2JYGA

Solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 16
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jygA00
3DS3A 1A8OA 4XFXA 2M8LA 4COPA 3G21A 4PH1A 3G28A 1BAJA 4U0CA 4XFYA 4XROA 2XV6A 3DS0A 3DS5A 4PH0A 3G1GA 5HGOA 3MGEA 5HGNA 2LF4A 3H4EA 2L6EA 2M8PA 1E6JP 1A43A 5DCKA 3P05A 3DS1A 3H47A 4WYMA 4IPYA 5I4TG 3DPHA 3DS4A 4COCA 2EIAA 5HGMA 3DTJA 3NTEA 2ONTA 2JYLA 2KODA 3G26A 2M8NA 4U0FA 1D1DA 4U0BA 4QNBA 3G29A 3G0VA 2JYGA 2JO0A 3LRYA 4XRQA 4U0DA 4XFZA 5JPAA 4U0AA 1QRJA 3DS2A 4M0IA 3G1IA 2XT1A 5HGLA 3VRLC 1EIAA 4U0EA 1AUMA 1EOQA 2BUOA 2XXMA
chains in the Genus database with same CATH superfamily
1A8OA 1AYIA 3DS5A 3WBHA 3B4QA 1VQ4P 1RO0A 2N5IA 4UHPB 2KWLA 3CCVP 2M8NA 1YI2P 3G29A 3G0VA 1DNYA 2JO0A 1E0HA 1K30A 3G1IA 2AFEA 2XXMA 5BS2A 2KOPA 3EJBA 5HV8A 4DG9A 2LIWA 3G1GA 3GZLA 1VQPP 2CQ8A 2M5RA 1IUQA 2DNWA 1YJWP 2GZGA 3DTJA 2WPTA 1VQ9P 2GDWA 1Q86Q 4BPGA 1KQSO 2XT1A 1EIAA 2KGCA 3CCRP 1BAJA 3CCLP 2EFJA 2GZIA 3CXCO 2L9FA 4IPYA 3CCJP 1BXIA 3CD6P 2PENA 2MY5A 2L22A 1GPJA 2NO8A 2PEIA 3CMEP 1GXGA 2N6ZA 2JU1A 1YHQP 2MVUA 2JYLA 4IZ6A 1K73Q 2MF4A 1QRJA 1F80D 2BUOA 4QKOA 3CE7A 5HGNA 3OW2O 2K92A 2LF4A 2KOOA 3CC4P 3M1MA 4R0MA 2CWOA 3DPHA 2OTLP 2GYKA 2KODA 1KC8Q 5KP6B 2EG5A 2KR5A 2JQ4A 1AF8A 5JPAA 4U0AA 1ZNVA 3CCUP 4M0IA 2KOQA 1HY8A 1HQBA 1EMVA 2VLOA 1A43A 4WYMA 1K9MQ 3DS4A 2QA4P 3RG2A 3CCSP 1IMQA 1D1DA 1QVFO 1L0HA 3DS2A 1AUMA 3GZMA 1Z6MA 1VQ6P 4BPHA 3G28A 7CEIA 1T8KA 1ZMBA 2ERHA 2P9XA 2X2BA 1YITP 2PEOA 1JJ2O 2CGQA 4COCA 1ACPA 5F2KA 2VLQA 3NTEA 2ONTA 1VQKP 3Q20A 4QNBA 1M1KQ 2EHTA 1RNIA 2FVAA 3EJDA 2LOLA 1UJZA 4XFYA 2XV6A 1VKUA 2K0YA 3G6EP 1YJNP 4HKGA 3EJEA 1M90Q 2L4BA 2MD9A 1Q82Q 3CCEP 4U0DA 1MZ8A 2KGEA 4XFXA 3LMOA 2GZEA 3MGEA 2K93A 3B5IA 5HVCA 5DCKA 2L0QA 4MRTC 5I4TG 3I56P 2FADA 2VLNA 2EIAA 3U43A 1VQNP 2K2QA 5EW5E 4U0FA 2AVAA 1NJIQ 2PNGA 2FVEA 2KGDA 1X3OA 4U0EA 2FACA 4CA3A 4COPA 2FVFA 4U0CA 2L6EA 2XZ1C 2KG8A 2K5XA 1QVGO 3H0DA 5EJDA 1VQ5P 1IMPA 4XRQA 2OTJP 2PEKA 1S72P 1W2BO 1YJ9P 2VSQA 4PH1A 3DS0A 2N98A 2LIUA 2LKIA 2FHSC 3I55P 2KW2A 2JAZA 4XFZA 2N5HA 3CC7P 1EOQA 1N8RQ 3CPWO 1M6NA 2PEQA 2ROQA 4XROA 1RO2A 4PXHB 2LPKA 5F2NA 2M8PA 3HZQA 1E6JP 3P05A 2VLPA 3E2DA 2BHVA 2KOSA 3NY7B 2LMLA 3GKLC 2GZJA 5HGLA 1L0IA 5BS1A 2PEJA 1GXHA 1VQOP 4GR6A 2FQ0A 2EHSA 2GDXA 3G21A 2LL8A 4PWVB 2Z46A 1Q81Q 3H4EA 2KG6A 2CNRA 3DS1A 2DGYA 3GJNA 5CZDB 5KP7B 2QEXP 3CC2P 2KG9A 2OARA 2K94A 2MR8A 2GDYA 2FQ2A 2JYGA 5F2OA 2JU2A 3G4SP 1VHNA 2Z44A 3RG6C 1VQ7P 2Z45A 3CCQP 4NEOA 3DS3A 2M8LA 1KD1Q 4PH0A 2K0DX 2N6YA 2AF8A 2K0XA 2QNWA 1VQ8P 1M74A 4GR2A 1FR2A 2MR7A 1VQMP 1K8AQ 3CMAP 2JGPA 5HGMA 1M6EX 5KP8B 2PEMA 1NQ4A 3LRYA 4H2WC 2XZ0D 3VRLC 2E1MA 1CEIA 5HGOA 3G71P 2PY8A 3CCMP 2N50A 2KORA 4H2XC 4U0BA 2AFDA 1VQLP 4BPFA 1UNKA 1DV5A 2FQ1A 2MVVA 1KLPA 3HYBA 1YIJP 3H47A 1OR5A 2FAEA 2JBGA 3G26A 4H2YC 2JB0A 2GZFA 2LTEA 4F37A 2KGAA 1Q7YQ 2CG5B
chains in the Genus database with same CATH topology
1VQOP 4GR6A 1A8OA 4XFXA 3G21A 2Z46A 3DS5A 3MGEA 3WBHA 5HGNA 3OW2O 2LF4A 3H4EA 1Q81Q 3CC4P 3M1MA 3B5IA 2CWOA 1VQ4P 5DCKA 1RO0A 3DS1A 2DGYA 5I4TG 3DPHA 3I56P 2QEXP 2OTLP 2EIAA 1VQNP 2KODA 1KC8Q 3CC2P 2OARA 3CCVP 2M8NA 4U0FA 1YI2P 2EG5A 3G29A 3G0VA 2JYGA 1NJIQ 2JO0A 5F2OA 5JPAA 1K30A 4U0AA 3G4SP 3G1IA 3RG6C 2Z44A 1VQ7P 2Z45A 4U0EA 2XXMA 3CCQP 4M0IA 3CCUP 5BS2A 3DS3A 2M8LA 1KD1Q 4COPA 4U0CA 4PH0A 3G1GA 1VQPP 2L6EA 1M74A 1VQ8P 1A43A 1IUQA 4WYMA 4GR2A 1YJWP 1K9MQ 1VQMP 3DS4A 2QA4P 1QVGO 3H0DA 1K8AQ 3CMAP 5HGMA 3DTJA 1VQ5P 3CCSP 1M6EX 1VQ9P 2PEMA 1D1DA 1QVFO 3LRYA 4XRQA 1Q86Q 3DS2A 1KQSO 2OTJP 2PEKA 2XT1A 3VRLC 1EIAA 1AUMA 2E1MA 1S72P 1W2BO 1VQ6P 1YJ9P 3CCRP 4PH1A 3G28A 1BAJA 5HGOA 3CCLP 2EFJA 3DS0A 3G71P 1ZMBA 2PY8A 3CCMP 2P9XA 1YITP 2PEOA 3CXCO 1JJ2O 3I55P 4IPYA 3CCJP 4COCA 5F2KA 3NTEA 2ONTA 1VQKP 3Q20A 3CD6P 4U0BA 4QNBA 1M1KQ 2PENA 1VQLP 4XFZA 3CC7P 1RNIA 1EOQA 1N8RQ 3CPWO 1M6NA 2PEQA 4XROA 4XFYA 1RO2A 2XV6A 2PEIA 5F2NA 2M8PA 3HZQA 3G6EP 3CMEP 1E6JP 3HYBA 1YJNP 1YIJP 3P05A 3H47A 1YHQP 3E2DA 2BHVA 1M90Q 2JYLA 3G26A 1K73Q 3CCEP 1Q82Q 4U0DA 1QRJA 5HGLA 5BS1A 2PEJA 2BUOA 1Q7YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS3 A;  1A8O A;  4XFX A;  2M8L A;  4COP A;  3G21 A;  4PH1 A;  3G28 A;  1BAJ A;  4U0C A;  4XFY A;  4XRO A;  2XV6 A;  3DS0 A;  3DS5 A;  4PH0 A;  3G1G A;  5HGO A;  3MGE A;  5HGN A;  2LF4 A;  3H4E A;  2L6E A;  2M8P A;  1E6J P;  1A43 A;  5DCK A;  3P05 A;  3DS1 A;  3H47 A;  4WYM A;  4IPY A;  5I4T G;  3DPH A;  3DS4 A;  4COC A;  2EIA A;  5HGM A;  3DTJ A;  3NTE A;  2ONT A;  2JYL A;  2KOD A;  3G26 A;  2M8N A;  4U0F A;  1D1D A;  4U0B A;  4QNB A;  3G29 A;  3G0V A;  2JYG A;  2JO0 A;  3LRY A;  4XRQ A;  4U0D A;  4XFZ A;  5JPA A;  4U0A A;  1QRJ A;  3DS2 A;  4M0I A;  3G1I A;  2XT1 A;  5HGL A;  3VRL C;  1EIA A;  4U0E A;  1AUM A;  1EOQ A;  2BUO A;  2XXM A; 
#chains in the Genus database with same CATH topology
 1A8O A;  1AYI A;  3DS5 A;  3WBH A;  3B4Q A;  1VQ4 P;  1RO0 A;  2N5I A;  4UHP B;  2KWL A;  3CCV P;  2M8N A;  1YI2 P;  3G29 A;  3G0V A;  1DNY A;  2JO0 A;  1E0H A;  1K30 A;  3G1I A;  2AFE A;  2XXM A;  5BS2 A;  2KOP A;  3EJB A;  5HV8 A;  4DG9 A;  2LIW A;  3G1G A;  3GZL A;  1VQP P;  2CQ8 A;  2M5R A;  1IUQ A;  2DNW A;  1YJW P;  2GZG A;  3DTJ A;  2WPT A;  1VQ9 P;  2GDW A;  1Q86 Q;  4BPG A;  1KQS O;  2XT1 A;  1EIA A;  2KGC A;  3CCR P;  1BAJ A;  3CCL P;  2EFJ A;  2GZI A;  3CXC O;  2L9F A;  4IPY A;  3CCJ P;  1BXI A;  3CD6 P;  2PEN A;  2MY5 A;  2L22 A;  1GPJ A;  2NO8 A;  2PEI A;  3CME P;  1GXG A;  2N6Z A;  2JU1 A;  1YHQ P;  2MVU A;  2JYL A;  4IZ6 A;  1K73 Q;  2MF4 A;  1QRJ A;  1F80 D;  2BUO A;  4QKO A;  3CE7 A;  5HGN A;  3OW2 O;  2K92 A;  2LF4 A;  2KOO A;  3CC4 P;  3M1M A;  4R0M A;  2CWO A;  3DPH A;  2OTL P;  2GYK A;  2KOD A;  1KC8 Q;  5KP6 B;  2EG5 A;  2KR5 A;  2JQ4 A;  1AF8 A;  5JPA A;  4U0A A;  1ZNV A;  3CCU P;  4M0I A;  2KOQ A;  1HY8 A;  1HQB A;  1EMV A;  2VLO A;  1A43 A;  4WYM A;  1K9M Q;  3DS4 A;  2QA4 P;  3RG2 A;  3CCS P;  1IMQ A;  1D1D A;  1QVF O;  1L0H A;  3DS2 A;  1AUM A;  3GZM A;  1Z6M A;  1VQ6 P;  4BPH A;  3G28 A;  7CEI A;  1T8K A;  1ZMB A;  2ERH A;  2P9X A;  2X2B A;  1YIT P;  2PEO A;  1JJ2 O;  2CGQ A;  4COC A;  1ACP A;  5F2K A;  2VLQ A;  3NTE A;  2ONT A;  1VQK P;  3Q20 A;  4QNB A;  1M1K Q;  2EHT A;  1RNI A;  2FVA A;  3EJD A;  2LOL A;  1UJZ A;  4XFY A;  2XV6 A;  1VKU A;  2K0Y A;  3G6E P;  1YJN P;  4HKG A;  3EJE A;  1M90 Q;  2L4B A;  2MD9 A;  1Q82 Q;  3CCE P;  4U0D A;  1MZ8 A;  2KGE A;  4XFX A;  3LMO A;  2GZE A;  3MGE A;  2K93 A;  3B5I A;  5HVC A;  5DCK A;  2L0Q A;  4MRT C;  5I4T G;  3I56 P;  2FAD A;  2VLN A;  2EIA A;  3U43 A;  1VQN P;  2K2Q A;  5EW5 E;  4U0F A;  2AVA A;  1NJI Q;  2PNG A;  2FVE A;  2KGD A;  1X3O A;  4U0E A;  2FAC A;  4CA3 A;  4COP A;  2FVF A;  4U0C A;  2L6E A;  2XZ1 C;  2KG8 A;  2K5X A;  1QVG O;  3H0D A;  5EJD A;  1VQ5 P;  1IMP A;  4XRQ A;  2OTJ P;  2PEK A;  1S72 P;  1W2B O;  1YJ9 P;  2VSQ A;  4PH1 A;  3DS0 A;  2N98 A;  2LIU A;  2LKI A;  2FHS C;  3I55 P;  2KW2 A;  2JAZ A;  4XFZ A;  2N5H A;  3CC7 P;  1EOQ A;  1N8R Q;  3CPW O;  1M6N A;  2PEQ A;  2ROQ A;  4XRO A;  1RO2 A;  4PXH B;  2LPK A;  5F2N A;  2M8P A;  3HZQ A;  1E6J P;  3P05 A;  2VLP A;  3E2D A;  2BHV A;  2KOS A;  3NY7 B;  2LML A;  3GKL C;  2GZJ A;  5HGL A;  1L0I A;  5BS1 A;  2PEJ A;  1GXH A;  1VQO P;  4GR6 A;  2FQ0 A;  2EHS A;  2GDX A;  3G21 A;  2LL8 A;  4PWV B;  2Z46 A;  1Q81 Q;  3H4E A;  2KG6 A;  2CNR A;  3DS1 A;  2DGY A;  3GJN A;  5CZD B;  5KP7 B;  2QEX P;  3CC2 P;  2KG9 A;  2OAR A;  2K94 A;  2MR8 A;  2GDY A;  2FQ2 A;  2JYG A;  5F2O A;  2JU2 A;  3G4S P;  1VHN A;  2Z44 A;  3RG6 C;  1VQ7 P;  2Z45 A;  3CCQ P;  4NEO A;  3DS3 A;  2M8L A;  1KD1 Q;  4PH0 A;  2K0D X;  2N6Y A;  2AF8 A;  2K0X A;  2QNW A;  1VQ8 P;  1M74 A;  4GR2 A;  1FR2 A;  2MR7 A;  1VQM P;  1K8A Q;  3CMA P;  2JGP A;  5HGM A;  1M6E X;  5KP8 B;  2PEM A;  1NQ4 A;  3LRY A;  4H2W C;  2XZ0 D;  3VRL C;  2E1M A;  1CEI A;  5HGO A;  3G71 P;  2PY8 A;  3CCM P;  2N50 A;  2KOR A;  4H2X C;  4U0B A;  2AFD A;  1VQL P;  4BPF A;  1UNK A;  1DV5 A;  2FQ1 A;  2MVV A;  1KLP A;  3HYB A;  1YIJ P;  3H47 A;  1OR5 A;  2FAE A;  2JBG A;  3G26 A;  4H2Y C;  2JB0 A;  2GZF A;  2LTE A;  4F37 A;  2KGA A;  1Q7Y Q;  2CG5 B; 
#chains in the Genus database with same CATH homology
 1VQO P;  4GR6 A;  1A8O A;  4XFX A;  3G21 A;  2Z46 A;  3DS5 A;  3MGE A;  3WBH A;  5HGN A;  3OW2 O;  2LF4 A;  3H4E A;  1Q81 Q;  3CC4 P;  3M1M A;  3B5I A;  2CWO A;  1VQ4 P;  5DCK A;  1RO0 A;  3DS1 A;  2DGY A;  5I4T G;  3DPH A;  3I56 P;  2QEX P;  2OTL P;  2EIA A;  1VQN P;  2KOD A;  1KC8 Q;  3CC2 P;  2OAR A;  3CCV P;  2M8N A;  4U0F A;  1YI2 P;  2EG5 A;  3G29 A;  3G0V A;  2JYG A;  1NJI Q;  2JO0 A;  5F2O A;  5JPA A;  1K30 A;  4U0A A;  3G4S P;  3G1I A;  3RG6 C;  2Z44 A;  1VQ7 P;  2Z45 A;  4U0E A;  2XXM A;  3CCQ P;  4M0I A;  3CCU P;  5BS2 A;  3DS3 A;  2M8L A;  1KD1 Q;  4COP A;  4U0C A;  4PH0 A;  3G1G A;  1VQP P;  2L6E A;  1M74 A;  1VQ8 P;  1A43 A;  1IUQ A;  4WYM A;  4GR2 A;  1YJW P;  1K9M Q;  1VQM P;  3DS4 A;  2QA4 P;  1QVG O;  3H0D A;  1K8A Q;  3CMA P;  5HGM A;  3DTJ A;  1VQ5 P;  3CCS P;  1M6E X;  1VQ9 P;  2PEM A;  1D1D A;  1QVF O;  3LRY A;  4XRQ A;  1Q86 Q;  3DS2 A;  1KQS O;  2OTJ P;  2PEK A;  2XT1 A;  3VRL C;  1EIA A;  1AUM A;  2E1M A;  1S72 P;  1W2B O;  1VQ6 P;  1YJ9 P;  3CCR P;  4PH1 A;  3G28 A;  1BAJ A;  5HGO A;  3CCL P;  2EFJ A;  3DS0 A;  3G71 P;  1ZMB A;  2PY8 A;  3CCM P;  2P9X A;  1YIT P;  2PEO A;  3CXC O;  1JJ2 O;  3I55 P;  4IPY A;  3CCJ P;  4COC A;  5F2K A;  3NTE A;  2ONT A;  1VQK P;  3Q20 A;  3CD6 P;  4U0B A;  4QNB A;  1M1K Q;  2PEN A;  1VQL P;  4XFZ A;  3CC7 P;  1RNI A;  1EOQ A;  1N8R Q;  3CPW O;  1M6N A;  2PEQ A;  4XRO A;  4XFY A;  1RO2 A;  2XV6 A;  2PEI A;  5F2N A;  2M8P A;  3HZQ A;  3G6E P;  3CME P;  1E6J P;  3HYB A;  1YJN P;  1YIJ P;  3P05 A;  3H47 A;  1YHQ P;  3E2D A;  2BHV A;  1M90 Q;  2JYL A;  3G26 A;  1K73 Q;  3CCE P;  1Q82 Q;  4U0D A;  1QRJ A;  5HGL A;  5BS1 A;  2PEJ A;  2BUO A;  1Q7Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...