2JB0A 2FADA 3DS5A 2GYKA 2LIWA 2GZJA 2N98A 3RG6C 2EFJA 2KGCA 1EMVA 2JQ4A 5DCKA 1VQOP 1GXHA 3CCQP 2JYLA 4R0MA 2JU1A 2MF4A 5JPAA 4XFYA 4H2XC 2P9XA 1K9MQ 2N50A 2FAEA 4BPFA 2M8PA 2FQ0A 2E1MA 3CPWO 3CCLP 2PEQA 1K73Q 5HGLA 2Z46A 2K2QA 2KGAA 2VLNA 4QNBA 3CCEP 4COCA 3CC7P 1RO2A 2L6EA 2Z44A 2JBGA 4IPYA 3DS2A 2FACA 2VLPA 1BXIA 2WPTA 4H2WC 1VQMP 4U0DA 2MVVA 3EJBA 2FVEA 2L0QA 2PEJA 4NEOA 4MRTC 4U0AA 3G26A 3I55P 3G1IA 3G29A 3CD6P 3DS4A 5HV8A 1M74A 1Q86Q 1JJ2O 2VLQA 2KOOA 2PENA 3DPHA 2EIAA 1VQ4P 1FR2A 1M6EX 3CCUP 1E6JP 2AVAA 1KC8Q 3GZLA 2ERHA 2MD9A 2GDXA 1N8RQ 3EJEA 2FVFA 1MZ8A 5HGOA 7CEIA 5HGMA 4BPGA 4XROA 2MY5A 3G4SP 2KR5A 1M1KQ
chains in the Genus database with same CATH topology
2LTEA 4R0MA 2JU1A 2CNRA 2LOLA 3NY7B 2MF4A 4H2XC 5EJDA 2N50A 2FAEA 4BPFA 2M5RA 2FQ0A 2K0YA 2KGEA 3EJDA 4HKGA 2KOQA 1L0HA 2AF8A 2KG9A 1OR5A 2FHSC 2EHSA 1KLPA 2K2QA 2KGAA 1ACPA 4IZ6A 2KWLA 1DV5A 1HY8A 2XZ0D 2K92A 2N6ZA 2X2BA 1F80D 5KP6B 2FACA 2XZ1C 2L4BA 4H2WC 5KP7B 1VKUA 2MVVA 3EJBA 2LIUA 2QNWA 2K94A 2FVEA 2N5HA 2EHTA 2ROQA 2CQ8A 2KGDA 2K0XA 1X3OA 2L0QA 4H2YC 2CGQA 4NEOA 4MRTC 1HQBA 2CG5B 1DNYA 4BPHA 5KP8B 2LPKA 2MR7A 2FQ1A 5HV8A 2DNWA 4DG9A 3RG2A 2N5IA 2N6YA 2LKIA 2LMLA 2AFEA 2MR8A 2KORA 1T8KA 2KOOA 1L0IA 2L22A 2AFDA 1NQ4A 2FQ2A 2FVAA 2KOSA 2MVUA 2PNGA 2KW2A 3CE7A 3GZMA 3LMOA 2VSQA 2K93A 5CZDB 4PWVB 2AVAA 2JU2A 2JGPA 2LL8A 4PXHB 3GZLA 2FADA 2LIWA 2GDYA 2MD9A 2GDXA 2N98A 3EJEA 2KG6A 1AF8A 5HVCA 2FVFA 2GDWA 2KGCA 2JQ4A 2KOPA 2L9FA 4BPGA 4CA3A 2MY5A 2KG8A 2KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTE A;  4R0M A;  2JU1 A;  2CNR A;  2LOL A;  3NY7 B;  2MF4 A;  4H2X C;  5EJD A;  2N50 A;  2FAE A;  4BPF A;  2M5R A;  2FQ0 A;  2K0Y A;  2KGE A;  3EJD A;  4HKG A;  2KOQ A;  1L0H A;  2AF8 A;  2KG9 A;  1OR5 A;  2FHS C;  2EHS A;  1KLP A;  2K2Q A;  2KGA A;  1ACP A;  4IZ6 A;  2KWL A;  1DV5 A;  1HY8 A;  2XZ0 D;  2K92 A;  2N6Z A;  2X2B A;  1F80 D;  5KP6 B;  2FAC A;  2XZ1 C;  2L4B A;  4H2W C;  5KP7 B;  1VKU A;  2MVV A;  3EJB A;  2LIU A;  2QNW A;  2K94 A;  2FVE A;  2N5H A;  2EHT A;  2ROQ A;  2CQ8 A;  2KGD A;  2K0X A;  1X3O A;  2L0Q A;  4H2Y C;  2CGQ A;  4NEO A;  4MRT C;  1HQB A;  2CG5 B;  1DNY A;  4BPH A;  5KP8 B;  2LPK A;  2MR7 A;  2FQ1 A;  5HV8 A;  2DNW A;  4DG9 A;  3RG2 A;  2N5I A;  2N6Y A;  2LKI A;  2LML A;  2AFE A;  2MR8 A;  2KOR A;  1T8K A;  2KOO A;  1L0I A;  2L22 A;  2AFD A;  1NQ4 A;  2FQ2 A;  2FVA A;  2KOS A;  2MVU A;  2PNG A;  2KW2 A;  3CE7 A;  3GZM A;  3LMO A;  2VSQ A;  2K93 A;  5CZD B;  4PWV B;  2AVA A;  2JU2 A;  2JGP A;  2LL8 A;  4PXH B;  3GZL A;  2FAD A;  2LIW A;  2GDY A;  2MD9 A;  2GDX A;  2N98 A;  3EJE A;  2KG6 A;  1AF8 A;  5HVC A;  2FVF A;  2GDW A;  2KGC A;  2JQ4 A;  2KOP A;  2L9F A;  4BPG A;  4CA3 A;  2MY5 A;  2KG8 A;  2KR5 A; 
#chains in the Genus database with same CATH topology
 1ZNV A;  4PH1 A;  4U0B A;  3G0V A;  3DS0 A;  3CXC O;  2KGE A;  2ONT A;  1L0H A;  2FHS C;  2QEX P;  1KD1 Q;  4F37 A;  3CMA P;  3B4Q A;  1HY8 A;  2XZ0 D;  2K92 A;  1GPJ A;  1E0H A;  3DS3 A;  2M8L A;  1VQN P;  3G6E P;  3DTJ A;  3GKL C;  1KQS O;  5KP7 B;  3GJN A;  2BUO A;  2QNW A;  2K94 A;  1RO0 A;  4XFX A;  2KGD A;  2K0X A;  1X3O A;  2BHV A;  4XRQ A;  4GR2 A;  1RNI A;  1HQB A;  1A43 A;  3CME P;  2LF4 A;  2MR7 A;  2DNW A;  3CCS P;  2N5I A;  3HZQ A;  1YIT P;  2AFE A;  1M90 Q;  2L22 A;  1NQ4 A;  2AFD A;  3DS1 A;  2FQ2 A;  1YIJ P;  1W2B O;  2MVU A;  2PNG A;  2KW2 A;  1D1D A;  4U0C A;  3Q20 A;  5F2O A;  5CZD B;  3CCR P;  2K0D X;  1YJ9 P;  1QVF O;  1Q7Y Q;  3E2D A;  2KG6 A;  1VQL P;  4UHP B;  2GDW A;  2QA4 P;  2KOP A;  1QRJ A;  2L9F A;  3P05 A;  1Z6M A;  3H0D A;  3U43 A;  5F2N A;  2LTE A;  2VLO A;  3NY7 B;  5F2K A;  2GZF A;  4U0F A;  2Z45 A;  5BS2 A;  1M6N A;  4U0E A;  2K0Y A;  3EJD A;  3M1M A;  1UJZ A;  2GZI A;  4HKG A;  2AF8 A;  1OR5 A;  2EHS A;  1KLP A;  4IZ6 A;  2KWL A;  1YJW P;  3G71 P;  1VQ6 P;  3H4E A;  5BS1 A;  1S72 P;  3CC2 P;  2X2B A;  1VQ9 P;  2JO0 A;  1VQP P;  5KP6 B;  3VRL C;  4WYM A;  1VQK P;  3CC4 P;  1UNK A;  2M8N A;  2LIU A;  1YI2 P;  2ROQ A;  2CQ8 A;  1A8O A;  1AYI A;  1K8A Q;  2CG5 B;  2GZE A;  1IMP A;  3CCM P;  2GZG A;  1GXG A;  1Q81 Q;  2DGY A;  2N6Y A;  3MGE A;  2PEO A;  2LML A;  3NTE A;  2PEM A;  3HYB A;  2FVA A;  1CEI A;  1Q82 Q;  2PEI A;  3LMO A;  1VHN A;  3OW2 O;  2VSQ A;  1VQ5 P;  2K93 A;  4M0I A;  2JGP A;  3G1G A;  2LL8 A;  4PXH B;  3H47 A;  2OTL P;  1ZMB A;  1BAJ A;  3B5I A;  2GDY A;  2OAR A;  1AF8 A;  5HVC A;  1AUM A;  1QVG O;  4XFZ A;  4CA3 A;  4QKO A;  2KG8 A;  1NJI Q;  4GR6 A;  2CNR A;  2LOL A;  1YHQ P;  2JAZ A;  5EJD A;  3WBH A;  2M5R A;  2NO8 A;  4PH0 A;  2KOQ A;  2XV6 A;  1IUQ A;  2KG9 A;  2XT1 A;  3LRY A;  2OTJ P;  1ACP A;  1DV5 A;  2PEK A;  1IMQ A;  2N6Z A;  1F80 D;  2XXM A;  1K30 A;  2K5X A;  1VQ7 P;  2XZ1 C;  2L4B A;  2PY8 A;  1VKU A;  2CWO A;  2EG5 A;  3G28 A;  2N5H A;  2EHT A;  4H2Y C;  1VQ8 P;  2CGQ A;  1DNY A;  4BPH A;  5EW5 E;  5KP8 B;  3CCV P;  3G21 A;  2LPK A;  2FQ1 A;  1EIA A;  5HGN A;  5I4T G;  4DG9 A;  1EOQ A;  3RG2 A;  2LKI A;  2KOD A;  3I56 P;  3CCJ P;  2MR8 A;  2KOR A;  1T8K A;  1L0I A;  2KOS A;  3CE7 A;  3GZM A;  1YJN P;  4COP A;  2JYG A;  4PWV B;  2JU2 A;  2JB0 A;  2FAD A;  3DS5 A;  2GYK A;  2LIW A;  2GZJ A;  2N98 A;  3RG6 C;  2EFJ A;  2KGC A;  1EMV A;  2JQ4 A;  5DCK A;  1VQO P;  1GXH A;  3CCQ P;  2JYL A;  4R0M A;  2JU1 A;  2MF4 A;  5JPA A;  4XFY A;  4H2X C;  2P9X A;  1K9M Q;  2N50 A;  2FAE A;  4BPF A;  2M8P A;  2FQ0 A;  2E1M A;  3CPW O;  3CCL P;  2PEQ A;  1K73 Q;  5HGL A;  2Z46 A;  2K2Q A;  2KGA A;  2VLN A;  4QNB A;  3CCE P;  4COC A;  3CC7 P;  1RO2 A;  2L6E A;  2Z44 A;  2JBG A;  4IPY A;  3DS2 A;  2FAC A;  2VLP A;  1BXI A;  2WPT A;  4H2W C;  1VQM P;  4U0D A;  2MVV A;  3EJB A;  2FVE A;  2L0Q A;  2PEJ A;  4NEO A;  4MRT C;  4U0A A;  3G26 A;  3I55 P;  3G1I A;  3G29 A;  3CD6 P;  3DS4 A;  5HV8 A;  1M74 A;  1Q86 Q;  1JJ2 O;  2VLQ A;  2KOO A;  2PEN A;  3DPH A;  2EIA A;  1VQ4 P;  1FR2 A;  1M6E X;  3CCU P;  1E6J P;  2AVA A;  1KC8 Q;  3GZL A;  2ERH A;  2MD9 A;  2GDX A;  1N8R Q;  3EJE A;  2FVF A;  1MZ8 A;  5HGO A;  7CEI A;  5HGM A;  4BPG A;  4XRO A;  2MY5 A;  3G4S P;  2KR5 A;  1M1K Q; 
#chains in the Genus database with same CATH homology
 2LTE A;  4R0M A;  2JU1 A;  2CNR A;  2LOL A;  3NY7 B;  2MF4 A;  4H2X C;  5EJD A;  2N50 A;  2FAE A;  4BPF A;  2M5R A;  2FQ0 A;  2K0Y A;  2KGE A;  3EJD A;  4HKG A;  2KOQ A;  1L0H A;  2AF8 A;  2KG9 A;  1OR5 A;  2FHS C;  2EHS A;  1KLP A;  2K2Q A;  2KGA A;  1ACP A;  4IZ6 A;  2KWL A;  1DV5 A;  1HY8 A;  2XZ0 D;  2K92 A;  2N6Z A;  2X2B A;  1F80 D;  5KP6 B;  2FAC A;  2XZ1 C;  2L4B A;  4H2W C;  5KP7 B;  1VKU A;  2MVV A;  3EJB A;  2LIU A;  2QNW A;  2K94 A;  2FVE A;  2N5H A;  2EHT A;  2ROQ A;  2CQ8 A;  2KGD A;  2K0X A;  1X3O A;  2L0Q A;  4H2Y C;  2CGQ A;  4NEO A;  4MRT C;  1HQB A;  2CG5 B;  1DNY A;  4BPH A;  5KP8 B;  2LPK A;  2MR7 A;  2FQ1 A;  5HV8 A;  2DNW A;  4DG9 A;  3RG2 A;  2N5I A;  2N6Y A;  2LKI A;  2LML A;  2AFE A;  2MR8 A;  2KOR A;  1T8K A;  2KOO A;  1L0I A;  2L22 A;  2AFD A;  1NQ4 A;  2FQ2 A;  2FVA A;  2KOS A;  2MVU A;  2PNG A;  2KW2 A;  3CE7 A;  3GZM A;  3LMO A;  2VSQ A;  2K93 A;  5CZD B;  4PWV B;  2AVA A;  2JU2 A;  2JGP A;  2LL8 A;  4PXH B;  3GZL A;  2FAD A;  2LIW A;  2GDY A;  2MD9 A;  2GDX A;  2N98 A;  3EJE A;  2KG6 A;  1AF8 A;  5HVC A;  2FVF A;  2GDW A;  2KGC A;  2JQ4 A;  2KOP A;  2L9F A;  4BPG A;  4CA3 A;  2MY5 A;  2KG8 A;  2KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...