5KP8B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with acetyl donor-acp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp8B00
2EHTA 1L0HA 2XZ1C 2MF4A 2L22A 2N6ZA 2FAEA 5KP8B 2LIWA 2K0XA 2XZ0D 5EJDA 4BPHA 3GZLA 2LIUA 4H2YC 3NY7B 2LMLA 2KG8A 2KWLA 2PNGA 3RG2A 1X3OA 4H2XC 4PXHB 2CQ8A 2FACA 2KW2A 2JU1A 2N5HA 1F80D 2FVFA 2JGPA 3LMOA 2GDXA 1AF8A 2M5RA 2MR8A 2DNWA 2LPKA 5HVCA 2N5IA 2KR5A 5HV8A 2CG5B 1L0IA 2CGQA 1DNYA 4NEOA 2QNWA 2AF8A 2LTEA 1HQBA 2JU2A 1HY8A 2L4BA 4DG9A 1NQ4A 1OR5A 2FADA 2N98A 2KGAA 2GDWA 2KOOA 5KP7B 2FVEA 2KG6A 1VKUA 2N6YA 2KGEA 5CZDB 2FVAA 2K0YA 2FQ1A 2K2QA 2KOPA 2CNRA 2KORA 4H2WC 2LOLA 2FHSC 2KOQA 3EJBA 2MVVA 2MR7A 2ROQA 3GZMA 2AVAA 2MY5A 1T8KA 2AFDA 3CE7A 2MD9A 4MRTC 2K92A 2KOSA 2EHSA 2GDYA 1KLPA 2L0QA 2L9FA 3EJDA 5KP6B 1ACPA 3EJEA 2FQ2A 4BPGA 2FQ0A 2LKIA 2LL8A 4IZ6A 4BPFA 2K94A 2KGDA 2KGCA 2KG9A 4HKGA 2N50A 2AFEA 4CA3A 2VSQA 2K93A 4R0MA 2JQ4A 2X2BA 2MVUA 4PWVB 1DV5A
chains in the Genus database with same CATH superfamily
1KC8Q 3CCQP 1YI2P 5BS1A 2XZ1C 5I4TG 1VQMP 2KODA 2LIWA 2Z45A 3GZLA 3M1MA 1VQOP 3VRLC 3NTEA 2JBGA 3NY7B 2BUOA 2PEMA 1VQ6P 2KWLA 3RG2A 2GZFA 1YJ9P 2FACA 1W2BO 2PY8A 1F80D 2FVFA 3E2DA 1AF8A 2MR8A 1GXHA 2N5IA 1VQ4P 2M8LA 3HZQA 1DNYA 4GR2A 1MZ8A 4F37A 2GZEA 4WYMA 2CWOA 4DG9A 1NQ4A 2FADA 2M8NA 2N98A 1K73Q 5F2NA 2KOOA 3CC2P 1M6EX 2KGEA 5BS2A 5CZDB 3U43A 2GZGA 3DTJA 1UNKA 2LOLA 5DCKA 2MR7A 4XFZA 3GZMA 3MGEA 2AVAA 1E0HA 2AFDA 2ERHA 3CE7A 4PH0A 4MRTC 2KOSA 2EHSA 4U0DA 3G4SP 1KLPA 2L0QA 2WPTA 2EG5A 2FQ2A 4IZ6A 4CA3A 2N50A 4U0EA 2JQ4A 5HGNA 1VQLP 3OW2O 3GJNA 2QEXP 3G71P 2XT1A 3CC4P 2L22A 4XFXA 2XV6A 3CPWO 4COPA 2OTJP 2LIUA 2PEQA 4XFYA 3CCEP 1IMPA 1AUMA 3WBHA 1M6NA 2KG8A 1VQ8P 2JB0A 2GZIA 2OARA 2CQ8A 3G29A 2JU1A 2N5HA 2JGPA 3LMOA 2GDXA 1RNIA 2K5XA 2DNWA 4M0IA 5HGOA 3G0VA 5HVCA 1L0IA 3G6EP 3CCJP 1VQ5P 2AF8A 2LTEA 2JU2A 2L4BA 3DS0A 2KGAA 1VKUA 1YJWP 1VQ9P 1Q7YQ 1M74A 1YIJP 2JYLA 3CCVP 1FR2A 4QKOA 2GZJA 4H2WC 5F2OA 2FHSC 1KD1Q 3EJBA 4U0FA 2VLOA 4XROA 1VQKP 4GR6A 3P05A 2GDYA 1S72P 1KQSO 2EIAA 2L9FA 1ACPA 3EJEA 2FQ0A 2LKIA 2KG9A 1EOQA 2VSQA 2K93A 3DS4A 2X2BA 2MVUA 5EW5E 1DV5A 2E1MA 1YJNP 2EHTA 1L0HA 2Z44A 1Q81Q 1RO2A 1EMVA 3DPHA 2N6ZA 1A43A 3GKLC 2EFJA 2XZ0D 3CMAP 4BPHA 1NJIQ 4XRQA 3CD6P 4H2YC 1VQ7P 3Q20A 2LMLA 4QNBA 3G26A 5HGLA 2PNGA 1M90Q 1X3OA 3DS1A 1QRJA 4H2XC 4PXHB 3B4QA 3B5IA 2VLNA 2M5RA 1QVFO 1AYIA 2ONTA 2LPKA 3CMEP 2KR5A 5HV8A 2CGQA 2QNWA 2PENA 3DS3A 1HQBA 5JPAA 2JYGA 2NO8A 2JO0A 1JJ2O 5KP7B 2FVEA 1N8RQ 4U0AA 2N6YA 3G1GA 2FQ1A 2K2QA 2PEIA 2VLPA 4UHPB 3H0DA 1VQPP 1YHQP 2MY5A 1YITP 2MD9A 2PEKA 3RG6C 3EJDA 4BPGA 2LL8A 2JAZA 2KGCA 2QA4P 4R0MA 3CXCO 1Q82Q 3CCUP 3HYBA 3CCMP 2OTLP 1K8AQ 1E6JP 1A8OA 7CEIA 2MF4A 2FAEA 5KP8B 3CCLP 2K0XA 5EJDA 1CEIA 2M8PA 3G1IA 1ZMBA 2PEOA 4PH1A 5F2KA 3G28A 1EIAA 2KW2A 2P9XA 3DS5A 1ZNVA 1IUQA 2VLQA 1UJZA 3LRYA 3CCRP 4U0BA 1BXIA 3G21A 2LF4A 4U0CA 1Z6MA 2CG5B 4NEOA 2GYKA 1QVGO 1K9MQ 1HY8A 2DGYA 1GXGA 1OR5A 2GDWA 2KG6A 3DS2A 4IPYA 2FVAA 2K0YA 2XXMA 2KOPA 2CNRA 2KORA 3H4EA 2KOQA 2MVVA 2ROQA 3I55P 1T8KA 1K30A 2K92A 1Q86Q 1M1KQ 4COCA 3CC7P 5HGMA 1VHNA 2L6EA 3CCSP 1D1DA 2PEJA 5KP6B 2K0DX 4BPFA 2K94A 2KGDA 1VQNP 4HKGA 1IMQA 2AFEA 2BHVA 1RO0A 2Z46A 3H47A 1BAJA 3I56P 4PWVB 1GPJA
chains in the Genus database with same CATH topology
2EHTA 1L0HA 2XZ1C 2MF4A 2L22A 2N6ZA 2FAEA 5KP8B 2LIWA 2K0XA 2XZ0D 5EJDA 4BPHA 3GZLA 2LIUA 4H2YC 3NY7B 2LMLA 2KG8A 2KWLA 2PNGA 3RG2A 1X3OA 4H2XC 4PXHB 2CQ8A 2FACA 2KW2A 2JU1A 2N5HA 1F80D 2FVFA 2JGPA 3LMOA 2GDXA 1AF8A 2M5RA 2MR8A 2DNWA 2LPKA 5HVCA 2N5IA 2KR5A 5HV8A 2CG5B 1L0IA 2CGQA 1DNYA 4NEOA 2QNWA 2AF8A 2LTEA 1HQBA 2JU2A 1HY8A 2L4BA 4DG9A 1NQ4A 1OR5A 2FADA 2N98A 2KGAA 2GDWA 2KOOA 5KP7B 2FVEA 2KG6A 1VKUA 2N6YA 2KGEA 5CZDB 2FVAA 2K0YA 2FQ1A 2K2QA 2KOPA 2CNRA 2KORA 4H2WC 2LOLA 2FHSC 2KOQA 3EJBA 2MVVA 2MR7A 2ROQA 3GZMA 2AVAA 2MY5A 1T8KA 2AFDA 3CE7A 2MD9A 4MRTC 2K92A 2KOSA 2EHSA 2GDYA 1KLPA 2L0QA 2L9FA 3EJDA 5KP6B 1ACPA 3EJEA 2FQ2A 4BPGA 2FQ0A 2LKIA 2LL8A 4IZ6A 4BPFA 2K94A 2KGDA 2KGCA 2KG9A 4HKGA 2N50A 2AFEA 4CA3A 2VSQA 2K93A 4R0MA 2JQ4A 2X2BA 2MVUA 4PWVB 1DV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHT A;  1L0H A;  2XZ1 C;  2MF4 A;  2L22 A;  2N6Z A;  2FAE A;  5KP8 B;  2LIW A;  2K0X A;  2XZ0 D;  5EJD A;  4BPH A;  3GZL A;  2LIU A;  4H2Y C;  3NY7 B;  2LML A;  2KG8 A;  2KWL A;  2PNG A;  3RG2 A;  1X3O A;  4H2X C;  4PXH B;  2CQ8 A;  2FAC A;  2KW2 A;  2JU1 A;  2N5H A;  1F80 D;  2FVF A;  2JGP A;  3LMO A;  2GDX A;  1AF8 A;  2M5R A;  2MR8 A;  2DNW A;  2LPK A;  5HVC A;  2N5I A;  2KR5 A;  5HV8 A;  2CG5 B;  1L0I A;  2CGQ A;  1DNY A;  4NEO A;  2QNW A;  2AF8 A;  2LTE A;  1HQB A;  2JU2 A;  1HY8 A;  2L4B A;  4DG9 A;  1NQ4 A;  1OR5 A;  2FAD A;  2N98 A;  2KGA A;  2GDW A;  2KOO A;  5KP7 B;  2FVE A;  2KG6 A;  1VKU A;  2N6Y A;  2KGE A;  5CZD B;  2FVA A;  2K0Y A;  2FQ1 A;  2K2Q A;  2KOP A;  2CNR A;  2KOR A;  4H2W C;  2LOL A;  2FHS C;  2KOQ A;  3EJB A;  2MVV A;  2MR7 A;  2ROQ A;  3GZM A;  2AVA A;  2MY5 A;  1T8K A;  2AFD A;  3CE7 A;  2MD9 A;  4MRT C;  2K92 A;  2KOS A;  2EHS A;  2GDY A;  1KLP A;  2L0Q A;  2L9F A;  3EJD A;  5KP6 B;  1ACP A;  3EJE A;  2FQ2 A;  4BPG A;  2FQ0 A;  2LKI A;  2LL8 A;  4IZ6 A;  4BPF A;  2K94 A;  2KGD A;  2KGC A;  2KG9 A;  4HKG A;  2N50 A;  2AFE A;  4CA3 A;  2VSQ A;  2K93 A;  4R0M A;  2JQ4 A;  2X2B A;  2MVU A;  4PWV B;  1DV5 A; 
#chains in the Genus database with same CATH topology
 1KC8 Q;  3CCQ P;  1YI2 P;  5BS1 A;  2XZ1 C;  5I4T G;  1VQM P;  2KOD A;  2LIW A;  2Z45 A;  3GZL A;  3M1M A;  1VQO P;  3VRL C;  3NTE A;  2JBG A;  3NY7 B;  2BUO A;  2PEM A;  1VQ6 P;  2KWL A;  3RG2 A;  2GZF A;  1YJ9 P;  2FAC A;  1W2B O;  2PY8 A;  1F80 D;  2FVF A;  3E2D A;  1AF8 A;  2MR8 A;  1GXH A;  2N5I A;  1VQ4 P;  2M8L A;  3HZQ A;  1DNY A;  4GR2 A;  1MZ8 A;  4F37 A;  2GZE A;  4WYM A;  2CWO A;  4DG9 A;  1NQ4 A;  2FAD A;  2M8N A;  2N98 A;  1K73 Q;  5F2N A;  2KOO A;  3CC2 P;  1M6E X;  2KGE A;  5BS2 A;  5CZD B;  3U43 A;  2GZG A;  3DTJ A;  1UNK A;  2LOL A;  5DCK A;  2MR7 A;  4XFZ A;  3GZM A;  3MGE A;  2AVA A;  1E0H A;  2AFD A;  2ERH A;  3CE7 A;  4PH0 A;  4MRT C;  2KOS A;  2EHS A;  4U0D A;  3G4S P;  1KLP A;  2L0Q A;  2WPT A;  2EG5 A;  2FQ2 A;  4IZ6 A;  4CA3 A;  2N50 A;  4U0E A;  2JQ4 A;  5HGN A;  1VQL P;  3OW2 O;  3GJN A;  2QEX P;  3G71 P;  2XT1 A;  3CC4 P;  2L22 A;  4XFX A;  2XV6 A;  3CPW O;  4COP A;  2OTJ P;  2LIU A;  2PEQ A;  4XFY A;  3CCE P;  1IMP A;  1AUM A;  3WBH A;  1M6N A;  2KG8 A;  1VQ8 P;  2JB0 A;  2GZI A;  2OAR A;  2CQ8 A;  3G29 A;  2JU1 A;  2N5H A;  2JGP A;  3LMO A;  2GDX A;  1RNI A;  2K5X A;  2DNW A;  4M0I A;  5HGO A;  3G0V A;  5HVC A;  1L0I A;  3G6E P;  3CCJ P;  1VQ5 P;  2AF8 A;  2LTE A;  2JU2 A;  2L4B A;  3DS0 A;  2KGA A;  1VKU A;  1YJW P;  1VQ9 P;  1Q7Y Q;  1M74 A;  1YIJ P;  2JYL A;  3CCV P;  1FR2 A;  4QKO A;  2GZJ A;  4H2W C;  5F2O A;  2FHS C;  1KD1 Q;  3EJB A;  4U0F A;  2VLO A;  4XRO A;  1VQK P;  4GR6 A;  3P05 A;  2GDY A;  1S72 P;  1KQS O;  2EIA A;  2L9F A;  1ACP A;  3EJE A;  2FQ0 A;  2LKI A;  2KG9 A;  1EOQ A;  2VSQ A;  2K93 A;  3DS4 A;  2X2B A;  2MVU A;  5EW5 E;  1DV5 A;  2E1M A;  1YJN P;  2EHT A;  1L0H A;  2Z44 A;  1Q81 Q;  1RO2 A;  1EMV A;  3DPH A;  2N6Z A;  1A43 A;  3GKL C;  2EFJ A;  2XZ0 D;  3CMA P;  4BPH A;  1NJI Q;  4XRQ A;  3CD6 P;  4H2Y C;  1VQ7 P;  3Q20 A;  2LML A;  4QNB A;  3G26 A;  5HGL A;  2PNG A;  1M90 Q;  1X3O A;  3DS1 A;  1QRJ A;  4H2X C;  4PXH B;  3B4Q A;  3B5I A;  2VLN A;  2M5R A;  1QVF O;  1AYI A;  2ONT A;  2LPK A;  3CME P;  2KR5 A;  5HV8 A;  2CGQ A;  2QNW A;  2PEN A;  3DS3 A;  1HQB A;  5JPA A;  2JYG A;  2NO8 A;  2JO0 A;  1JJ2 O;  5KP7 B;  2FVE A;  1N8R Q;  4U0A A;  2N6Y A;  3G1G A;  2FQ1 A;  2K2Q A;  2PEI A;  2VLP A;  4UHP B;  3H0D A;  1VQP P;  1YHQ P;  2MY5 A;  1YIT P;  2MD9 A;  2PEK A;  3RG6 C;  3EJD A;  4BPG A;  2LL8 A;  2JAZ A;  2KGC A;  2QA4 P;  4R0M A;  3CXC O;  1Q82 Q;  3CCU P;  3HYB A;  3CCM P;  2OTL P;  1K8A Q;  1E6J P;  1A8O A;  7CEI A;  2MF4 A;  2FAE A;  5KP8 B;  3CCL P;  2K0X A;  5EJD A;  1CEI A;  2M8P A;  3G1I A;  1ZMB A;  2PEO A;  4PH1 A;  5F2K A;  3G28 A;  1EIA A;  2KW2 A;  2P9X A;  3DS5 A;  1ZNV A;  1IUQ A;  2VLQ A;  1UJZ A;  3LRY A;  3CCR P;  4U0B A;  1BXI A;  3G21 A;  2LF4 A;  4U0C A;  1Z6M A;  2CG5 B;  4NEO A;  2GYK A;  1QVG O;  1K9M Q;  1HY8 A;  2DGY A;  1GXG A;  1OR5 A;  2GDW A;  2KG6 A;  3DS2 A;  4IPY A;  2FVA A;  2K0Y A;  2XXM A;  2KOP A;  2CNR A;  2KOR A;  3H4E A;  2KOQ A;  2MVV A;  2ROQ A;  3I55 P;  1T8K A;  1K30 A;  2K92 A;  1Q86 Q;  1M1K Q;  4COC A;  3CC7 P;  5HGM A;  1VHN A;  2L6E A;  3CCS P;  1D1D A;  2PEJ A;  5KP6 B;  2K0D X;  4BPF A;  2K94 A;  2KGD A;  1VQN P;  4HKG A;  1IMQ A;  2AFE A;  2BHV A;  1RO0 A;  2Z46 A;  3H47 A;  1BAJ A;  3I56 P;  4PWV B;  1GPJ A; 
#chains in the Genus database with same CATH homology
 2EHT A;  1L0H A;  2XZ1 C;  2MF4 A;  2L22 A;  2N6Z A;  2FAE A;  5KP8 B;  2LIW A;  2K0X A;  2XZ0 D;  5EJD A;  4BPH A;  3GZL A;  2LIU A;  4H2Y C;  3NY7 B;  2LML A;  2KG8 A;  2KWL A;  2PNG A;  3RG2 A;  1X3O A;  4H2X C;  4PXH B;  2CQ8 A;  2FAC A;  2KW2 A;  2JU1 A;  2N5H A;  1F80 D;  2FVF A;  2JGP A;  3LMO A;  2GDX A;  1AF8 A;  2M5R A;  2MR8 A;  2DNW A;  2LPK A;  5HVC A;  2N5I A;  2KR5 A;  5HV8 A;  2CG5 B;  1L0I A;  2CGQ A;  1DNY A;  4NEO A;  2QNW A;  2AF8 A;  2LTE A;  1HQB A;  2JU2 A;  1HY8 A;  2L4B A;  4DG9 A;  1NQ4 A;  1OR5 A;  2FAD A;  2N98 A;  2KGA A;  2GDW A;  2KOO A;  5KP7 B;  2FVE A;  2KG6 A;  1VKU A;  2N6Y A;  2KGE A;  5CZD B;  2FVA A;  2K0Y A;  2FQ1 A;  2K2Q A;  2KOP A;  2CNR A;  2KOR A;  4H2W C;  2LOL A;  2FHS C;  2KOQ A;  3EJB A;  2MVV A;  2MR7 A;  2ROQ A;  3GZM A;  2AVA A;  2MY5 A;  1T8K A;  2AFD A;  3CE7 A;  2MD9 A;  4MRT C;  2K92 A;  2KOS A;  2EHS A;  2GDY A;  1KLP A;  2L0Q A;  2L9F A;  3EJD A;  5KP6 B;  1ACP A;  3EJE A;  2FQ2 A;  4BPG A;  2FQ0 A;  2LKI A;  2LL8 A;  4IZ6 A;  4BPF A;  2K94 A;  2KGD A;  2KGC A;  2KG9 A;  4HKG A;  2N50 A;  2AFE A;  4CA3 A;  2VSQ A;  2K93 A;  4R0M A;  2JQ4 A;  2X2B A;  2MVU A;  4PWV B;  1DV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...