5KP8B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with acetyl donor-acp
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
molecule keywords CurD
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp8B00
2MY5A 2AFEA 1HY8A 4R0MA 2K93A 2KR5A 2JQ4A 2N5HA 2LL8A 2AF8A 2JGPA 4CA3A 3RG2A 5HV8A 2MVVA 2GDYA 3EJBA 4MRTC 2DNWA 5KP7B 1OR5A 3GZLA 2N5IA 4HKGA 4BPGA 2EHSA 2MVUA 2LIUA 2KGEA 5CZDB 2KOQA 1AF8A 4DG9A 2LIWA 2FVEA 2KG9A 5KP6B 1KLPA 3NY7B 2MD9A 2KOOA 2LPKA 2LKIA 2FHSC 2VSQA 2XZ0D 2PNGA 2KWLA 4H2XC 2KGCA 1DNYA 3CE7A 5KP8B 2N6ZA 2CQ8A 2FQ0A 2X2BA 4BPHA 2QNWA 2AFDA 1L0HA 1T8KA 2N6YA 2KG8A 3EJDA 1F80D 3LMOA 4H2WC 4PXHB 2LMLA 2K0XA 4H2YC 2KW2A 5HVCA 4BPFA 2KOSA 2K2QA 2JU2A 2JU1A 2KGAA 2ROQA 2GDWA 2K0YA 2CNRA 4IZ6A 1ACPA 2N50A 5EJDA 1X3OA 2FQ2A 2FVAA 2KGDA 2K94A 2EHTA 2CGQA 2KORA 2L0QA 2MR8A 2FVFA 2L4BA 3GZMA 2LTEA 2L9FA 2XZ1C 1DV5A 2AVAA 2FACA 4PWVB 2KOPA 1L0IA 1HQBA 2FQ1A 1NQ4A 1VKUA 2CG5B 3EJEA 2L22A 2M5RA 2MF4A 2GDXA 2LOLA 2MR7A 2FADA 2FAEA 4NEOA 2K92A 2N98A 2KG6A
chains in the Genus database with same CATH superfamily
2AFEA 2KR5A 2GYKA 2EIAA 1Q7YQ 2JGPA 4CA3A 3EJBA 1YI2P 2XXMA 1IMQA 2DNWA 3GZLA 3CCUP 1VQOP 4HKGA 3Q20A 1YJWP 3G28A 3CCQP 5CZDB 1K9MQ 1QVGO 3CCRP 2FVEA 2KG9A 4QKOA 2OTJP 1KLPA 3CCMP 2KOOA 5F2NA 2LKIA 1K30A 2DGYA 1ZMBA 2KWLA 2M8NA 4H2XC 2KGCA 3H0DA 1DNYA 1GPJA 3CE7A 4WYMA 2GZIA 1KQSO 2CQ8A 2PEKA 3HYBA 1F80D 4H2WC 3B5IA 3GJNA 4H2YC 4XROA 5JPAA 1W2BO 2KOSA 3MGEA 2JU2A 3LRYA 2VLQA 3CPWO 2K0YA 3DS4A 1M74A 2CNRA 3E2DA 1RO0A 2KGDA 1YITP 2ERHA 4UHPB 1N8RQ 2K94A 2L0QA 2JB0A 1VQ8P 2LTEA 2XZ1C 1Q82Q 4U0BA 3I56P 2FQ1A 1NQ4A 1VQ7P 3EJEA 3CD6P 5HGMA 3DS1A 2LOLA 1VQNP 1EOQA 2FAEA 2JBGA 2EG5A 2QA4P 2MY5A 1HY8A 2K93A 2CWOA 3CXCO 2N5HA 2LL8A 2AF8A 3G71P 4MRTC 2E1MA 2GZFA 5KP7B 1CEIA 3HZQA 2EHSA 3H47A 2KGEA 3GKLC 2KOQA 1VQMP 1IUQA 2Z46A 5KP6B 2NO8A 2MD9A 4XFZA 2FHSC 2JAZA 2XZ0D 2PNGA 3CCSP 2EFJA 2FQ0A 3DS0A 1L0HA 1KD1Q 1Q81Q 3LMOA 4PXHB 2LMLA 2KW2A 2K2QA 3CMEP 4PH1A 2GDWA 4IZ6A 1ACPA 5I4TG 5EJDA 4U0DA 2FQ2A 3NTEA 3CMAP 3VRLC 1YJ9P 1VQ4P 2EHTA 4U0CA 2KORA 2PEOA 1NJIQ 2L4BA 2K0DX 3GZMA 1DV5A 2FACA 3CC2P 3CC7P 1QRJA 3G21A 4U0FA 1M90Q 2LF4A 5BS1A 2M8LA 4QNBA 3I55P 4NEOA 1RNIA 4R0MA 5EW5E 1AUMA 1VHNA 1KC8Q 2XV6A 2MVVA 2GDYA 5HV8A 1EMVA 1OR5A 3DS2A 2N5IA 3G26A 3G1IA 2MVUA 4COPA 2KG6A 1A43A 1AF8A 4DG9A 3H4EA 1M1KQ 1VQ6P 1UNKA 3NY7B 3CC4P 1E6JP 2VSQA 3CCEP 3DPHA 1VQ5P 4GR6A 5KP8B 2N6ZA 1JJ2O 4U0EA 4IPYA 2X2BA 4BPHA 1T8KA 2N6YA 2KG8A 2PEQA 3EJDA 4XRQA 4F37A 5HGOA 2QEXP 1AYIA 2VLNA 2M8PA 5HVCA 5HGNA 2KGAA 1M6NA 7CEIA 2N50A 4XFYA 2PEIA 1X3OA 3DS5A 3CCVP 2GZEA 2VLPA 3CCLP 3M1MA 1YJNP 1GXHA 2MR8A 2FVFA 3G6EP 1VQPP 3WBHA 2L9FA 3CCJP 1K73Q 1HQBA 2JYGA 2CG5B 1M6EX 2L22A 2GDXA 1UJZA 3B4QA 1A8OA 1VQKP 1EIAA 1ZNVA 2K92A 2WPTA 2N98A 3G1GA 3OW2O 2JYLA 3DS3A 2OARA 2VLOA 2OTLP 1S72P 5BS2A 4XFXA 2JQ4A 3U43A 3RG2A 1BXIA 1YIJP 5F2KA 1BAJA 1Q86Q 4BPGA 2KODA 2PY8A 2Z45A 2LIUA 1MZ8A 1GXGA 2LIWA 1Z6MA 2LPKA 2XT1A 4M0IA 4GR2A 2QNWA 2AFDA 2PEMA 2BHVA 1QVFO 1IMPA 2K0XA 3G4SP 2PEJA 4PH0A 4BPFA 1VQ9P 1FR2A 2JU1A 2ROQA 1YHQP 2PENA 3G29A 2BUOA 2K5XA 2GZJA 4U0AA 2FVAA 5DCKA 2GZGA 1E0HA 3DTJA 2CGQA 1K8AQ 1RO2A 2L6EA 2AVAA 3P05A 4PWVB 2KOPA 1L0IA 2Z44A 1VKUA 1D1DA 4COCA 2M5RA 5HGLA 2MF4A 5F2OA 3RG6C 2MR7A 2P9XA 3G0VA 2ONTA 2FADA 2JO0A 1VQLP
chains in the Genus database with same CATH topology
2MY5A 2AFEA 1HY8A 4R0MA 2K93A 2KR5A 2JQ4A 2N5HA 2LL8A 2AF8A 2JGPA 4CA3A 3RG2A 5HV8A 2MVVA 2GDYA 3EJBA 4MRTC 2DNWA 5KP7B 1OR5A 3GZLA 2N5IA 4HKGA 4BPGA 2EHSA 2MVUA 2LIUA 2KGEA 5CZDB 2KOQA 1AF8A 4DG9A 2LIWA 2FVEA 2KG9A 5KP6B 1KLPA 3NY7B 2MD9A 2KOOA 2LPKA 2LKIA 2FHSC 2VSQA 2XZ0D 2PNGA 2KWLA 4H2XC 2KGCA 1DNYA 3CE7A 5KP8B 2N6ZA 2CQ8A 2FQ0A 2X2BA 4BPHA 2QNWA 2AFDA 1L0HA 1T8KA 2N6YA 2KG8A 3EJDA 1F80D 3LMOA 4H2WC 4PXHB 2LMLA 2K0XA 4H2YC 2KW2A 5HVCA 4BPFA 2KOSA 2K2QA 2JU2A 2JU1A 2KGAA 2ROQA 2GDWA 2K0YA 2CNRA 4IZ6A 1ACPA 2N50A 5EJDA 1X3OA 2FQ2A 2FVAA 2KGDA 2K94A 2EHTA 2CGQA 2KORA 2L0QA 2MR8A 2FVFA 2L4BA 3GZMA 2LTEA 2L9FA 2XZ1C 1DV5A 2AVAA 2FACA 4PWVB 2KOPA 1L0IA 1HQBA 2FQ1A 1NQ4A 1VKUA 2CG5B 3EJEA 2L22A 2M5RA 2MF4A 2GDXA 2LOLA 2MR7A 2FADA 2FAEA 4NEOA 2K92A 2N98A 2KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  2AFE A;  1HY8 A;  4R0M A;  2K93 A;  2KR5 A;  2JQ4 A;  2N5H A;  2LL8 A;  2AF8 A;  2JGP A;  4CA3 A;  3RG2 A;  5HV8 A;  2MVV A;  2GDY A;  3EJB A;  4MRT C;  2DNW A;  5KP7 B;  1OR5 A;  3GZL A;  2N5I A;  4HKG A;  4BPG A;  2EHS A;  2MVU A;  2LIU A;  2KGE A;  5CZD B;  2KOQ A;  1AF8 A;  4DG9 A;  2LIW A;  2FVE A;  2KG9 A;  5KP6 B;  1KLP A;  3NY7 B;  2MD9 A;  2KOO A;  2LPK A;  2LKI A;  2FHS C;  2VSQ A;  2XZ0 D;  2PNG A;  2KWL A;  4H2X C;  2KGC A;  1DNY A;  3CE7 A;  5KP8 B;  2N6Z A;  2CQ8 A;  2FQ0 A;  2X2B A;  4BPH A;  2QNW A;  2AFD A;  1L0H A;  1T8K A;  2N6Y A;  2KG8 A;  3EJD A;  1F80 D;  3LMO A;  4H2W C;  4PXH B;  2LML A;  2K0X A;  4H2Y C;  2KW2 A;  5HVC A;  4BPF A;  2KOS A;  2K2Q A;  2JU2 A;  2JU1 A;  2KGA A;  2ROQ A;  2GDW A;  2K0Y A;  2CNR A;  4IZ6 A;  1ACP A;  2N50 A;  5EJD A;  1X3O A;  2FQ2 A;  2FVA A;  2KGD A;  2K94 A;  2EHT A;  2CGQ A;  2KOR A;  2L0Q A;  2MR8 A;  2FVF A;  2L4B A;  3GZM A;  2LTE A;  2L9F A;  2XZ1 C;  1DV5 A;  2AVA A;  2FAC A;  4PWV B;  2KOP A;  1L0I A;  1HQB A;  2FQ1 A;  1NQ4 A;  1VKU A;  2CG5 B;  3EJE A;  2L22 A;  2M5R A;  2MF4 A;  2GDX A;  2LOL A;  2MR7 A;  2FAD A;  2FAE A;  4NEO A;  2K92 A;  2N98 A;  2KG6 A; 
#chains in the Genus database with same CATH topology
 2AFE A;  2KR5 A;  2GYK A;  2EIA A;  1Q7Y Q;  2JGP A;  4CA3 A;  3EJB A;  1YI2 P;  2XXM A;  1IMQ A;  2DNW A;  3GZL A;  3CCU P;  1VQO P;  4HKG A;  3Q20 A;  1YJW P;  3G28 A;  3CCQ P;  5CZD B;  1K9M Q;  1QVG O;  3CCR P;  2FVE A;  2KG9 A;  4QKO A;  2OTJ P;  1KLP A;  3CCM P;  2KOO A;  5F2N A;  2LKI A;  1K30 A;  2DGY A;  1ZMB A;  2KWL A;  2M8N A;  4H2X C;  2KGC A;  3H0D A;  1DNY A;  1GPJ A;  3CE7 A;  4WYM A;  2GZI A;  1KQS O;  2CQ8 A;  2PEK A;  3HYB A;  1F80 D;  4H2W C;  3B5I A;  3GJN A;  4H2Y C;  4XRO A;  5JPA A;  1W2B O;  2KOS A;  3MGE A;  2JU2 A;  3LRY A;  2VLQ A;  3CPW O;  2K0Y A;  3DS4 A;  1M74 A;  2CNR A;  3E2D A;  1RO0 A;  2KGD A;  1YIT P;  2ERH A;  4UHP B;  1N8R Q;  2K94 A;  2L0Q A;  2JB0 A;  1VQ8 P;  2LTE A;  2XZ1 C;  1Q82 Q;  4U0B A;  3I56 P;  2FQ1 A;  1NQ4 A;  1VQ7 P;  3EJE A;  3CD6 P;  5HGM A;  3DS1 A;  2LOL A;  1VQN P;  1EOQ A;  2FAE A;  2JBG A;  2EG5 A;  2QA4 P;  2MY5 A;  1HY8 A;  2K93 A;  2CWO A;  3CXC O;  2N5H A;  2LL8 A;  2AF8 A;  3G71 P;  4MRT C;  2E1M A;  2GZF A;  5KP7 B;  1CEI A;  3HZQ A;  2EHS A;  3H47 A;  2KGE A;  3GKL C;  2KOQ A;  1VQM P;  1IUQ A;  2Z46 A;  5KP6 B;  2NO8 A;  2MD9 A;  4XFZ A;  2FHS C;  2JAZ A;  2XZ0 D;  2PNG A;  3CCS P;  2EFJ A;  2FQ0 A;  3DS0 A;  1L0H A;  1KD1 Q;  1Q81 Q;  3LMO A;  4PXH B;  2LML A;  2KW2 A;  2K2Q A;  3CME P;  4PH1 A;  2GDW A;  4IZ6 A;  1ACP A;  5I4T G;  5EJD A;  4U0D A;  2FQ2 A;  3NTE A;  3CMA P;  3VRL C;  1YJ9 P;  1VQ4 P;  2EHT A;  4U0C A;  2KOR A;  2PEO A;  1NJI Q;  2L4B A;  2K0D X;  3GZM A;  1DV5 A;  2FAC A;  3CC2 P;  3CC7 P;  1QRJ A;  3G21 A;  4U0F A;  1M90 Q;  2LF4 A;  5BS1 A;  2M8L A;  4QNB A;  3I55 P;  4NEO A;  1RNI A;  4R0M A;  5EW5 E;  1AUM A;  1VHN A;  1KC8 Q;  2XV6 A;  2MVV A;  2GDY A;  5HV8 A;  1EMV A;  1OR5 A;  3DS2 A;  2N5I A;  3G26 A;  3G1I A;  2MVU A;  4COP A;  2KG6 A;  1A43 A;  1AF8 A;  4DG9 A;  3H4E A;  1M1K Q;  1VQ6 P;  1UNK A;  3NY7 B;  3CC4 P;  1E6J P;  2VSQ A;  3CCE P;  3DPH A;  1VQ5 P;  4GR6 A;  5KP8 B;  2N6Z A;  1JJ2 O;  4U0E A;  4IPY A;  2X2B A;  4BPH A;  1T8K A;  2N6Y A;  2KG8 A;  2PEQ A;  3EJD A;  4XRQ A;  4F37 A;  5HGO A;  2QEX P;  1AYI A;  2VLN A;  2M8P A;  5HVC A;  5HGN A;  2KGA A;  1M6N A;  7CEI A;  2N50 A;  4XFY A;  2PEI A;  1X3O A;  3DS5 A;  3CCV P;  2GZE A;  2VLP A;  3CCL P;  3M1M A;  1YJN P;  1GXH A;  2MR8 A;  2FVF A;  3G6E P;  1VQP P;  3WBH A;  2L9F A;  3CCJ P;  1K73 Q;  1HQB A;  2JYG A;  2CG5 B;  1M6E X;  2L22 A;  2GDX A;  1UJZ A;  3B4Q A;  1A8O A;  1VQK P;  1EIA A;  1ZNV A;  2K92 A;  2WPT A;  2N98 A;  3G1G A;  3OW2 O;  2JYL A;  3DS3 A;  2OAR A;  2VLO A;  2OTL P;  1S72 P;  5BS2 A;  4XFX A;  2JQ4 A;  3U43 A;  3RG2 A;  1BXI A;  1YIJ P;  5F2K A;  1BAJ A;  1Q86 Q;  4BPG A;  2KOD A;  2PY8 A;  2Z45 A;  2LIU A;  1MZ8 A;  1GXG A;  2LIW A;  1Z6M A;  2LPK A;  2XT1 A;  4M0I A;  4GR2 A;  2QNW A;  2AFD A;  2PEM A;  2BHV A;  1QVF O;  1IMP A;  2K0X A;  3G4S P;  2PEJ A;  4PH0 A;  4BPF A;  1VQ9 P;  1FR2 A;  2JU1 A;  2ROQ A;  1YHQ P;  2PEN A;  3G29 A;  2BUO A;  2K5X A;  2GZJ A;  4U0A A;  2FVA A;  5DCK A;  2GZG A;  1E0H A;  3DTJ A;  2CGQ A;  1K8A Q;  1RO2 A;  2L6E A;  2AVA A;  3P05 A;  4PWV B;  2KOP A;  1L0I A;  2Z44 A;  1VKU A;  1D1D A;  4COC A;  2M5R A;  5HGL A;  2MF4 A;  5F2O A;  3RG6 C;  2MR7 A;  2P9X A;  3G0V A;  2ONT A;  2FAD A;  2JO0 A;  1VQL P; 
#chains in the Genus database with same CATH homology
 2MY5 A;  2AFE A;  1HY8 A;  4R0M A;  2K93 A;  2KR5 A;  2JQ4 A;  2N5H A;  2LL8 A;  2AF8 A;  2JGP A;  4CA3 A;  3RG2 A;  5HV8 A;  2MVV A;  2GDY A;  3EJB A;  4MRT C;  2DNW A;  5KP7 B;  1OR5 A;  3GZL A;  2N5I A;  4HKG A;  4BPG A;  2EHS A;  2MVU A;  2LIU A;  2KGE A;  5CZD B;  2KOQ A;  1AF8 A;  4DG9 A;  2LIW A;  2FVE A;  2KG9 A;  5KP6 B;  1KLP A;  3NY7 B;  2MD9 A;  2KOO A;  2LPK A;  2LKI A;  2FHS C;  2VSQ A;  2XZ0 D;  2PNG A;  2KWL A;  4H2X C;  2KGC A;  1DNY A;  3CE7 A;  5KP8 B;  2N6Z A;  2CQ8 A;  2FQ0 A;  2X2B A;  4BPH A;  2QNW A;  2AFD A;  1L0H A;  1T8K A;  2N6Y A;  2KG8 A;  3EJD A;  1F80 D;  3LMO A;  4H2W C;  4PXH B;  2LML A;  2K0X A;  4H2Y C;  2KW2 A;  5HVC A;  4BPF A;  2KOS A;  2K2Q A;  2JU2 A;  2JU1 A;  2KGA A;  2ROQ A;  2GDW A;  2K0Y A;  2CNR A;  4IZ6 A;  1ACP A;  2N50 A;  5EJD A;  1X3O A;  2FQ2 A;  2FVA A;  2KGD A;  2K94 A;  2EHT A;  2CGQ A;  2KOR A;  2L0Q A;  2MR8 A;  2FVF A;  2L4B A;  3GZM A;  2LTE A;  2L9F A;  2XZ1 C;  1DV5 A;  2AVA A;  2FAC A;  4PWV B;  2KOP A;  1L0I A;  1HQB A;  2FQ1 A;  1NQ4 A;  1VKU A;  2CG5 B;  3EJE A;  2L22 A;  2M5R A;  2MF4 A;  2GDX A;  2LOL A;  2MR7 A;  2FAD A;  2FAE A;  4NEO A;  2K92 A;  2N98 A;  2KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...