2JYGA

Solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
total genus 16
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jygA00
2ONTA 3G0VA 5I4TG 1QRJA 1A43A 2JYLA 4IPYA 2XXMA 2BUOA 3G21A 3G29A 3G1GA 3H47A 3G26A 4XFYA 3DS1A 5HGMA 1EOQA 5JPAA 3G1IA 3DS3A 3DS4A 2JYGA 3DTJA 1E6JP 4U0AA 5HGOA 2EIAA 2JO0A 1BAJA 3H4EA 3NTEA 4WYMA 2M8NA 3G28A 1D1DA 3DS2A 2KODA 2M8PA 3LRYA 1AUMA 3DS5A 4QNBA 4PH1A 4U0DA 4XROA 4U0FA 3MGEA 4COCA 4U0CA 2XV6A 4U0EA 2XT1A 4U0BA 4XRQA 3DS0A 3VRLC 3P05A 3DPHA 5HGLA 4COPA 4PH0A 4M0IA 1A8OA 2LF4A 2M8LA 4XFZA 5DCKA 5HGNA 1EIAA 4XFXA 2L6EA
chains in the Genus database with same CATH superfamily
5I4TG 1OR5A 3Q20A 1VQOP 3G71P 1BXIA 1VKUA 1BAJA 3G4SP 1YITP 1K30A 3MGEA 1VQ6P 4HKGA 4H2WC 2MVUA 3DS0A 2KGAA 2KGEA 2PY8A 4PH0A 1KLPA 2DGYA 1A8OA 2Z44A 5F2OA 1YJWP 2K0XA 2FADA 2FVFA 2VLQA 2MR7A 2PEKA 1NJIQ 2EG5A 2PEMA 4U0FA 5KP8B 3CCUP 3CPWO 1VQ5P 2EHSA 2JU2A 1UJZA 2AVAA 3G1GA 1ZNVA 3DS1A 5HGMA 2N5HA 2PEQA 2KODA 1M74A 1KD1Q 1W2BO 4H2XC 2LPKA 2QA4P 1VQNP 3CCJP 2VSQA 3G0VA 2LOLA 4CA3A 1KC8Q 2FVEA 3B5IA 1K8AQ 3CCSP 2MVVA 2CGQA 3CC4P 2KGCA 2JAZA 1DNYA 3DS5A 4U0DA 2EHTA 1MZ8A 4PXHB 5CZDB 2GDYA 2P9XA 4GR6A 1X3OA 2JYLA 2LMLA 1VQMP 1CEIA 2GDXA 2M8PA 3LRYA 2KOSA 3LMOA 1IMPA 2PNGA 1IUQA 1VQ7P 2BHVA 3CC2P 3EJDA 2AFDA 4IPYA 3OW2O 2LIWA 2KGDA 4UHPB 2L22A 2KR5A 4XROA 2KOQA 2ROQA 2PEOA 1AYIA 1L0HA 2CNRA 3VRLC 3B4QA 1YI2P 5HV8A 4GR2A 1UNKA 2L6EA 3U43A 3CCEP 2KORA 2DNWA 3G1IA 2GDWA 2L9FA 5HGOA 1JJ2O 2AF8A 3NTEA 3H4EA 1L0IA 2PEJA 1E0HA 2KWLA 2N50A 2KG6A 1NQ4A 5BS1A 2LIUA 3I55P 3P05A 3GZMA 1Q82Q 2WPTA 2ONTA 3NY7B 3G26A 1HY8A 1GXGA 3CCRP 3M1MA 2FQ0A 1YJ9P 3G28A 3DS2A 3GJNA 2XZ1C 3I56P 2OARA 4DG9A 1EMVA 2GZGA 2QNWA 2LTEA 3WBHA 2LF4A 2JQ4A 2QEXP 2KG8A 2N98A 2EFJA 4U0AA 4BPGA 1D1DA 4H2YC 2CQ8A 2L0QA 1VHNA 4U0EA 1YHQP 3HYBA 2XT1A 4MRTC 2GZJA 1RO2A 1K9MQ 5KP6B 3RG6C 1QRJA 1Q7YQ 2KW2A 2KOOA 5BS2A 1FR2A 3CMAP 2JU1A 1AUMA 3EJBA 3DPHA 1YIJP 2FVAA 2OTJP 2E1MA 1AF8A 2K2QA 4PWVB 4XFXA 1M6NA 3CMEP 1YJNP 1A43A 4QKOA 2XZ0D 3G29A 2JB0A 2L4BA 2JO0A 2K92A 4QNBA 2PENA 2MY5A 2MD9A 2XV6A 1KQSO 4U0BA 5HGLA 2M8LA 1VQPP 1N8RQ 1F80D 1Q86Q 5HVCA 3G21A 1ACPA 1E6JP 4BPFA 2M8NA 3E2DA 4PH1A 3CCMP 4IZ6A 2GZIA 4NEOA 2OTLP 3CD6P 4COPA 2VLPA 5F2NA 1RNIA 2FACA 1EIAA 2GZEA 3GZLA 1M1KQ 2XXMA 2FHSC 2Z46A 2Z45A 2K0YA 1Q81Q 2CG5B 1GPJA 4COCA 2ERHA 2FAEA 3CCQP 3HZQA 1Z6MA 3CXCO 3CC7P 2X2BA 1GXHA 3G6EP 5KP7B 4XFYA 2BUOA 1VQ4P 1M90Q 1HQBA 3DS3A 3DS4A 2JYGA 3RG2A 1VQKP 2GYKA 2AFEA 2KG9A 2JGPA 2CWOA 1DV5A 2N6ZA 7CEIA 1VQ8P 2PEIA 2JBGA 1VQ9P 2FQ1A 3H0DA 2VLOA 5DCKA 5HGNA 2M5RA 2VLNA 3CE7A 4BPHA 1M6EX 2KOPA 3EJEA 2LL8A 3H47A 3CCVP 3GKLC 2EIAA 1IMQA 4WYMA 2LKIA 2N5IA 4U0CA 2K94A 1QVFO 2NO8A 5EJDA 2K0DX 1ZMBA 2FQ2A 2MR8A 1EOQA 5JPAA 1VQLP 5F2KA 1RO0A 3DTJA 2K93A 2MF4A 4F37A 2GZFA 2K5XA 2N6YA 1T8KA 4R0MA 4XRQA 3CCLP 1S72P 5EW5E 4M0IA 4XFZA 1QVGO 1K73Q
chains in the Genus database with same CATH topology
1M1KQ 5I4TG 2JYLA 2XXMA 2Z46A 2EFJA 3Q20A 2Z45A 1VQOP 4U0AA 3G71P 1VQMP 1BAJA 3G4SP 1YITP 1D1DA 2M8PA 3LRYA 1Q81Q 1K30A 3MGEA 4COCA 3CCQP 1VQ6P 3HZQA 4U0EA 1YHQP 3HYBA 2XT1A 3DS0A 2PY8A 4PH0A 2DGYA 1RO2A 1K9MQ 1A8OA 1IUQA 3CXCO 2Z44A 3CC7P 1VQ7P 2BHVA 3CC2P 5F2OA 1YJWP 3RG6C 1QRJA 3G6EP 4IPYA 4XFYA 2BUOA 1Q7YQ 1VQ4P 1M90Q 3OW2O 3DS3A 3DS4A 2JYGA 1VQKP 5BS2A 2PEKA 1NJIQ 2EG5A 3CMAP 2PEMA 1AUMA 2CWOA 4XROA 4U0FA 1VQ8P 2PEOA 3CPWO 3CCUP 1VQ5P 2PEIA 3VRLC 3DPHA 1YI2P 1YIJP 2OTJP 1VQ9P 2E1MA 4GR2A 3H0DA 5DCKA 5HGNA 4XFXA 2L6EA 1M6NA 1M6EX 3CMEP 1YJNP 1A43A 3CCEP 3H47A 3G29A 3G1GA 3DS1A 5HGMA 3CCVP 3G1IA 5HGOA 2EIAA 1JJ2O 2JO0A 3NTEA 3H4EA 2PEJA 2PEQA 4WYMA 4QNBA 2KODA 2PENA 4U0CA 5BS1A 2XV6A 1QVFO 1KQSO 4U0BA 1M74A 3I55P 3P05A 5HGLA 1KD1Q 2M8LA 1VQPP 1W2BO 1Q82Q 2QA4P 1N8RQ 1VQNP 1Q86Q 3CCJP 2ONTA 3G0VA 1ZMBA 3G21A 3G26A 1KC8Q 3B5IA 1EOQA 3CCSP 5JPAA 1K8AQ 1VQLP 5F2KA 1RO0A 3DTJA 1E6JP 3CCRP 3CC4P 3M1MA 1YJ9P 2M8NA 3G28A 3E2DA 3DS2A 3DS5A 4U0DA 4PH1A 3CCMP 3I56P 2OARA 2OTLP 4XRQA 3CCLP 3CD6P 1S72P 4COPA 4M0IA 3WBHA 2LF4A 5F2NA 2P9XA 4XFZA 1RNIA 1EIAA 1QVGO 4GR6A 2QEXP 1K73Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONT A;  3G0V A;  5I4T G;  1QRJ A;  1A43 A;  2JYL A;  4IPY A;  2XXM A;  2BUO A;  3G21 A;  3G29 A;  3G1G A;  3H47 A;  3G26 A;  4XFY A;  3DS1 A;  5HGM A;  1EOQ A;  5JPA A;  3G1I A;  3DS3 A;  3DS4 A;  2JYG A;  3DTJ A;  1E6J P;  4U0A A;  5HGO A;  2EIA A;  2JO0 A;  1BAJ A;  3H4E A;  3NTE A;  4WYM A;  2M8N A;  3G28 A;  1D1D A;  3DS2 A;  2KOD A;  2M8P A;  3LRY A;  1AUM A;  3DS5 A;  4QNB A;  4PH1 A;  4U0D A;  4XRO A;  4U0F A;  3MGE A;  4COC A;  4U0C A;  2XV6 A;  4U0E A;  2XT1 A;  4U0B A;  4XRQ A;  3DS0 A;  3VRL C;  3P05 A;  3DPH A;  5HGL A;  4COP A;  4PH0 A;  4M0I A;  1A8O A;  2LF4 A;  2M8L A;  4XFZ A;  5DCK A;  5HGN A;  1EIA A;  4XFX A;  2L6E A; 
#chains in the Genus database with same CATH topology
 5I4T G;  1OR5 A;  3Q20 A;  1VQO P;  3G71 P;  1BXI A;  1VKU A;  1BAJ A;  3G4S P;  1YIT P;  1K30 A;  3MGE A;  1VQ6 P;  4HKG A;  4H2W C;  2MVU A;  3DS0 A;  2KGA A;  2KGE A;  2PY8 A;  4PH0 A;  1KLP A;  2DGY A;  1A8O A;  2Z44 A;  5F2O A;  1YJW P;  2K0X A;  2FAD A;  2FVF A;  2VLQ A;  2MR7 A;  2PEK A;  1NJI Q;  2EG5 A;  2PEM A;  4U0F A;  5KP8 B;  3CCU P;  3CPW O;  1VQ5 P;  2EHS A;  2JU2 A;  1UJZ A;  2AVA A;  3G1G A;  1ZNV A;  3DS1 A;  5HGM A;  2N5H A;  2PEQ A;  2KOD A;  1M74 A;  1KD1 Q;  1W2B O;  4H2X C;  2LPK A;  2QA4 P;  1VQN P;  3CCJ P;  2VSQ A;  3G0V A;  2LOL A;  4CA3 A;  1KC8 Q;  2FVE A;  3B5I A;  1K8A Q;  3CCS P;  2MVV A;  2CGQ A;  3CC4 P;  2KGC A;  2JAZ A;  1DNY A;  3DS5 A;  4U0D A;  2EHT A;  1MZ8 A;  4PXH B;  5CZD B;  2GDY A;  2P9X A;  4GR6 A;  1X3O A;  2JYL A;  2LML A;  1VQM P;  1CEI A;  2GDX A;  2M8P A;  3LRY A;  2KOS A;  3LMO A;  1IMP A;  2PNG A;  1IUQ A;  1VQ7 P;  2BHV A;  3CC2 P;  3EJD A;  2AFD A;  4IPY A;  3OW2 O;  2LIW A;  2KGD A;  4UHP B;  2L22 A;  2KR5 A;  4XRO A;  2KOQ A;  2ROQ A;  2PEO A;  1AYI A;  1L0H A;  2CNR A;  3VRL C;  3B4Q A;  1YI2 P;  5HV8 A;  4GR2 A;  1UNK A;  2L6E A;  3U43 A;  3CCE P;  2KOR A;  2DNW A;  3G1I A;  2GDW A;  2L9F A;  5HGO A;  1JJ2 O;  2AF8 A;  3NTE A;  3H4E A;  1L0I A;  2PEJ A;  1E0H A;  2KWL A;  2N50 A;  2KG6 A;  1NQ4 A;  5BS1 A;  2LIU A;  3I55 P;  3P05 A;  3GZM A;  1Q82 Q;  2WPT A;  2ONT A;  3NY7 B;  3G26 A;  1HY8 A;  1GXG A;  3CCR P;  3M1M A;  2FQ0 A;  1YJ9 P;  3G28 A;  3DS2 A;  3GJN A;  2XZ1 C;  3I56 P;  2OAR A;  4DG9 A;  1EMV A;  2GZG A;  2QNW A;  2LTE A;  3WBH A;  2LF4 A;  2JQ4 A;  2QEX P;  2KG8 A;  2N98 A;  2EFJ A;  4U0A A;  4BPG A;  1D1D A;  4H2Y C;  2CQ8 A;  2L0Q A;  1VHN A;  4U0E A;  1YHQ P;  3HYB A;  2XT1 A;  4MRT C;  2GZJ A;  1RO2 A;  1K9M Q;  5KP6 B;  3RG6 C;  1QRJ A;  1Q7Y Q;  2KW2 A;  2KOO A;  5BS2 A;  1FR2 A;  3CMA P;  2JU1 A;  1AUM A;  3EJB A;  3DPH A;  1YIJ P;  2FVA A;  2OTJ P;  2E1M A;  1AF8 A;  2K2Q A;  4PWV B;  4XFX A;  1M6N A;  3CME P;  1YJN P;  1A43 A;  4QKO A;  2XZ0 D;  3G29 A;  2JB0 A;  2L4B A;  2JO0 A;  2K92 A;  4QNB A;  2PEN A;  2MY5 A;  2MD9 A;  2XV6 A;  1KQS O;  4U0B A;  5HGL A;  2M8L A;  1VQP P;  1N8R Q;  1F80 D;  1Q86 Q;  5HVC A;  3G21 A;  1ACP A;  1E6J P;  4BPF A;  2M8N A;  3E2D A;  4PH1 A;  3CCM P;  4IZ6 A;  2GZI A;  4NEO A;  2OTL P;  3CD6 P;  4COP A;  2VLP A;  5F2N A;  1RNI A;  2FAC A;  1EIA A;  2GZE A;  3GZL A;  1M1K Q;  2XXM A;  2FHS C;  2Z46 A;  2Z45 A;  2K0Y A;  1Q81 Q;  2CG5 B;  1GPJ A;  4COC A;  2ERH A;  2FAE A;  3CCQ P;  3HZQ A;  1Z6M A;  3CXC O;  3CC7 P;  2X2B A;  1GXH A;  3G6E P;  5KP7 B;  4XFY A;  2BUO A;  1VQ4 P;  1M90 Q;  1HQB A;  3DS3 A;  3DS4 A;  2JYG A;  3RG2 A;  1VQK P;  2GYK A;  2AFE A;  2KG9 A;  2JGP A;  2CWO A;  1DV5 A;  2N6Z A;  7CEI A;  1VQ8 P;  2PEI A;  2JBG A;  1VQ9 P;  2FQ1 A;  3H0D A;  2VLO A;  5DCK A;  5HGN A;  2M5R A;  2VLN A;  3CE7 A;  4BPH A;  1M6E X;  2KOP A;  3EJE A;  2LL8 A;  3H47 A;  3CCV P;  3GKL C;  2EIA A;  1IMQ A;  4WYM A;  2LKI A;  2N5I A;  4U0C A;  2K94 A;  1QVF O;  2NO8 A;  5EJD A;  2K0D X;  1ZMB A;  2FQ2 A;  2MR8 A;  1EOQ A;  5JPA A;  1VQL P;  5F2K A;  1RO0 A;  3DTJ A;  2K93 A;  2MF4 A;  4F37 A;  2GZF A;  2K5X A;  2N6Y A;  1T8K A;  4R0M A;  4XRQ A;  3CCL P;  1S72 P;  5EW5 E;  4M0I A;  4XFZ A;  1QVG O;  1K73 Q; 
#chains in the Genus database with same CATH homology
 1M1K Q;  5I4T G;  2JYL A;  2XXM A;  2Z46 A;  2EFJ A;  3Q20 A;  2Z45 A;  1VQO P;  4U0A A;  3G71 P;  1VQM P;  1BAJ A;  3G4S P;  1YIT P;  1D1D A;  2M8P A;  3LRY A;  1Q81 Q;  1K30 A;  3MGE A;  4COC A;  3CCQ P;  1VQ6 P;  3HZQ A;  4U0E A;  1YHQ P;  3HYB A;  2XT1 A;  3DS0 A;  2PY8 A;  4PH0 A;  2DGY A;  1RO2 A;  1K9M Q;  1A8O A;  1IUQ A;  3CXC O;  2Z44 A;  3CC7 P;  1VQ7 P;  2BHV A;  3CC2 P;  5F2O A;  1YJW P;  3RG6 C;  1QRJ A;  3G6E P;  4IPY A;  4XFY A;  2BUO A;  1Q7Y Q;  1VQ4 P;  1M90 Q;  3OW2 O;  3DS3 A;  3DS4 A;  2JYG A;  1VQK P;  5BS2 A;  2PEK A;  1NJI Q;  2EG5 A;  3CMA P;  2PEM A;  1AUM A;  2CWO A;  4XRO A;  4U0F A;  1VQ8 P;  2PEO A;  3CPW O;  3CCU P;  1VQ5 P;  2PEI A;  3VRL C;  3DPH A;  1YI2 P;  1YIJ P;  2OTJ P;  1VQ9 P;  2E1M A;  4GR2 A;  3H0D A;  5DCK A;  5HGN A;  4XFX A;  2L6E A;  1M6N A;  1M6E X;  3CME P;  1YJN P;  1A43 A;  3CCE P;  3H47 A;  3G29 A;  3G1G A;  3DS1 A;  5HGM A;  3CCV P;  3G1I A;  5HGO A;  2EIA A;  1JJ2 O;  2JO0 A;  3NTE A;  3H4E A;  2PEJ A;  2PEQ A;  4WYM A;  4QNB A;  2KOD A;  2PEN A;  4U0C A;  5BS1 A;  2XV6 A;  1QVF O;  1KQS O;  4U0B A;  1M74 A;  3I55 P;  3P05 A;  5HGL A;  1KD1 Q;  2M8L A;  1VQP P;  1W2B O;  1Q82 Q;  2QA4 P;  1N8R Q;  1VQN P;  1Q86 Q;  3CCJ P;  2ONT A;  3G0V A;  1ZMB A;  3G21 A;  3G26 A;  1KC8 Q;  3B5I A;  1EOQ A;  3CCS P;  5JPA A;  1K8A Q;  1VQL P;  5F2K A;  1RO0 A;  3DTJ A;  1E6J P;  3CCR P;  3CC4 P;  3M1M A;  1YJ9 P;  2M8N A;  3G28 A;  3E2D A;  3DS2 A;  3DS5 A;  4U0D A;  4PH1 A;  3CCM P;  3I56 P;  2OAR A;  2OTL P;  4XRQ A;  3CCL P;  3CD6 P;  1S72 P;  4COP A;  4M0I A;  3WBH A;  2LF4 A;  5F2N A;  2P9X A;  4XFZ A;  1RNI A;  1EIA A;  1QVG O;  4GR6 A;  2QEX P;  1K73 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...