2QNWA

Toxoplasma gondii apicoplast-targeted acyl carrier protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
80
structure length
80
Chain Sequence
SDDRPLLERVKDVVADQLGVDRARINPESNFIKDLDADSLDSVELVMAFEEKFGVSIPDEEASKIATVQDALSYIEKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Acyl carrier protein
publication title Toxoplasma gondii apicoplast-targeted acyl carrier protein.
rcsb
source organism Toxoplasma gondii
total genus 27
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2007-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2qnwA00
1VKUA 2VSQA 2LOLA 1NQ4A 2CNRA 2MF4A 2N50A 2JQ4A 4H2YC 2FQ2A 2LKIA 2K94A 2XZ0D 2ROQA 2AFDA 2GDXA 2CQ8A 2QNWA 2FADA 2LMLA 2FACA 1DV5A 4PXHB 2LL8A 4BPGA 5KP6B 2FHSC 1F80D 2KW2A 2KOQA 2FVEA 2LIUA 2AVAA 2LPKA 2L9FA 2M5RA 4BPHA 2MD9A 2LIWA 3EJEA 2JU2A 2L0QA 2MVUA 2K2QA 4H2WC 2KG8A 2K0XA 2KGEA 2MVVA 2GDWA 1OR5A 3RG2A 4CA3A 2L22A 2KR5A 1KLPA 5CZDB 3LMOA 2KWLA 5HVCA 4H2XC 4NEOA 2XZ1C 4R0MA 2PNGA 4MRTC 1HQBA 2K0YA 5HV8A 3CE7A 2N6YA 2L4BA 1HY8A 2EHSA 2FVFA 5EJDA 1T8KA 5KP7B 2CG5B 3NY7B 1DNYA 2KG6A 1ACPA 1L0HA 2AFEA 2N5IA 2KGAA 2KGDA 2EHTA 2FQ1A 2N98A 2N6ZA 4BPFA 1AF8A 2KG9A 2DNWA 2MR7A 2CGQA 2KOPA 2JU1A 3GZLA 4PWVB 1L0IA 2FAEA 2KOOA 2KGCA 2FVAA 3EJBA 2KORA 4DG9A 2MY5A 2X2BA 2AF8A 4HKGA 3GZMA 2FQ0A 1X3OA 2N5HA 2GDYA 4IZ6A 2K92A 5KP8B 2KOSA 2LTEA 3EJDA 2K93A 2MR8A 2JGPA
chains in the Genus database with same CATH superfamily
2VSQA 1NQ4A 2MF4A 1ZNVA 3CXCO 1VQ5P 2ROQA 2GZFA 2CQ8A 1YJNP 2KW2A 1VQOP 2KOQA 2ERHA 2OTJP 2LIUA 3DS3A 3E2DA 2L9FA 4BPHA 1K30A 4IPYA 2GZIA 2K2QA 4COCA 2KGEA 1GXGA 2PEJA 1NJIQ 2JBGA 4GR2A 3P05A 3CCVP 1HQBA 3H4EA 2N6YA 4U0CA 3B5IA 3CPWO 1VQNP 3CCUP 1GPJA 1VQKP 2EHSA 2M8PA 1T8KA 1M1KQ 1KQSO 2EG5A 1Q82Q 1CEIA 1VQMP 3CD6P 1Z6MA 2K0DX 4BPFA 5HGMA 2DNWA 2MR7A 2CGQA 3B4QA 1A43A 4XRQA 1BXIA 1N8RQ 3GZLA 1YHQP 2FAEA 2Z45A 2KORA 2X2BA 1QVFO 2JO0A 5HGOA 1RNIA 1VQ9P 5F2OA 1M74A 2ONTA 2LTEA 3EJDA 1YI2P 2OARA 2MR8A 2PEMA 1VKUA 2LOLA 2CNRA 2XV6A 2N50A 1D1DA 2XZ0D 3DS0A 2GDXA 3DS1A 2QNWA 1QRJA 2LMLA 1DV5A 3G0VA 5HGNA 5EW5E 2OTLP 5KP6B 1EMVA 2AVAA 2LPKA 3CMAP 3I56P 2M5RA 3G29A 3G6EP 3CCQP 7CEIA 2K0XA 2KODA 2GDWA 1OR5A 1K73Q 2VLQA 3LMOA 1EOQA 1YJWP 4QKOA 5HVCA 4U0AA 1KD1Q 2L6EA 4H2XC 1S72P 2PNGA 5F2NA 1K9MQ 2CWOA 2K0YA 3G71P 2LF4A 3CMEP 2L4BA 1HY8A 2GZEA 2JYGA 2QEXP 3G26A 5EJDA 2CG5B 1DNYA 2KG6A 1ACPA 2E1MA 4UHPB 1K8AQ 2AFEA 2N5IA 4PH0A 2KGDA 2EHTA 2FQ1A 2PEKA 4QNBA 1RO2A 3VRLC 4XFZA 2GZJA 2JU1A 2JYLA 5DCKA 1L0IA 2KGCA 4DG9A 3LRYA 5BS1A 4HKGA 2FQ0A 1X3OA 5HGLA 2DGYA 2EIAA 4XFYA 5KP8B 1IUQA 1IMPA 2K93A 4XFXA 2P9XA 3G1GA 3CCJP 2JQ4A 2PEIA 2FQ2A 2LKIA 1Q86Q 1M90Q 2FACA 1IMQA 2LL8A 5F2KA 4BPGA 2FHSC 2M8NA 1F80D 1GXHA 2JB0A 2VLPA 3M1MA 1W2BO 3OW2O 3EJEA 2MVUA 4XROA 4H2WC 2KG8A 3DS2A 1FR2A 2MVVA 3CCEP 3G4SP 3RG2A 3RG6C 2KR5A 2BUOA 2KWLA 2PENA 2GYKA 3Q20A 2XZ1C 4MRTC 1UNKA 3CC2P 4F37A 2EFJA 2XT1A 1ZMBA 3H47A 3U43A 5KP7B 5JPAA 3GJNA 2Z44A 3CCSP 3CC7P 1VQ4P 3CCLP 2N98A 2QA4P 2KG9A 4WYMA 4COPA 1VHNA 2KOPA 5BS2A 4PH1A 4PWVB 3WBHA 2FVAA 3EJBA 1RO0A 3GZMA 4U0FA 2N5HA 2GDYA 3DS4A 4IZ6A 3MGEA 4U0BA 1YITP 3DTJA 1EIAA 2KOSA 1VQ6P 2JGPA 3NTEA 1M6EX 2K5XA 1AUMA 4H2YC 2K94A 1A8OA 2AFDA 2FADA 3HYBA 4PXHB 1MZ8A 4GR6A 2FVEA 3CCMP 2BHVA 3I55P 1M6NA 1AYIA 3DS5A 3GKLC 2MD9A 1YIJP 2LIWA 2JU2A 2L0QA 1UJZA 1Q7YQ 3DPHA 1JJ2O 1QVGO 3G1IA 2JAZA 4CA3A 2L22A 5CZDB 1E0HA 1Q81Q 2XXMA 4NEOA 2NO8A 2WPTA 4R0MA 4U0DA 2PEOA 2PEQA 1E6JP 2VLOA 5HV8A 3CE7A 1VQ7P 3CCRP 2FVFA 3G28A 1YJ9P 3NY7B 1L0HA 5I4TG 2KGAA 3CC4P 2N6ZA 1AF8A 1BAJA 1VQPP 2GZGA 2PY8A 2M8LA 1KC8Q 2KOOA 1VQLP 2MY5A 2AF8A 3HZQA 1VQ8P 2Z46A 3G21A 4M0IA 2K92A 2VLNA 3H0DA 4U0EA 1KLPA
chains in the Genus database with same CATH topology
1VKUA 2VSQA 2LOLA 1NQ4A 2CNRA 2MF4A 2N50A 2JQ4A 4H2YC 2FQ2A 2LKIA 2K94A 2XZ0D 2ROQA 2AFDA 2GDXA 2CQ8A 2QNWA 2FADA 2LMLA 2FACA 1DV5A 4PXHB 2LL8A 4BPGA 5KP6B 2FHSC 1F80D 2KW2A 2KOQA 2FVEA 2LIUA 2AVAA 2LPKA 2L9FA 2M5RA 4BPHA 2MD9A 2LIWA 3EJEA 2JU2A 2L0QA 2MVUA 2K2QA 4H2WC 2KG8A 2K0XA 2KGEA 2MVVA 2GDWA 1OR5A 3RG2A 4CA3A 2L22A 2KR5A 1KLPA 5CZDB 3LMOA 2KWLA 5HVCA 4H2XC 4NEOA 2XZ1C 4R0MA 2PNGA 4MRTC 1HQBA 2K0YA 5HV8A 3CE7A 2N6YA 2L4BA 1HY8A 2EHSA 2FVFA 5EJDA 1T8KA 5KP7B 2CG5B 3NY7B 1DNYA 2KG6A 1ACPA 1L0HA 2AFEA 2N5IA 2KGAA 2KGDA 2EHTA 2FQ1A 2N98A 2N6ZA 4BPFA 1AF8A 2KG9A 2DNWA 2MR7A 2CGQA 2KOPA 2JU1A 3GZLA 4PWVB 1L0IA 2FAEA 2KOOA 2KGCA 2FVAA 3EJBA 2KORA 4DG9A 2MY5A 2X2BA 2AF8A 4HKGA 3GZMA 2FQ0A 1X3OA 2N5HA 2GDYA 4IZ6A 2K92A 5KP8B 2KOSA 2LTEA 3EJDA 2K93A 2MR8A 2JGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKU A;  2VSQ A;  2LOL A;  1NQ4 A;  2CNR A;  2MF4 A;  2N50 A;  2JQ4 A;  4H2Y C;  2FQ2 A;  2LKI A;  2K94 A;  2XZ0 D;  2ROQ A;  2AFD A;  2GDX A;  2CQ8 A;  2QNW A;  2FAD A;  2LML A;  2FAC A;  1DV5 A;  4PXH B;  2LL8 A;  4BPG A;  5KP6 B;  2FHS C;  1F80 D;  2KW2 A;  2KOQ A;  2FVE A;  2LIU A;  2AVA A;  2LPK A;  2L9F A;  2M5R A;  4BPH A;  2MD9 A;  2LIW A;  3EJE A;  2JU2 A;  2L0Q A;  2MVU A;  2K2Q A;  4H2W C;  2KG8 A;  2K0X A;  2KGE A;  2MVV A;  2GDW A;  1OR5 A;  3RG2 A;  4CA3 A;  2L22 A;  2KR5 A;  1KLP A;  5CZD B;  3LMO A;  2KWL A;  5HVC A;  4H2X C;  4NEO A;  2XZ1 C;  4R0M A;  2PNG A;  4MRT C;  1HQB A;  2K0Y A;  5HV8 A;  3CE7 A;  2N6Y A;  2L4B A;  1HY8 A;  2EHS A;  2FVF A;  5EJD A;  1T8K A;  5KP7 B;  2CG5 B;  3NY7 B;  1DNY A;  2KG6 A;  1ACP A;  1L0H A;  2AFE A;  2N5I A;  2KGA A;  2KGD A;  2EHT A;  2FQ1 A;  2N98 A;  2N6Z A;  4BPF A;  1AF8 A;  2KG9 A;  2DNW A;  2MR7 A;  2CGQ A;  2KOP A;  2JU1 A;  3GZL A;  4PWV B;  1L0I A;  2FAE A;  2KOO A;  2KGC A;  2FVA A;  3EJB A;  2KOR A;  4DG9 A;  2MY5 A;  2X2B A;  2AF8 A;  4HKG A;  3GZM A;  2FQ0 A;  1X3O A;  2N5H A;  2GDY A;  4IZ6 A;  2K92 A;  5KP8 B;  2KOS A;  2LTE A;  3EJD A;  2K93 A;  2MR8 A;  2JGP A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  1NQ4 A;  2MF4 A;  1ZNV A;  3CXC O;  1VQ5 P;  2ROQ A;  2GZF A;  2CQ8 A;  1YJN P;  2KW2 A;  1VQO P;  2KOQ A;  2ERH A;  2OTJ P;  2LIU A;  3DS3 A;  3E2D A;  2L9F A;  4BPH A;  1K30 A;  4IPY A;  2GZI A;  2K2Q A;  4COC A;  2KGE A;  1GXG A;  2PEJ A;  1NJI Q;  2JBG A;  4GR2 A;  3P05 A;  3CCV P;  1HQB A;  3H4E A;  2N6Y A;  4U0C A;  3B5I A;  3CPW O;  1VQN P;  3CCU P;  1GPJ A;  1VQK P;  2EHS A;  2M8P A;  1T8K A;  1M1K Q;  1KQS O;  2EG5 A;  1Q82 Q;  1CEI A;  1VQM P;  3CD6 P;  1Z6M A;  2K0D X;  4BPF A;  5HGM A;  2DNW A;  2MR7 A;  2CGQ A;  3B4Q A;  1A43 A;  4XRQ A;  1BXI A;  1N8R Q;  3GZL A;  1YHQ P;  2FAE A;  2Z45 A;  2KOR A;  2X2B A;  1QVF O;  2JO0 A;  5HGO A;  1RNI A;  1VQ9 P;  5F2O A;  1M74 A;  2ONT A;  2LTE A;  3EJD A;  1YI2 P;  2OAR A;  2MR8 A;  2PEM A;  1VKU A;  2LOL A;  2CNR A;  2XV6 A;  2N50 A;  1D1D A;  2XZ0 D;  3DS0 A;  2GDX A;  3DS1 A;  2QNW A;  1QRJ A;  2LML A;  1DV5 A;  3G0V A;  5HGN A;  5EW5 E;  2OTL P;  5KP6 B;  1EMV A;  2AVA A;  2LPK A;  3CMA P;  3I56 P;  2M5R A;  3G29 A;  3G6E P;  3CCQ P;  7CEI A;  2K0X A;  2KOD A;  2GDW A;  1OR5 A;  1K73 Q;  2VLQ A;  3LMO A;  1EOQ A;  1YJW P;  4QKO A;  5HVC A;  4U0A A;  1KD1 Q;  2L6E A;  4H2X C;  1S72 P;  2PNG A;  5F2N A;  1K9M Q;  2CWO A;  2K0Y A;  3G71 P;  2LF4 A;  3CME P;  2L4B A;  1HY8 A;  2GZE A;  2JYG A;  2QEX P;  3G26 A;  5EJD A;  2CG5 B;  1DNY A;  2KG6 A;  1ACP A;  2E1M A;  4UHP B;  1K8A Q;  2AFE A;  2N5I A;  4PH0 A;  2KGD A;  2EHT A;  2FQ1 A;  2PEK A;  4QNB A;  1RO2 A;  3VRL C;  4XFZ A;  2GZJ A;  2JU1 A;  2JYL A;  5DCK A;  1L0I A;  2KGC A;  4DG9 A;  3LRY A;  5BS1 A;  4HKG A;  2FQ0 A;  1X3O A;  5HGL A;  2DGY A;  2EIA A;  4XFY A;  5KP8 B;  1IUQ A;  1IMP A;  2K93 A;  4XFX A;  2P9X A;  3G1G A;  3CCJ P;  2JQ4 A;  2PEI A;  2FQ2 A;  2LKI A;  1Q86 Q;  1M90 Q;  2FAC A;  1IMQ A;  2LL8 A;  5F2K A;  4BPG A;  2FHS C;  2M8N A;  1F80 D;  1GXH A;  2JB0 A;  2VLP A;  3M1M A;  1W2B O;  3OW2 O;  3EJE A;  2MVU A;  4XRO A;  4H2W C;  2KG8 A;  3DS2 A;  1FR2 A;  2MVV A;  3CCE P;  3G4S P;  3RG2 A;  3RG6 C;  2KR5 A;  2BUO A;  2KWL A;  2PEN A;  2GYK A;  3Q20 A;  2XZ1 C;  4MRT C;  1UNK A;  3CC2 P;  4F37 A;  2EFJ A;  2XT1 A;  1ZMB A;  3H47 A;  3U43 A;  5KP7 B;  5JPA A;  3GJN A;  2Z44 A;  3CCS P;  3CC7 P;  1VQ4 P;  3CCL P;  2N98 A;  2QA4 P;  2KG9 A;  4WYM A;  4COP A;  1VHN A;  2KOP A;  5BS2 A;  4PH1 A;  4PWV B;  3WBH A;  2FVA A;  3EJB A;  1RO0 A;  3GZM A;  4U0F A;  2N5H A;  2GDY A;  3DS4 A;  4IZ6 A;  3MGE A;  4U0B A;  1YIT P;  3DTJ A;  1EIA A;  2KOS A;  1VQ6 P;  2JGP A;  3NTE A;  1M6E X;  2K5X A;  1AUM A;  4H2Y C;  2K94 A;  1A8O A;  2AFD A;  2FAD A;  3HYB A;  4PXH B;  1MZ8 A;  4GR6 A;  2FVE A;  3CCM P;  2BHV A;  3I55 P;  1M6N A;  1AYI A;  3DS5 A;  3GKL C;  2MD9 A;  1YIJ P;  2LIW A;  2JU2 A;  2L0Q A;  1UJZ A;  1Q7Y Q;  3DPH A;  1JJ2 O;  1QVG O;  3G1I A;  2JAZ A;  4CA3 A;  2L22 A;  5CZD B;  1E0H A;  1Q81 Q;  2XXM A;  4NEO A;  2NO8 A;  2WPT A;  4R0M A;  4U0D A;  2PEO A;  2PEQ A;  1E6J P;  2VLO A;  5HV8 A;  3CE7 A;  1VQ7 P;  3CCR P;  2FVF A;  3G28 A;  1YJ9 P;  3NY7 B;  1L0H A;  5I4T G;  2KGA A;  3CC4 P;  2N6Z A;  1AF8 A;  1BAJ A;  1VQP P;  2GZG A;  2PY8 A;  2M8L A;  1KC8 Q;  2KOO A;  1VQL P;  2MY5 A;  2AF8 A;  3HZQ A;  1VQ8 P;  2Z46 A;  3G21 A;  4M0I A;  2K92 A;  2VLN A;  3H0D A;  4U0E A;  1KLP A; 
#chains in the Genus database with same CATH homology
 1VKU A;  2VSQ A;  2LOL A;  1NQ4 A;  2CNR A;  2MF4 A;  2N50 A;  2JQ4 A;  4H2Y C;  2FQ2 A;  2LKI A;  2K94 A;  2XZ0 D;  2ROQ A;  2AFD A;  2GDX A;  2CQ8 A;  2QNW A;  2FAD A;  2LML A;  2FAC A;  1DV5 A;  4PXH B;  2LL8 A;  4BPG A;  5KP6 B;  2FHS C;  1F80 D;  2KW2 A;  2KOQ A;  2FVE A;  2LIU A;  2AVA A;  2LPK A;  2L9F A;  2M5R A;  4BPH A;  2MD9 A;  2LIW A;  3EJE A;  2JU2 A;  2L0Q A;  2MVU A;  2K2Q A;  4H2W C;  2KG8 A;  2K0X A;  2KGE A;  2MVV A;  2GDW A;  1OR5 A;  3RG2 A;  4CA3 A;  2L22 A;  2KR5 A;  1KLP A;  5CZD B;  3LMO A;  2KWL A;  5HVC A;  4H2X C;  4NEO A;  2XZ1 C;  4R0M A;  2PNG A;  4MRT C;  1HQB A;  2K0Y A;  5HV8 A;  3CE7 A;  2N6Y A;  2L4B A;  1HY8 A;  2EHS A;  2FVF A;  5EJD A;  1T8K A;  5KP7 B;  2CG5 B;  3NY7 B;  1DNY A;  2KG6 A;  1ACP A;  1L0H A;  2AFE A;  2N5I A;  2KGA A;  2KGD A;  2EHT A;  2FQ1 A;  2N98 A;  2N6Z A;  4BPF A;  1AF8 A;  2KG9 A;  2DNW A;  2MR7 A;  2CGQ A;  2KOP A;  2JU1 A;  3GZL A;  4PWV B;  1L0I A;  2FAE A;  2KOO A;  2KGC A;  2FVA A;  3EJB A;  2KOR A;  4DG9 A;  2MY5 A;  2X2B A;  2AF8 A;  4HKG A;  3GZM A;  2FQ0 A;  1X3O A;  2N5H A;  2GDY A;  4IZ6 A;  2K92 A;  5KP8 B;  2KOS A;  2LTE A;  3EJD A;  2K93 A;  2MR8 A;  2JGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...