5KP8B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with acetyl donor-acp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp8B00
1KLPA 2KOPA 2K93A 4MRTC 2GDWA 4PXHB 2L22A 5KP7B 2FVAA 2FADA 2K0YA 4H2XC 2MF4A 1HQBA 2QNWA 2EHSA 4BPFA 4CA3A 2XZ0D 1F80D 2LKIA 2VSQA 2KWLA 2MY5A 2FACA 5KP6B 2KW2A 2K94A 4BPHA 5KP8B 4NEOA 2X2BA 2ROQA 2AF8A 2FHSC 2N5HA 2KOQA 2CGQA 1L0HA 2FQ1A 2MVUA 2FAEA 1AF8A 2GDYA 2LPKA 4R0MA 5HV8A 2FVEA 2KGDA 2LIUA 1VKUA 2K92A 2EHTA 1DNYA 2AVAA 4BPGA 4H2YC 2LIWA 2KGAA 2KGEA 1HY8A 1NQ4A 2PNGA 2N98A 4H2WC 2XZ1C 3RG2A 2FQ2A 1L0IA 3GZLA 2CG5B 2AFDA 2KORA 2L0QA 3EJBA 2KG9A 3EJEA 1X3OA 2JGPA 2KG6A 2LMLA 5CZDB 2JU2A 2MR7A 4PWVB 3NY7B 1OR5A 2L4BA 2N6YA 2GDXA 2N5IA 2FQ0A 5EJDA 1T8KA 2CQ8A 2CNRA 2L9FA 3LMOA 2LTEA 5HVCA 1DV5A 2MR8A 2MVVA 2N6ZA 3EJDA 4DG9A 2LOLA 3GZMA 2JU1A 2KGCA 4HKGA 3CE7A 2KR5A 2JQ4A 4IZ6A 2N50A 2K0XA 2MD9A 2K2QA 2LL8A 2AFEA 1ACPA 2KOSA 2M5RA 2KG8A 2KOOA 2DNWA 2FVFA
chains in the Genus database with same CATH superfamily
2KOPA 2K93A 2VLOA 4PXHB 1IUQA 2DGYA 4H2XC 2MF4A 1HQBA 3CC4P 4BPFA 1QVGO 2LKIA 2KWLA 2MY5A 2Z45A 3G21A 2E1MA 4NEOA 2ROQA 2AF8A 2FHSC 2N5HA 3DS4A 1Z6MA 1L0HA 1M1KQ 1YI2P 4R0MA 4U0AA 2PEIA 1EOQA 1VKUA 2EHTA 2L6EA 1K8AQ 2PNGA 1YHQP 3M1MA 2XZ1C 2PEMA 1EMVA 3U43A 1Q82Q 1CEIA 2KG9A 2JGPA 2JU2A 2L4BA 2N6YA 2N5IA 5EJDA 3P05A 2CQ8A 2XV6A 1N8RQ 2CNRA 1VQ8P 3CC2P 1MZ8A 5HVCA 3H4EA 1DV5A 4U0FA 4DG9A 3NTEA 2LOLA 2KGCA 1VQOP 2ONTA 4U0EA 1RO0A 2CWOA 4QNBA 2KR5A 1VQPP 2N50A 2JAZA 4F37A 2PEKA 2AFEA 2KG8A 3DTJA 3CMEP 1A43A 1VHNA 5KP7B 1UNKA 3DS5A 1IMPA 2PY8A 5HGOA 1Q81Q 2XZ0D 1E0HA 2FACA 1RNIA 2VLQA 2KW2A 2VLPA 5F2KA 1KC8Q 1D1DA 1GXHA 1IMQA 2FQ1A 5HGNA 3H0DA 1YJ9P 1M74A 3I55P 1KD1Q 2XXMA 2GZFA 5JPAA 4U0BA 2QEXP 3B4QA 5HV8A 5I4TG 2FVEA 2K92A 2NO8A 4BPGA 4H2YC 3OW2O 2KGAA 2OTLP 2Z44A 1VQMP 2WPTA 1HY8A 1NQ4A 2N98A 3G0VA 2GZJA 1AUMA 2GZEA 1QRJA 2FQ2A 1VQ4P 2AFDA 2KORA 2L0QA 1Q86Q 5EW5E 2KG6A 4XFZA 2LMLA 5CZDB 2P9XA 3H47A 4UHPB 2GDXA 1VQNP 3CC7P 2L9FA 2XT1A 3CCEP 2N6ZA 3GZMA 2LF4A 1A8OA 1RO2A 7CEIA 5BS2A 2M8LA 4COCA 4COPA 2K2QA 2JO0A 2LL8A 3G4SP 4M0IA 2KOSA 4GR2A 2GYKA 2K5XA 1YITP 2DNWA 1KLPA 2QA4P 2GDWA 1YIJP 1W2BO 2FVAA 1VQ5P 3CXCO 3CCRP 2M8NA 3GKLC 2QNWA 2EG5A 2VSQA 2EIAA 1Q7YQ 2EFJA 3G29A 5DCKA 3RG6C 5KP6B 2K94A 4IPYA 2X2BA 3CD6P 2GZGA 3G26A 2KOQA 3DS0A 3E2DA 2GDYA 1ZNVA 4QKOA 2PENA 2LIUA 1M6NA 1DNYA 4U0DA 2AVAA 2JYLA 2KGEA 2PEQA 2PEJA 1VQ6P 3CMAP 3RG2A 1L0IA 3GZLA 1KQSO 2PEOA 1X3OA 5F2NA 2MR7A 4PWVB 3NY7B 1OR5A 4U0CA 2FQ0A 1T8KA 3LMOA 2LTEA 2ERHA 2KODA 3HYBA 1M90Q 2BUOA 5HGLA 3CCLP 2BHVA 4IZ6A 4XRQA 3DPHA 1FR2A 2M8PA 2K0XA 4PH0A 5F2OA 5BS1A 3G6EP 1BAJA 1K73Q 3CE7A 2KOOA 2FVFA 3CCUP 1AF8A 1NJIQ 2OTJP 4XFYA 3GJNA 4MRTC 2L22A 2FADA 1AYIA 2K0YA 3CCVP 1VQ9P 2EHSA 4CA3A 3CCSP 1YJWP 1F80D 1VQKP 3G71P 3LRYA 1K9MQ 4XROA 1GXGA 4BPHA 1QVFO 5KP8B 4PH1A 3G1GA 2CGQA 2MVUA 2FAEA 2LPKA 1VQ7P 4WYMA 2KGDA 2LIWA 1GPJA 2OARA 3WBHA 3DS2A 4H2WC 1UJZA 2VLNA 2CG5B 3EJBA 3DS1A 3EJEA 1BXIA 5HGMA 1K30A 3CCQP 3G28A 3CCMP 1EIAA 2K0DX 3CPWO 3DS3A 3Q20A 2GZIA 3I56P 3HZQA 1S72P 2JBGA 2MR8A 2MVVA 1VQLP 3EJDA 3VRLC 4GR6A 1E6JP 1M6EX 1ZMBA 2JU1A 4HKGA 3G1IA 3CCJP 1JJ2O 3MGEA 2JQ4A 3B5IA 2Z46A 2MD9A 2JB0A 2JYGA 1ACPA 2M5RA 1YJNP 4XFXA
chains in the Genus database with same CATH topology
1KLPA 2KOPA 2K93A 4MRTC 2GDWA 4PXHB 2L22A 5KP7B 2FVAA 2FADA 2K0YA 4H2XC 2MF4A 1HQBA 2QNWA 2EHSA 4BPFA 4CA3A 2XZ0D 1F80D 2LKIA 2VSQA 2KWLA 2MY5A 2FACA 5KP6B 2KW2A 2K94A 4BPHA 5KP8B 4NEOA 2X2BA 2ROQA 2AF8A 2FHSC 2N5HA 2KOQA 2CGQA 1L0HA 2FQ1A 2MVUA 2FAEA 1AF8A 2GDYA 2LPKA 4R0MA 5HV8A 2FVEA 2KGDA 2LIUA 1VKUA 2K92A 2EHTA 1DNYA 2AVAA 4BPGA 4H2YC 2LIWA 2KGAA 2KGEA 1HY8A 1NQ4A 2PNGA 2N98A 4H2WC 2XZ1C 3RG2A 2FQ2A 1L0IA 3GZLA 2CG5B 2AFDA 2KORA 2L0QA 3EJBA 2KG9A 3EJEA 1X3OA 2JGPA 2KG6A 2LMLA 5CZDB 2JU2A 2MR7A 4PWVB 3NY7B 1OR5A 2L4BA 2N6YA 2GDXA 2N5IA 2FQ0A 5EJDA 1T8KA 2CQ8A 2CNRA 2L9FA 3LMOA 2LTEA 5HVCA 1DV5A 2MR8A 2MVVA 2N6ZA 3EJDA 4DG9A 2LOLA 3GZMA 2JU1A 2KGCA 4HKGA 3CE7A 2KR5A 2JQ4A 4IZ6A 2N50A 2K0XA 2MD9A 2K2QA 2LL8A 2AFEA 1ACPA 2KOSA 2M5RA 2KG8A 2KOOA 2DNWA 2FVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KLP A;  2KOP A;  2K93 A;  4MRT C;  2GDW A;  4PXH B;  2L22 A;  5KP7 B;  2FVA A;  2FAD A;  2K0Y A;  4H2X C;  2MF4 A;  1HQB A;  2QNW A;  2EHS A;  4BPF A;  4CA3 A;  2XZ0 D;  1F80 D;  2LKI A;  2VSQ A;  2KWL A;  2MY5 A;  2FAC A;  5KP6 B;  2KW2 A;  2K94 A;  4BPH A;  5KP8 B;  4NEO A;  2X2B A;  2ROQ A;  2AF8 A;  2FHS C;  2N5H A;  2KOQ A;  2CGQ A;  1L0H A;  2FQ1 A;  2MVU A;  2FAE A;  1AF8 A;  2GDY A;  2LPK A;  4R0M A;  5HV8 A;  2FVE A;  2KGD A;  2LIU A;  1VKU A;  2K92 A;  2EHT A;  1DNY A;  2AVA A;  4BPG A;  4H2Y C;  2LIW A;  2KGA A;  2KGE A;  1HY8 A;  1NQ4 A;  2PNG A;  2N98 A;  4H2W C;  2XZ1 C;  3RG2 A;  2FQ2 A;  1L0I A;  3GZL A;  2CG5 B;  2AFD A;  2KOR A;  2L0Q A;  3EJB A;  2KG9 A;  3EJE A;  1X3O A;  2JGP A;  2KG6 A;  2LML A;  5CZD B;  2JU2 A;  2MR7 A;  4PWV B;  3NY7 B;  1OR5 A;  2L4B A;  2N6Y A;  2GDX A;  2N5I A;  2FQ0 A;  5EJD A;  1T8K A;  2CQ8 A;  2CNR A;  2L9F A;  3LMO A;  2LTE A;  5HVC A;  1DV5 A;  2MR8 A;  2MVV A;  2N6Z A;  3EJD A;  4DG9 A;  2LOL A;  3GZM A;  2JU1 A;  2KGC A;  4HKG A;  3CE7 A;  2KR5 A;  2JQ4 A;  4IZ6 A;  2N50 A;  2K0X A;  2MD9 A;  2K2Q A;  2LL8 A;  2AFE A;  1ACP A;  2KOS A;  2M5R A;  2KG8 A;  2KOO A;  2DNW A;  2FVF A; 
#chains in the Genus database with same CATH topology
 2KOP A;  2K93 A;  2VLO A;  4PXH B;  1IUQ A;  2DGY A;  4H2X C;  2MF4 A;  1HQB A;  3CC4 P;  4BPF A;  1QVG O;  2LKI A;  2KWL A;  2MY5 A;  2Z45 A;  3G21 A;  2E1M A;  4NEO A;  2ROQ A;  2AF8 A;  2FHS C;  2N5H A;  3DS4 A;  1Z6M A;  1L0H A;  1M1K Q;  1YI2 P;  4R0M A;  4U0A A;  2PEI A;  1EOQ A;  1VKU A;  2EHT A;  2L6E A;  1K8A Q;  2PNG A;  1YHQ P;  3M1M A;  2XZ1 C;  2PEM A;  1EMV A;  3U43 A;  1Q82 Q;  1CEI A;  2KG9 A;  2JGP A;  2JU2 A;  2L4B A;  2N6Y A;  2N5I A;  5EJD A;  3P05 A;  2CQ8 A;  2XV6 A;  1N8R Q;  2CNR A;  1VQ8 P;  3CC2 P;  1MZ8 A;  5HVC A;  3H4E A;  1DV5 A;  4U0F A;  4DG9 A;  3NTE A;  2LOL A;  2KGC A;  1VQO P;  2ONT A;  4U0E A;  1RO0 A;  2CWO A;  4QNB A;  2KR5 A;  1VQP P;  2N50 A;  2JAZ A;  4F37 A;  2PEK A;  2AFE A;  2KG8 A;  3DTJ A;  3CME P;  1A43 A;  1VHN A;  5KP7 B;  1UNK A;  3DS5 A;  1IMP A;  2PY8 A;  5HGO A;  1Q81 Q;  2XZ0 D;  1E0H A;  2FAC A;  1RNI A;  2VLQ A;  2KW2 A;  2VLP A;  5F2K A;  1KC8 Q;  1D1D A;  1GXH A;  1IMQ A;  2FQ1 A;  5HGN A;  3H0D A;  1YJ9 P;  1M74 A;  3I55 P;  1KD1 Q;  2XXM A;  2GZF A;  5JPA A;  4U0B A;  2QEX P;  3B4Q A;  5HV8 A;  5I4T G;  2FVE A;  2K92 A;  2NO8 A;  4BPG A;  4H2Y C;  3OW2 O;  2KGA A;  2OTL P;  2Z44 A;  1VQM P;  2WPT A;  1HY8 A;  1NQ4 A;  2N98 A;  3G0V A;  2GZJ A;  1AUM A;  2GZE A;  1QRJ A;  2FQ2 A;  1VQ4 P;  2AFD A;  2KOR A;  2L0Q A;  1Q86 Q;  5EW5 E;  2KG6 A;  4XFZ A;  2LML A;  5CZD B;  2P9X A;  3H47 A;  4UHP B;  2GDX A;  1VQN P;  3CC7 P;  2L9F A;  2XT1 A;  3CCE P;  2N6Z A;  3GZM A;  2LF4 A;  1A8O A;  1RO2 A;  7CEI A;  5BS2 A;  2M8L A;  4COC A;  4COP A;  2K2Q A;  2JO0 A;  2LL8 A;  3G4S P;  4M0I A;  2KOS A;  4GR2 A;  2GYK A;  2K5X A;  1YIT P;  2DNW A;  1KLP A;  2QA4 P;  2GDW A;  1YIJ P;  1W2B O;  2FVA A;  1VQ5 P;  3CXC O;  3CCR P;  2M8N A;  3GKL C;  2QNW A;  2EG5 A;  2VSQ A;  2EIA A;  1Q7Y Q;  2EFJ A;  3G29 A;  5DCK A;  3RG6 C;  5KP6 B;  2K94 A;  4IPY A;  2X2B A;  3CD6 P;  2GZG A;  3G26 A;  2KOQ A;  3DS0 A;  3E2D A;  2GDY A;  1ZNV A;  4QKO A;  2PEN A;  2LIU A;  1M6N A;  1DNY A;  4U0D A;  2AVA A;  2JYL A;  2KGE A;  2PEQ A;  2PEJ A;  1VQ6 P;  3CMA P;  3RG2 A;  1L0I A;  3GZL A;  1KQS O;  2PEO A;  1X3O A;  5F2N A;  2MR7 A;  4PWV B;  3NY7 B;  1OR5 A;  4U0C A;  2FQ0 A;  1T8K A;  3LMO A;  2LTE A;  2ERH A;  2KOD A;  3HYB A;  1M90 Q;  2BUO A;  5HGL A;  3CCL P;  2BHV A;  4IZ6 A;  4XRQ A;  3DPH A;  1FR2 A;  2M8P A;  2K0X A;  4PH0 A;  5F2O A;  5BS1 A;  3G6E P;  1BAJ A;  1K73 Q;  3CE7 A;  2KOO A;  2FVF A;  3CCU P;  1AF8 A;  1NJI Q;  2OTJ P;  4XFY A;  3GJN A;  4MRT C;  2L22 A;  2FAD A;  1AYI A;  2K0Y A;  3CCV P;  1VQ9 P;  2EHS A;  4CA3 A;  3CCS P;  1YJW P;  1F80 D;  1VQK P;  3G71 P;  3LRY A;  1K9M Q;  4XRO A;  1GXG A;  4BPH A;  1QVF O;  5KP8 B;  4PH1 A;  3G1G A;  2CGQ A;  2MVU A;  2FAE A;  2LPK A;  1VQ7 P;  4WYM A;  2KGD A;  2LIW A;  1GPJ A;  2OAR A;  3WBH A;  3DS2 A;  4H2W C;  1UJZ A;  2VLN A;  2CG5 B;  3EJB A;  3DS1 A;  3EJE A;  1BXI A;  5HGM A;  1K30 A;  3CCQ P;  3G28 A;  3CCM P;  1EIA A;  2K0D X;  3CPW O;  3DS3 A;  3Q20 A;  2GZI A;  3I56 P;  3HZQ A;  1S72 P;  2JBG A;  2MR8 A;  2MVV A;  1VQL P;  3EJD A;  3VRL C;  4GR6 A;  1E6J P;  1M6E X;  1ZMB A;  2JU1 A;  4HKG A;  3G1I A;  3CCJ P;  1JJ2 O;  3MGE A;  2JQ4 A;  3B5I A;  2Z46 A;  2MD9 A;  2JB0 A;  2JYG A;  1ACP A;  2M5R A;  1YJN P;  4XFX A; 
#chains in the Genus database with same CATH homology
 1KLP A;  2KOP A;  2K93 A;  4MRT C;  2GDW A;  4PXH B;  2L22 A;  5KP7 B;  2FVA A;  2FAD A;  2K0Y A;  4H2X C;  2MF4 A;  1HQB A;  2QNW A;  2EHS A;  4BPF A;  4CA3 A;  2XZ0 D;  1F80 D;  2LKI A;  2VSQ A;  2KWL A;  2MY5 A;  2FAC A;  5KP6 B;  2KW2 A;  2K94 A;  4BPH A;  5KP8 B;  4NEO A;  2X2B A;  2ROQ A;  2AF8 A;  2FHS C;  2N5H A;  2KOQ A;  2CGQ A;  1L0H A;  2FQ1 A;  2MVU A;  2FAE A;  1AF8 A;  2GDY A;  2LPK A;  4R0M A;  5HV8 A;  2FVE A;  2KGD A;  2LIU A;  1VKU A;  2K92 A;  2EHT A;  1DNY A;  2AVA A;  4BPG A;  4H2Y C;  2LIW A;  2KGA A;  2KGE A;  1HY8 A;  1NQ4 A;  2PNG A;  2N98 A;  4H2W C;  2XZ1 C;  3RG2 A;  2FQ2 A;  1L0I A;  3GZL A;  2CG5 B;  2AFD A;  2KOR A;  2L0Q A;  3EJB A;  2KG9 A;  3EJE A;  1X3O A;  2JGP A;  2KG6 A;  2LML A;  5CZD B;  2JU2 A;  2MR7 A;  4PWV B;  3NY7 B;  1OR5 A;  2L4B A;  2N6Y A;  2GDX A;  2N5I A;  2FQ0 A;  5EJD A;  1T8K A;  2CQ8 A;  2CNR A;  2L9F A;  3LMO A;  2LTE A;  5HVC A;  1DV5 A;  2MR8 A;  2MVV A;  2N6Z A;  3EJD A;  4DG9 A;  2LOL A;  3GZM A;  2JU1 A;  2KGC A;  4HKG A;  3CE7 A;  2KR5 A;  2JQ4 A;  4IZ6 A;  2N50 A;  2K0X A;  2MD9 A;  2K2Q A;  2LL8 A;  2AFE A;  1ACP A;  2KOS A;  2M5R A;  2KG8 A;  2KOO A;  2DNW A;  2FVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...