5KP8B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with acetyl donor-acp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp8B00
2MVUA 2QNWA 4BPGA 5KP6B 4H2YC 2JGPA 2FQ1A 2KORA 2GDXA 4DG9A 2X2BA 2DNWA 1HY8A 5EJDA 3RG2A 2FVEA 2KR5A 2FADA 2FVFA 4NEOA 2L4BA 1L0IA 2ROQA 2MD9A 2KWLA 2L22A 2LKIA 4BPFA 2LIWA 5CZDB 2KOSA 2KGEA 5HV8A 1X3OA 2KGDA 4PXHB 2M5RA 2AF8A 2KW2A 2XZ1C 1L0HA 2K0YA 1F80D 2L9FA 2N6YA 2LL8A 2EHTA 2KOOA 2JU2A 2N98A 3EJBA 2XZ0D 2AFEA 2JU1A 3LMOA 2LIUA 2N5IA 4BPHA 1KLPA 2N6ZA 2LTEA 3GZLA 1ACPA 3EJEA 5HVCA 2GDWA 2LMLA 5KP8B 2EHSA 2MR8A 2MY5A 1AF8A 2AVAA 2MF4A 2K92A 2FAEA 3CE7A 2KGCA 2CGQA 1VKUA 2FACA 2K93A 2N5HA 1T8KA 5KP7B 2KG6A 2KG8A 2AFDA 1OR5A 3NY7B 2CNRA 4R0MA 3EJDA 2GDYA 2KOPA 2PNGA 2FQ0A 2KG9A 4HKGA 4IZ6A 4MRTC 1DNYA 2LPKA 2VSQA 2K94A 4CA3A 2CG5B 4H2WC 1DV5A 4H2XC 2MVVA 1NQ4A 2K2QA 2N50A 4PWVB 2MR7A 3GZMA 2LOLA 2JQ4A 2L0QA 2CQ8A 2KGAA 2FVAA 2KOQA 2FHSC 2FQ2A 1HQBA 2K0XA
chains in the Genus database with same CATH superfamily
1VQ9P 2QNWA 5KP6B 5JPAA 5HGLA 4GR2A 3CCVP 2Z44A 3E2DA 1YJWP 1GXGA 3CC4P 2FVFA 3HYBA 3CCRP 2LF4A 5DCKA 1EMVA 2LKIA 3G21A 2WPTA 2XT1A 2KGEA 4PXHB 1VQ5P 2M5RA 1K8AQ 4XRQA 1RO0A 2PENA 4U0AA 2JO0A 2L6EA 3CCSP 2PEJA 1YITP 2JU2A 1Z6MA 1KQSO 2JAZA 4PH0A 3H4EA 2LTEA 2ERHA 3CMAP 5HGNA 1AUMA 5HVCA 3CXCO 1IMQA 3CCMP 2K92A 2M8LA 2PEKA 1Q7YQ 2K93A 1M90Q 2N5HA 5KP7B 1M74A 3CMEP 3H47A 3G28A 2KOPA 3U43A 1YIJP 3DTJA 1DNYA 3DS0A 2K2QA 2N50A 1YJNP 2M8NA 2LOLA 2GZFA 2L0QA 3CCLP 2VLNA 2EIAA 2K5XA 2FVAA 4U0EA 1CEIA 3WBHA 4UHPB 2EFJA 1N8RQ 2GZIA 2FQ1A 2JGPA 2PEOA 2DNWA 5EJDA 3RG2A 1YJ9P 3DS3A 1JJ2O 4U0DA 2KOSA 2JYLA 5HV8A 4XFYA 3I56P 3G4SP 2L9FA 2N6YA 3CD6P 5BS2A 5EW5E 4PH1A 2N98A 2Z45A 1VQPP 1IUQA 2XZ0D 1GPJA 2XV6A 4WYMA 2LIUA 2N5IA 2PEIA 3GZLA 1M6NA 2MY5A 1D1DA 2NO8A 2AVAA 3DS2A 4IPYA 1AF8A 4QKOA 3CE7A 2KGCA 2QEXP 1EOQA 3G1IA 1VQ4P 3G1GA 1UNKA 2KG6A 2CNRA 1VQ6P 2FQ0A 1Q82Q 1NJIQ 1ZMBA 1K73Q 1A8OA 1VQ7P 4IZ6A 2VSQA 2XXMA 1FR2A 2CG5B 3B4QA 4H2WC 5F2NA 1VQNP 1E6JP 3CC7P 2MR7A 2KODA 3NTEA 2CQ8A 2KGAA 1VQLP 3CCUP 2KOQA 2GYKA 3B5IA 1VQ8P 1YHQP 1KC8Q 3GKLC 2JYGA 4F37A 2GDXA 3VRLC 1HY8A 1VQOP 3LRYA 2FVEA 2KR5A 2FADA 4NEOA 2JB0A 2MD9A 2EG5A 2KWLA 2L22A 2OTLP 3CPWO 1X3OA 5F2OA 2GZJA 1QVFO 2AF8A 2PEQA 1ZNVA 1L0HA 1RO2A 2LL8A 2EHTA 4XFZA 1QVGO 3G0VA 1GXHA 1AYIA 4U0BA 3GJNA 3EJBA 1RNIA 2AFEA 4BPHA 1KLPA 2N6ZA 2CWOA 3EJEA 1EIAA 2M8PA 2LMLA 2BHVA 2EHSA 2VLOA 5F2KA 2MR8A 2OARA 3Q20A 4COCA 1VKUA 1K30A 3CC2P 1BXIA 2AFDA 2P9XA 1Q81Q 2JBGA 4MRTC 2K94A 1Q86Q 3M1MA 2PEMA 2Z46A 4M0IA 1DV5A 4U0FA 2K0DX 2MVVA 1VQKP 1NQ4A 2FHSC 1IMPA 2OTJP 2MVUA 3CCEP 3DS5A 4BPGA 1KD1Q 1VHNA 4H2YC 1S72P 3MGEA 2KORA 4DG9A 2X2BA 3OW2O 3H0DA 2DGYA 2L4BA 4U0CA 4COPA 1L0IA 2ROQA 4BPFA 2LIWA 5CZDB 1BAJA 2KGDA 1QRJA 1YI2P 3RG6C 3P05A 2KW2A 2XZ1C 3CCQP 2K0YA 5I4TG 1F80D 5BS1A 2GZGA 4XROA 2VLPA 2KOOA 3G29A 4QNBA 5HGOA 4GR6A 1M6EX 2JU1A 3LMOA 3G6EP 2GZEA 4XFXA 1UJZA 1ACPA 2GDWA 5KP8B 1VQMP 7CEIA 2VLQA 2E1MA 3HZQA 1E0HA 2MF4A 2FAEA 1W2BO 2CGQA 5HGMA 2QA4P 2ONTA 2FACA 1M1KQ 1T8KA 2KG8A 3DS1A 3DPHA 1OR5A 3NY7B 4R0MA 2BUOA 2GDYA 2PNGA 3EJDA 2PY8A 2KG9A 1K9MQ 4HKGA 2LPKA 4CA3A 3G71P 4H2XC 4PWVB 3GZMA 3CCJP 3I55P 2JQ4A 1MZ8A 3G26A 3DS4A 2FQ2A 1A43A 1HQBA 2K0XA
chains in the Genus database with same CATH topology
2MVUA 2QNWA 4BPGA 5KP6B 4H2YC 2JGPA 2FQ1A 2KORA 2GDXA 4DG9A 2X2BA 2DNWA 1HY8A 5EJDA 3RG2A 2FVEA 2KR5A 2FADA 2FVFA 4NEOA 2L4BA 1L0IA 2ROQA 2MD9A 2KWLA 2L22A 2LKIA 4BPFA 2LIWA 5CZDB 2KOSA 2KGEA 5HV8A 1X3OA 2KGDA 4PXHB 2M5RA 2AF8A 2KW2A 2XZ1C 1L0HA 2K0YA 1F80D 2L9FA 2N6YA 2LL8A 2EHTA 2KOOA 2JU2A 2N98A 3EJBA 2XZ0D 2AFEA 2JU1A 3LMOA 2LIUA 2N5IA 4BPHA 1KLPA 2N6ZA 2LTEA 3GZLA 1ACPA 3EJEA 5HVCA 2GDWA 2LMLA 5KP8B 2EHSA 2MR8A 2MY5A 1AF8A 2AVAA 2MF4A 2K92A 2FAEA 3CE7A 2KGCA 2CGQA 1VKUA 2FACA 2K93A 2N5HA 1T8KA 5KP7B 2KG6A 2KG8A 2AFDA 1OR5A 3NY7B 2CNRA 4R0MA 3EJDA 2GDYA 2KOPA 2PNGA 2FQ0A 2KG9A 4HKGA 4IZ6A 4MRTC 1DNYA 2LPKA 2VSQA 2K94A 4CA3A 2CG5B 4H2WC 1DV5A 4H2XC 2MVVA 1NQ4A 2K2QA 2N50A 4PWVB 2MR7A 3GZMA 2LOLA 2JQ4A 2L0QA 2CQ8A 2KGAA 2FVAA 2KOQA 2FHSC 2FQ2A 1HQBA 2K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVU A;  2QNW A;  4BPG A;  5KP6 B;  4H2Y C;  2JGP A;  2FQ1 A;  2KOR A;  2GDX A;  4DG9 A;  2X2B A;  2DNW A;  1HY8 A;  5EJD A;  3RG2 A;  2FVE A;  2KR5 A;  2FAD A;  2FVF A;  4NEO A;  2L4B A;  1L0I A;  2ROQ A;  2MD9 A;  2KWL A;  2L22 A;  2LKI A;  4BPF A;  2LIW A;  5CZD B;  2KOS A;  2KGE A;  5HV8 A;  1X3O A;  2KGD A;  4PXH B;  2M5R A;  2AF8 A;  2KW2 A;  2XZ1 C;  1L0H A;  2K0Y A;  1F80 D;  2L9F A;  2N6Y A;  2LL8 A;  2EHT A;  2KOO A;  2JU2 A;  2N98 A;  3EJB A;  2XZ0 D;  2AFE A;  2JU1 A;  3LMO A;  2LIU A;  2N5I A;  4BPH A;  1KLP A;  2N6Z A;  2LTE A;  3GZL A;  1ACP A;  3EJE A;  5HVC A;  2GDW A;  2LML A;  5KP8 B;  2EHS A;  2MR8 A;  2MY5 A;  1AF8 A;  2AVA A;  2MF4 A;  2K92 A;  2FAE A;  3CE7 A;  2KGC A;  2CGQ A;  1VKU A;  2FAC A;  2K93 A;  2N5H A;  1T8K A;  5KP7 B;  2KG6 A;  2KG8 A;  2AFD A;  1OR5 A;  3NY7 B;  2CNR A;  4R0M A;  3EJD A;  2GDY A;  2KOP A;  2PNG A;  2FQ0 A;  2KG9 A;  4HKG A;  4IZ6 A;  4MRT C;  1DNY A;  2LPK A;  2VSQ A;  2K94 A;  4CA3 A;  2CG5 B;  4H2W C;  1DV5 A;  4H2X C;  2MVV A;  1NQ4 A;  2K2Q A;  2N50 A;  4PWV B;  2MR7 A;  3GZM A;  2LOL A;  2JQ4 A;  2L0Q A;  2CQ8 A;  2KGA A;  2FVA A;  2KOQ A;  2FHS C;  2FQ2 A;  1HQB A;  2K0X A; 
#chains in the Genus database with same CATH topology
 1VQ9 P;  2QNW A;  5KP6 B;  5JPA A;  5HGL A;  4GR2 A;  3CCV P;  2Z44 A;  3E2D A;  1YJW P;  1GXG A;  3CC4 P;  2FVF A;  3HYB A;  3CCR P;  2LF4 A;  5DCK A;  1EMV A;  2LKI A;  3G21 A;  2WPT A;  2XT1 A;  2KGE A;  4PXH B;  1VQ5 P;  2M5R A;  1K8A Q;  4XRQ A;  1RO0 A;  2PEN A;  4U0A A;  2JO0 A;  2L6E A;  3CCS P;  2PEJ A;  1YIT P;  2JU2 A;  1Z6M A;  1KQS O;  2JAZ A;  4PH0 A;  3H4E A;  2LTE A;  2ERH A;  3CMA P;  5HGN A;  1AUM A;  5HVC A;  3CXC O;  1IMQ A;  3CCM P;  2K92 A;  2M8L A;  2PEK A;  1Q7Y Q;  2K93 A;  1M90 Q;  2N5H A;  5KP7 B;  1M74 A;  3CME P;  3H47 A;  3G28 A;  2KOP A;  3U43 A;  1YIJ P;  3DTJ A;  1DNY A;  3DS0 A;  2K2Q A;  2N50 A;  1YJN P;  2M8N A;  2LOL A;  2GZF A;  2L0Q A;  3CCL P;  2VLN A;  2EIA A;  2K5X A;  2FVA A;  4U0E A;  1CEI A;  3WBH A;  4UHP B;  2EFJ A;  1N8R Q;  2GZI A;  2FQ1 A;  2JGP A;  2PEO A;  2DNW A;  5EJD A;  3RG2 A;  1YJ9 P;  3DS3 A;  1JJ2 O;  4U0D A;  2KOS A;  2JYL A;  5HV8 A;  4XFY A;  3I56 P;  3G4S P;  2L9F A;  2N6Y A;  3CD6 P;  5BS2 A;  5EW5 E;  4PH1 A;  2N98 A;  2Z45 A;  1VQP P;  1IUQ A;  2XZ0 D;  1GPJ A;  2XV6 A;  4WYM A;  2LIU A;  2N5I A;  2PEI A;  3GZL A;  1M6N A;  2MY5 A;  1D1D A;  2NO8 A;  2AVA A;  3DS2 A;  4IPY A;  1AF8 A;  4QKO A;  3CE7 A;  2KGC A;  2QEX P;  1EOQ A;  3G1I A;  1VQ4 P;  3G1G A;  1UNK A;  2KG6 A;  2CNR A;  1VQ6 P;  2FQ0 A;  1Q82 Q;  1NJI Q;  1ZMB A;  1K73 Q;  1A8O A;  1VQ7 P;  4IZ6 A;  2VSQ A;  2XXM A;  1FR2 A;  2CG5 B;  3B4Q A;  4H2W C;  5F2N A;  1VQN P;  1E6J P;  3CC7 P;  2MR7 A;  2KOD A;  3NTE A;  2CQ8 A;  2KGA A;  1VQL P;  3CCU P;  2KOQ A;  2GYK A;  3B5I A;  1VQ8 P;  1YHQ P;  1KC8 Q;  3GKL C;  2JYG A;  4F37 A;  2GDX A;  3VRL C;  1HY8 A;  1VQO P;  3LRY A;  2FVE A;  2KR5 A;  2FAD A;  4NEO A;  2JB0 A;  2MD9 A;  2EG5 A;  2KWL A;  2L22 A;  2OTL P;  3CPW O;  1X3O A;  5F2O A;  2GZJ A;  1QVF O;  2AF8 A;  2PEQ A;  1ZNV A;  1L0H A;  1RO2 A;  2LL8 A;  2EHT A;  4XFZ A;  1QVG O;  3G0V A;  1GXH A;  1AYI A;  4U0B A;  3GJN A;  3EJB A;  1RNI A;  2AFE A;  4BPH A;  1KLP A;  2N6Z A;  2CWO A;  3EJE A;  1EIA A;  2M8P A;  2LML A;  2BHV A;  2EHS A;  2VLO A;  5F2K A;  2MR8 A;  2OAR A;  3Q20 A;  4COC A;  1VKU A;  1K30 A;  3CC2 P;  1BXI A;  2AFD A;  2P9X A;  1Q81 Q;  2JBG A;  4MRT C;  2K94 A;  1Q86 Q;  3M1M A;  2PEM A;  2Z46 A;  4M0I A;  1DV5 A;  4U0F A;  2K0D X;  2MVV A;  1VQK P;  1NQ4 A;  2FHS C;  1IMP A;  2OTJ P;  2MVU A;  3CCE P;  3DS5 A;  4BPG A;  1KD1 Q;  1VHN A;  4H2Y C;  1S72 P;  3MGE A;  2KOR A;  4DG9 A;  2X2B A;  3OW2 O;  3H0D A;  2DGY A;  2L4B A;  4U0C A;  4COP A;  1L0I A;  2ROQ A;  4BPF A;  2LIW A;  5CZD B;  1BAJ A;  2KGD A;  1QRJ A;  1YI2 P;  3RG6 C;  3P05 A;  2KW2 A;  2XZ1 C;  3CCQ P;  2K0Y A;  5I4T G;  1F80 D;  5BS1 A;  2GZG A;  4XRO A;  2VLP A;  2KOO A;  3G29 A;  4QNB A;  5HGO A;  4GR6 A;  1M6E X;  2JU1 A;  3LMO A;  3G6E P;  2GZE A;  4XFX A;  1UJZ A;  1ACP A;  2GDW A;  5KP8 B;  1VQM P;  7CEI A;  2VLQ A;  2E1M A;  3HZQ A;  1E0H A;  2MF4 A;  2FAE A;  1W2B O;  2CGQ A;  5HGM A;  2QA4 P;  2ONT A;  2FAC A;  1M1K Q;  1T8K A;  2KG8 A;  3DS1 A;  3DPH A;  1OR5 A;  3NY7 B;  4R0M A;  2BUO A;  2GDY A;  2PNG A;  3EJD A;  2PY8 A;  2KG9 A;  1K9M Q;  4HKG A;  2LPK A;  4CA3 A;  3G71 P;  4H2X C;  4PWV B;  3GZM A;  3CCJ P;  3I55 P;  2JQ4 A;  1MZ8 A;  3G26 A;  3DS4 A;  2FQ2 A;  1A43 A;  1HQB A;  2K0X A; 
#chains in the Genus database with same CATH homology
 2MVU A;  2QNW A;  4BPG A;  5KP6 B;  4H2Y C;  2JGP A;  2FQ1 A;  2KOR A;  2GDX A;  4DG9 A;  2X2B A;  2DNW A;  1HY8 A;  5EJD A;  3RG2 A;  2FVE A;  2KR5 A;  2FAD A;  2FVF A;  4NEO A;  2L4B A;  1L0I A;  2ROQ A;  2MD9 A;  2KWL A;  2L22 A;  2LKI A;  4BPF A;  2LIW A;  5CZD B;  2KOS A;  2KGE A;  5HV8 A;  1X3O A;  2KGD A;  4PXH B;  2M5R A;  2AF8 A;  2KW2 A;  2XZ1 C;  1L0H A;  2K0Y A;  1F80 D;  2L9F A;  2N6Y A;  2LL8 A;  2EHT A;  2KOO A;  2JU2 A;  2N98 A;  3EJB A;  2XZ0 D;  2AFE A;  2JU1 A;  3LMO A;  2LIU A;  2N5I A;  4BPH A;  1KLP A;  2N6Z A;  2LTE A;  3GZL A;  1ACP A;  3EJE A;  5HVC A;  2GDW A;  2LML A;  5KP8 B;  2EHS A;  2MR8 A;  2MY5 A;  1AF8 A;  2AVA A;  2MF4 A;  2K92 A;  2FAE A;  3CE7 A;  2KGC A;  2CGQ A;  1VKU A;  2FAC A;  2K93 A;  2N5H A;  1T8K A;  5KP7 B;  2KG6 A;  2KG8 A;  2AFD A;  1OR5 A;  3NY7 B;  2CNR A;  4R0M A;  3EJD A;  2GDY A;  2KOP A;  2PNG A;  2FQ0 A;  2KG9 A;  4HKG A;  4IZ6 A;  4MRT C;  1DNY A;  2LPK A;  2VSQ A;  2K94 A;  4CA3 A;  2CG5 B;  4H2W C;  1DV5 A;  4H2X C;  2MVV A;  1NQ4 A;  2K2Q A;  2N50 A;  4PWV B;  2MR7 A;  3GZM A;  2LOL A;  2JQ4 A;  2L0Q A;  2CQ8 A;  2KGA A;  2FVA A;  2KOQ A;  2FHS C;  2FQ2 A;  1HQB A;  2K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...