2JYGA

Solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
b'TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24 (CA)
publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 16
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jygA00
5HGLA 2XV6A 3DS5A 3H47A 5HGNA 3DTJA 5JPAA 2XT1A 2ONTA 4PH1A 3DS0A 2JYLA 3MGEA 1A43A 2BUOA 3G1GA 3DS3A 4COPA 2JO0A 4XFZA 1AUMA 2JYGA 4QNBA 4PH0A 5HGOA 4M0IA 5I4TG 2LF4A 1D1DA 3G28A 3DS4A 4U0AA 1QRJA 4WYMA 5HGMA 4U0EA 4XRQA 3G21A 4U0BA 1E6JP 2L6EA 3DPHA 3H4EA 4XFYA 2M8LA 2M8NA 3P05A 3G0VA 1A8OA 1BAJA 2KODA 3DS2A 3G1IA 2XXMA 3NTEA 4U0CA 4XFXA 3VRLC 3LRYA 4U0DA 1EIAA 5DCKA 2EIAA 2M8PA 3G29A 3G26A 4XROA 4COCA 1EOQA 3DS1A 4IPYA 4U0FA
chains in the Genus database with same CATH superfamily
3CCEP 4PWVB 1K9MQ 2JB0A 3B5IA 2KGCA 2KOPA 3WBHA 1S72P 2KG9A 2L22A 2L9FA 3G21A 2WPTA 2LPKA 1IMPA 4UHPB 5KP7B 2FACA 2K5XA 3I56P 1UJZA 3CCVP 2FHSC 2XV6A 1VQOP 3MGEA 2FADA 3GKLC 1M6EX 2GZGA 3CCMP 5HGMA 1Z6MA 1K73Q 3CCSP 1ACPA 2JAZA 2N5HA 3CC2P 3CC4P 3RG6C 3GJNA 3CE7A 1YIJP 3DS1A 4IPYA 5CZDB 2K93A 1E0HA 1FR2A 3DS0A 2PEKA 2GZIA 4COPA 3I55P 2ROQA 2OTJP 2FQ1A 2VLQA 2JQ4A 2KGDA 1DNYA 1L0IA 1MZ8A 2AF8A 3H0DA 2VSQA 1VQKP 2L0QA 5HGLA 2KG8A 2JYGA 2LTEA 2AFDA 3DPHA 4XFYA 3CCUP 4U0CA 1QVGO 2PEOA 2E1MA 2JBGA 4R0MA 1HY8A 3B4QA 4U0FA 2AVAA 2KWLA 2GZFA 2VLOA 1ZNVA 2MVVA 1VHNA 4U0AA 4WYMA 2LIWA 4PXHB 2PY8A 4IZ6A 1W2BO 2MD9A 2MF4A 1EMVA 1JJ2O 1OR5A 2XZ1C 1YJNP 2JU1A 4PH1A 2BUOA 1IUQA 2K2QA 1ZMBA 5HGOA 5BS1A 1VKUA 1AYIA 2CGQA 1X3OA 2KODA 1N8RQ 2M8PA 1F80D 1RNIA 2KGEA 2VLNA 2N6YA 2JYLA 5F2KA 3OW2O 2GZJA 4QNBA 4PH0A 2MY5A 2M5RA 2EHSA 2FAEA 5HV8A 1E6JP 3CMAP 1KC8Q 2JGPA 4HKGA 3DTJA 2KOOA 3DS5A 1T8KA 3CMEP 3CCRP 2KW2A 2OARA 3M1MA 3EJDA 2CG5B 2K94A 1M1KQ 1Q86Q 1YITP 2GYKA 3DS4A 4MRTC 3HZQA 2P9XA 2KOQA 2DGYA 1BAJA 2K0DX 2EHTA 2N50A 1DV5A 4H2XC 3H47A 5HGNA 1VQ6P 1BXIA 1YHQP 1VQ9P 2PEQA 5EW5E 1GPJA 7CEIA 2QEXP 1GXGA 2L6EA 1K8AQ 1RO0A 2M8NA 4F37A 1A8OA 2DNWA 3EJEA 2ONTA 3E2DA 1A43A 3G1GA 1GXHA 1K30A 2FVAA 2K0YA 2LMLA 3G28A 4U0BA 2LKIA 1UNKA 2GDXA 2M8LA 2XXMA 3RG2A 5F2NA 2N6ZA 2EIAA 3CD6P 4DG9A 3G4SP 1Q7YQ 2KOSA 1EOQA 1VQMP 2VLPA 1YJWP 1QVFO 2QNWA 2JO0A 2PNGA 4XFZA 2MR8A 2LOLA 2OTLP 2EFJA 1Q82Q 3GZLA 2GDWA 3P05A 1M6NA 3CC7P 2LIUA 2KG6A 2FVEA 1KLPA 4GR2A 1M74A 5KP8B 2GDYA 2XT1A 1Q81Q 3G71P 2CWOA 3HYBA 1YJ9P 4M0IA 2LF4A 1D1DA 1VQNP 1QRJA 2Z46A 2GZEA 2AFEA 4QKOA 3LRYA 2MR7A 5EJDA 1CEIA 1KD1Q 5DCKA 4CA3A 4GR6A 1VQLP 2FVFA 5HVCA 3U43A 1IMQA 3NY7B 1AF8A 4H2YC 5KP6B 2FQ2A 1VQPP 3CCQP 3CXCO 1VQ5P 3CCLP 2KGAA 2Z44A 3NTEA 2PEMA 2PEIA 5BS2A 2K92A 1VQ7P 4BPFA 1L0HA 3CPWO 1VQ4P 2JU2A 2QA4P 1NJIQ 3G1IA 2XZ0D 4U0DA 1EIAA 3GZMA 2LL8A 4H2WC 3G26A 4NEOA 5JPAA 1AUMA 5I4TG 2NO8A 3Q20A 4BPGA 2X2BA 2N5IA 2K0XA 2KR5A 2CNRA 1VQ8P 3G0VA 1HQBA 2EG5A 4XFXA 1RO2A 1NQ4A 2PEJA 1M90Q 3LMOA 3G6EP 3DS3A 2L4BA 2Z45A 2ERHA 2PENA 4U0EA 4XRQA 4BPHA 1YI2P 2MVUA 2N98A 3CCJP 3H4EA 2FQ0A 3EJBA 3DS2A 1KQSO 3VRLC 2BHVA 2KORA 2CQ8A 3G29A 4XROA 4COCA 5F2OA
chains in the Genus database with same CATH topology
4GR6A 1VQLP 3CCEP 3H47A 1K9MQ 5HGNA 1VQ6P 3B5IA 1YHQP 1VQ9P 2PEQA 3WBHA 1S72P 1VQPP 4U0AA 4WYMA 3CCQP 2PY8A 3CXCO 3G21A 1VQ5P 2QEXP 2L6EA 1K8AQ 3CCLP 1W2BO 1RO0A 2M8NA 1A8OA 2Z44A 1JJ2O 3NTEA 2PEMA 3I56P 2PEIA 3CCVP 5BS2A 1VQ7P 1YJNP 2XV6A 1VQOP 2ONTA 4PH1A 3E2DA 3MGEA 1A43A 2BUOA 1IUQA 3G1GA 1K30A 1ZMBA 5HGOA 1M6EX 5BS1A 3G28A 3CPWO 3CCMP 5HGMA 1VQ4P 4U0BA 1K73Q 3CCSP 2QA4P 2M8LA 1NJIQ 2KODA 3G1IA 2XXMA 3CC2P 3CC4P 4U0DA 1EIAA 3RG6C 1N8RQ 5F2NA 2EIAA 2M8PA 3G4SP 3CD6P 1Q7YQ 1YIJP 3G26A 1EOQA 3DS1A 1RNIA 4IPYA 1VQMP 5JPAA 1YJWP 1QVFO 3DS0A 2JYLA 2PEKA 4COPA 2JO0A 5F2KA 3OW2O 4XFZA 1AUMA 4QNBA 4PH0A 3I55P 5I4TG 2OTLP 2EFJA 1Q82Q 3Q20A 2OTJP 1E6JP 3CMAP 1VQ8P 3P05A 3G0VA 3H0DA 1M6NA 2EG5A 4XFXA 3CC7P 1RO2A 1KC8Q 1VQKP 2PEJA 1M90Q 3DTJA 5HGLA 4GR2A 3DS5A 1M74A 2XT1A 3G6EP 3CMEP 3CCRP 2OARA 3M1MA 3DS3A 1Q81Q 3G71P 2CWOA 3HYBA 1YJ9P 2JYGA 1M1KQ 4M0IA 1Q86Q 2LF4A 1YITP 1D1DA 3DS4A 2Z45A 1QRJA 1VQNP 2PENA 4U0EA 4XRQA 1YI2P 3CCJP 2Z46A 3DPHA 3H4EA 3HZQA 4XFYA 2P9XA 3CCUP 2DGYA 1BAJA 3DS2A 4U0CA 1KQSO 1QVGO 3VRLC 3LRYA 2PEOA 2E1MA 2BHVA 1KD1Q 5DCKA 3G29A 4XROA 4COCA 5F2OA 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGL A;  2XV6 A;  3DS5 A;  3H47 A;  5HGN A;  3DTJ A;  5JPA A;  2XT1 A;  2ONT A;  4PH1 A;  3DS0 A;  2JYL A;  3MGE A;  1A43 A;  2BUO A;  3G1G A;  3DS3 A;  4COP A;  2JO0 A;  4XFZ A;  1AUM A;  2JYG A;  4QNB A;  4PH0 A;  5HGO A;  4M0I A;  5I4T G;  2LF4 A;  1D1D A;  3G28 A;  3DS4 A;  4U0A A;  1QRJ A;  4WYM A;  5HGM A;  4U0E A;  4XRQ A;  3G21 A;  4U0B A;  1E6J P;  2L6E A;  3DPH A;  3H4E A;  4XFY A;  2M8L A;  2M8N A;  3P05 A;  3G0V A;  1A8O A;  1BAJ A;  2KOD A;  3DS2 A;  3G1I A;  2XXM A;  3NTE A;  4U0C A;  4XFX A;  3VRL C;  3LRY A;  4U0D A;  1EIA A;  5DCK A;  2EIA A;  2M8P A;  3G29 A;  3G26 A;  4XRO A;  4COC A;  1EOQ A;  3DS1 A;  4IPY A;  4U0F A; 
#chains in the Genus database with same CATH topology
 3CCE P;  4PWV B;  1K9M Q;  2JB0 A;  3B5I A;  2KGC A;  2KOP A;  3WBH A;  1S72 P;  2KG9 A;  2L22 A;  2L9F A;  3G21 A;  2WPT A;  2LPK A;  1IMP A;  4UHP B;  5KP7 B;  2FAC A;  2K5X A;  3I56 P;  1UJZ A;  3CCV P;  2FHS C;  2XV6 A;  1VQO P;  3MGE A;  2FAD A;  3GKL C;  1M6E X;  2GZG A;  3CCM P;  5HGM A;  1Z6M A;  1K73 Q;  3CCS P;  1ACP A;  2JAZ A;  2N5H A;  3CC2 P;  3CC4 P;  3RG6 C;  3GJN A;  3CE7 A;  1YIJ P;  3DS1 A;  4IPY A;  5CZD B;  2K93 A;  1E0H A;  1FR2 A;  3DS0 A;  2PEK A;  2GZI A;  4COP A;  3I55 P;  2ROQ A;  2OTJ P;  2FQ1 A;  2VLQ A;  2JQ4 A;  2KGD A;  1DNY A;  1L0I A;  1MZ8 A;  2AF8 A;  3H0D A;  2VSQ A;  1VQK P;  2L0Q A;  5HGL A;  2KG8 A;  2JYG A;  2LTE A;  2AFD A;  3DPH A;  4XFY A;  3CCU P;  4U0C A;  1QVG O;  2PEO A;  2E1M A;  2JBG A;  4R0M A;  1HY8 A;  3B4Q A;  4U0F A;  2AVA A;  2KWL A;  2GZF A;  2VLO A;  1ZNV A;  2MVV A;  1VHN A;  4U0A A;  4WYM A;  2LIW A;  4PXH B;  2PY8 A;  4IZ6 A;  1W2B O;  2MD9 A;  2MF4 A;  1EMV A;  1JJ2 O;  1OR5 A;  2XZ1 C;  1YJN P;  2JU1 A;  4PH1 A;  2BUO A;  1IUQ A;  2K2Q A;  1ZMB A;  5HGO A;  5BS1 A;  1VKU A;  1AYI A;  2CGQ A;  1X3O A;  2KOD A;  1N8R Q;  2M8P A;  1F80 D;  1RNI A;  2KGE A;  2VLN A;  2N6Y A;  2JYL A;  5F2K A;  3OW2 O;  2GZJ A;  4QNB A;  4PH0 A;  2MY5 A;  2M5R A;  2EHS A;  2FAE A;  5HV8 A;  1E6J P;  3CMA P;  1KC8 Q;  2JGP A;  4HKG A;  3DTJ A;  2KOO A;  3DS5 A;  1T8K A;  3CME P;  3CCR P;  2KW2 A;  2OAR A;  3M1M A;  3EJD A;  2CG5 B;  2K94 A;  1M1K Q;  1Q86 Q;  1YIT P;  2GYK A;  3DS4 A;  4MRT C;  3HZQ A;  2P9X A;  2KOQ A;  2DGY A;  1BAJ A;  2K0D X;  2EHT A;  2N50 A;  1DV5 A;  4H2X C;  3H47 A;  5HGN A;  1VQ6 P;  1BXI A;  1YHQ P;  1VQ9 P;  2PEQ A;  5EW5 E;  1GPJ A;  7CEI A;  2QEX P;  1GXG A;  2L6E A;  1K8A Q;  1RO0 A;  2M8N A;  4F37 A;  1A8O A;  2DNW A;  3EJE A;  2ONT A;  3E2D A;  1A43 A;  3G1G A;  1GXH A;  1K30 A;  2FVA A;  2K0Y A;  2LML A;  3G28 A;  4U0B A;  2LKI A;  1UNK A;  2GDX A;  2M8L A;  2XXM A;  3RG2 A;  5F2N A;  2N6Z A;  2EIA A;  3CD6 P;  4DG9 A;  3G4S P;  1Q7Y Q;  2KOS A;  1EOQ A;  1VQM P;  2VLP A;  1YJW P;  1QVF O;  2QNW A;  2JO0 A;  2PNG A;  4XFZ A;  2MR8 A;  2LOL A;  2OTL P;  2EFJ A;  1Q82 Q;  3GZL A;  2GDW A;  3P05 A;  1M6N A;  3CC7 P;  2LIU A;  2KG6 A;  2FVE A;  1KLP A;  4GR2 A;  1M74 A;  5KP8 B;  2GDY A;  2XT1 A;  1Q81 Q;  3G71 P;  2CWO A;  3HYB A;  1YJ9 P;  4M0I A;  2LF4 A;  1D1D A;  1VQN P;  1QRJ A;  2Z46 A;  2GZE A;  2AFE A;  4QKO A;  3LRY A;  2MR7 A;  5EJD A;  1CEI A;  1KD1 Q;  5DCK A;  4CA3 A;  4GR6 A;  1VQL P;  2FVF A;  5HVC A;  3U43 A;  1IMQ A;  3NY7 B;  1AF8 A;  4H2Y C;  5KP6 B;  2FQ2 A;  1VQP P;  3CCQ P;  3CXC O;  1VQ5 P;  3CCL P;  2KGA A;  2Z44 A;  3NTE A;  2PEM A;  2PEI A;  5BS2 A;  2K92 A;  1VQ7 P;  4BPF A;  1L0H A;  3CPW O;  1VQ4 P;  2JU2 A;  2QA4 P;  1NJI Q;  3G1I A;  2XZ0 D;  4U0D A;  1EIA A;  3GZM A;  2LL8 A;  4H2W C;  3G26 A;  4NEO A;  5JPA A;  1AUM A;  5I4T G;  2NO8 A;  3Q20 A;  4BPG A;  2X2B A;  2N5I A;  2K0X A;  2KR5 A;  2CNR A;  1VQ8 P;  3G0V A;  1HQB A;  2EG5 A;  4XFX A;  1RO2 A;  1NQ4 A;  2PEJ A;  1M90 Q;  3LMO A;  3G6E P;  3DS3 A;  2L4B A;  2Z45 A;  2ERH A;  2PEN A;  4U0E A;  4XRQ A;  4BPH A;  1YI2 P;  2MVU A;  2N98 A;  3CCJ P;  3H4E A;  2FQ0 A;  3EJB A;  3DS2 A;  1KQS O;  3VRL C;  2BHV A;  2KOR A;  2CQ8 A;  3G29 A;  4XRO A;  4COC A;  5F2O A; 
#chains in the Genus database with same CATH homology
 4GR6 A;  1VQL P;  3CCE P;  3H47 A;  1K9M Q;  5HGN A;  1VQ6 P;  3B5I A;  1YHQ P;  1VQ9 P;  2PEQ A;  3WBH A;  1S72 P;  1VQP P;  4U0A A;  4WYM A;  3CCQ P;  2PY8 A;  3CXC O;  3G21 A;  1VQ5 P;  2QEX P;  2L6E A;  1K8A Q;  3CCL P;  1W2B O;  1RO0 A;  2M8N A;  1A8O A;  2Z44 A;  1JJ2 O;  3NTE A;  2PEM A;  3I56 P;  2PEI A;  3CCV P;  5BS2 A;  1VQ7 P;  1YJN P;  2XV6 A;  1VQO P;  2ONT A;  4PH1 A;  3E2D A;  3MGE A;  1A43 A;  2BUO A;  1IUQ A;  3G1G A;  1K30 A;  1ZMB A;  5HGO A;  1M6E X;  5BS1 A;  3G28 A;  3CPW O;  3CCM P;  5HGM A;  1VQ4 P;  4U0B A;  1K73 Q;  3CCS P;  2QA4 P;  2M8L A;  1NJI Q;  2KOD A;  3G1I A;  2XXM A;  3CC2 P;  3CC4 P;  4U0D A;  1EIA A;  3RG6 C;  1N8R Q;  5F2N A;  2EIA A;  2M8P A;  3G4S P;  3CD6 P;  1Q7Y Q;  1YIJ P;  3G26 A;  1EOQ A;  3DS1 A;  1RNI A;  4IPY A;  1VQM P;  5JPA A;  1YJW P;  1QVF O;  3DS0 A;  2JYL A;  2PEK A;  4COP A;  2JO0 A;  5F2K A;  3OW2 O;  4XFZ A;  1AUM A;  4QNB A;  4PH0 A;  3I55 P;  5I4T G;  2OTL P;  2EFJ A;  1Q82 Q;  3Q20 A;  2OTJ P;  1E6J P;  3CMA P;  1VQ8 P;  3P05 A;  3G0V A;  3H0D A;  1M6N A;  2EG5 A;  4XFX A;  3CC7 P;  1RO2 A;  1KC8 Q;  1VQK P;  2PEJ A;  1M90 Q;  3DTJ A;  5HGL A;  4GR2 A;  3DS5 A;  1M74 A;  2XT1 A;  3G6E P;  3CME P;  3CCR P;  2OAR A;  3M1M A;  3DS3 A;  1Q81 Q;  3G71 P;  2CWO A;  3HYB A;  1YJ9 P;  2JYG A;  1M1K Q;  4M0I A;  1Q86 Q;  2LF4 A;  1YIT P;  1D1D A;  3DS4 A;  2Z45 A;  1QRJ A;  1VQN P;  2PEN A;  4U0E A;  4XRQ A;  1YI2 P;  3CCJ P;  2Z46 A;  3DPH A;  3H4E A;  3HZQ A;  4XFY A;  2P9X A;  3CCU P;  2DGY A;  1BAJ A;  3DS2 A;  4U0C A;  1KQS O;  1QVG O;  3VRL C;  3LRY A;  2PEO A;  2E1M A;  2BHV A;  1KD1 Q;  5DCK A;  3G29 A;  4XRO A;  4COC A;  5F2O A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...