2JYGA

Solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Capsid protein p24 (CA)
publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 16
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jygA00
5I4TG 2L6EA 3DS5A 4IPYA 2EIAA 2KODA 3LRYA 2JYLA 3G21A 2M8PA 4U0DA 4PH1A 1E6JP 3G29A 5HGLA 4PH0A 3DS3A 4QNBA 1EOQA 4WYMA 5HGMA 5JPAA 3G1IA 3G0VA 2M8NA 3DS2A 2JO0A 3DS4A 3G26A 4M0IA 3DPHA 4XFYA 4XRQA 4XROA 3G1GA 4XFZA 4COPA 3H47A 3H4EA 3MGEA 1AUMA 2ONTA 3G28A 4U0FA 4U0BA 2XV6A 1A43A 1EIAA 2M8LA 4COCA 3DS1A 5HGNA 3P05A 4U0AA 4U0CA 2JYGA 3DTJA 2XXMA 5DCKA 2LF4A 2XT1A 3VRLC 1QRJA 1BAJA 1A8OA 4XFXA 2BUOA 3NTEA 3DS0A 4U0EA 5HGOA 1D1DA
chains in the Genus database with same CATH superfamily
2KODA 3B4QA 1K8AQ 1ZMBA 4U0DA 1E6JP 5HV8A 2EHSA 2LTEA 2NO8A 2GZJA 3G0VA 4M0IA 4XROA 2JB0A 4XRQA 2M5RA 4XFZA 1VQMP 4U0FA 1UNKA 1VKUA 1YHQP 1FR2A 1Q82Q 2KR5A 2Z45A 2GDYA 4U0CA 1BAJA 5BS1A 2K2QA 3B5IA 3CCMP 1M6EX 1NQ4A 3CCQP 4H2WC 4PH0A 2FAEA 2L22A 1EMVA 2KGCA 3CD6P 2MR8A 3GKLC 4H2XC 2KW2A 2XZ1C 3CCSP 3MGEA 1YI2P 3EJBA 2Z44A 2FADA 2GDWA 2PEJA 2PEMA 2M8PA 3CC4P 1K9MQ 4MRTC 4XFYA 2DGYA 3G1GA 2LPKA 2K92A 2XV6A 3HZQA 5DCKA 1E0HA 2KORA 2LOLA 5F2NA 2LKIA 2E1MA 2JYLA 1MZ8A 1YJNP 3RG6C 3G1IA 3CE7A 4COPA 2AVAA 2GDXA 2KG8A 3I55P 2KGDA 1A8OA 1UJZA 5HGOA 5I4TG 1S72P 2VLQA 1F80D 1N8RQ 2L4BA 1VQOP 2FVFA 4WYMA 1ACPA 3H47A 2N5HA 2VSQA 4U0BA 1A43A 1Q86Q 2PY8A 2VLOA 1VQLP 1M6NA 3U43A 1M74A 2EFJA 2JGPA 1JJ2O 1VQ8P 1IMQA 1VQ4P 1YITP 5HVCA 4R0MA 1YJWP 3EJEA 2DNWA 2K0XA 1M1KQ 2CG5B 2JU2A 3EJDA 4F37A 5EW5E 3CCJP 1GXGA 2GZIA 1RO0A 3HYBA 3G4SP 7CEIA 2JYGA 3DTJA 2LL8A 2AF8A 2N6ZA 1GXHA 2EG5A 4IPYA 4UHPB 3CC2P 2FQ1A 2FQ2A 5HGLA 1HQBA 3CCVP 1VHNA 2FQ0A 1DV5A 3H4EA 2KOPA 1T8KA 1QRJA 5F2KA 1KC8Q 3I56P 3GZLA 1YJ9P 3CCUP 3GZMA 2JQ4A 2QEXP 1IUQA 5JPAA 1VQ7P 3G28A 2KOOA 4QKOA 3CMEP 1Q81Q 2JBGA 2VLPA 1VQNP 4DG9A 3CC7P 5EJDA 2MF4A 2K5XA 4PH1A 1VQPP 4HKGA 2M8NA 4COCA 3CPWO 3DPHA 3G71P 5KP7B 3H0DA 4BPFA 4BPHA 4U0EA 5CZDB 3DS5A 4BPGA 2OTJP 1CEIA 2LIWA 2CQ8A 2JO0A 1VQ9P 1HY8A 2OTLP 2N5IA 3G6EP 4PXHB 2MY5A 2GZEA 2CGQA 2BUOA 1KQSO 2XZ0D 2FACA 1Q7YQ 2L9FA 2QNWA 5KP6B 2QA4P 2CNRA 2Z46A 5HGMA 2K94A 5F2OA 3CXCO 1K30A 2PNGA 2LMLA 2X2BA 2EHTA 2FVAA 2K93A 3DS0A 1AYIA 2FVEA 2ROQA 1M90Q 3G29A 3Q20A 2N6YA 3DS3A 2KG9A 2WPTA 2JU1A 2P9XA 3DS4A 2AFEA 2K0YA 1EIAA 5HGNA 2MD9A 2LF4A 2XT1A 4IZ6A 3NTEA 1ZNVA 2N98A 1L0IA 3LRYA 3G21A 2N50A 4QNBA 2KOSA 1VQ6P 3G26A 3E2DA 2PEKA 2LIUA 1OR5A 1X3OA 1GPJA 1VQ5P 1W2BO 3VRLC 4U0AA 2XXMA 1KD1Q 2VLNA 4XFXA 1NJIQ 2KWLA 2GZFA 2BHVA 1BXIA 2EIAA 4GR2A 2KGEA 2PENA 2MVUA 4PWVB 3DS2A 3CMAP 2KGAA 3M1MA 2KOQA 1L0HA 5BS2A 3CCLP 3DS1A 5KP8B 2L0QA 3WBHA 1QVFO 2MR7A 1D1DA 2L6EA 1K73Q 2PEIA 2K0DX 3OW2O 1EOQA 1RO2A 2ERHA 3GJNA 1Z6MA 3RG2A 2GYKA 3CCRP 2PEOA 2GZGA 2PEQA 2KG6A 2FHSC 1YIJP 2AFDA 3CCEP 4CA3A 1DNYA 1RNIA 2CWOA 4NEOA 1QVGO 2JAZA 2MVVA 1IMPA 1AF8A 1AUMA 2ONTA 4H2YC 2OARA 2M8LA 3P05A 3LMOA 3NY7B 1KLPA 1VQKP 4GR6A
chains in the Genus database with same CATH topology
5I4TG 2KODA 1S72P 1N8RQ 3LRYA 3G21A 1K8AQ 1ZMBA 4U0DA 4PH1A 1E6JP 1VQOP 4QNBA 1VQPP 1VQ6P 4WYMA 3G26A 3G0VA 2M8NA 3E2DA 4M0IA 4XROA 4COCA 3DPHA 2PEKA 4XRQA 3CPWO 4XFZA 3H47A 1VQMP 4U0FA 4U0BA 3G71P 1A43A 1YHQP 1Q82Q 1VQ5P 3H0DA 2Z45A 3VRLC 4U0AA 4U0CA 1W2BO 2XXMA 1Q86Q 1KD1Q 1BAJA 5BS1A 2PY8A 4XFXA 1VQLP 4U0EA 1NJIQ 1M6NA 3B5IA 1M74A 2EFJA 3CCMP 3DS5A 2BHVA 1JJ2O 1M6EX 1VQ8P 2OTJP 2EIAA 1VQ4P 3CCQP 4GR2A 2PENA 4PH0A 1YITP 1YJWP 1M1KQ 3CD6P 3DS2A 2JO0A 3CMAP 3CCJP 1VQ9P 3CCSP 3M1MA 3MGEA 2OTLP 5BS2A 1YI2P 1RO0A 3CCLP 3HYBA 3G4SP 3DS1A 3G6EP 2JYGA 3DTJA 3WBHA 1QVFO 2BUOA 1KQSO 2Z44A 1D1DA 2L6EA 1Q7YQ 2PEIA 2EG5A 2PEJA 4IPYA 1K73Q 3CC2P 2PEMA 2M8PA 3OW2O 3CC4P 1K9MQ 5HGLA 2QA4P 1EOQA 2Z46A 5HGMA 4XFYA 2DGYA 3CCVP 1RO2A 5F2OA 3G1GA 3CXCO 3H4EA 2XV6A 1K30A 3HZQA 3CCRP 2PEOA 5DCKA 2PEQA 1QRJA 5F2KA 1KC8Q 3I56P 3DS0A 1YJ9P 5F2NA 2E1MA 3CCUP 1YIJP 3CCEP 1RNIA 2CWOA 2JYLA 1M90Q 2QEXP 3G29A 3Q20A 1IUQA 1YJNP 3DS3A 1QVGO 3RG6C 5JPAA 2P9XA 3G1IA 3DS4A 4COPA 1VQ7P 1AUMA 2ONTA 3G28A 3CMEP 1EIAA 1Q81Q 2OARA 2M8LA 5HGNA 3P05A 3I55P 2LF4A 2XT1A 1A8OA 3NTEA 1VQNP 5HGOA 3CC7P 1VQKP 4GR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4T G;  2L6E A;  3DS5 A;  4IPY A;  2EIA A;  2KOD A;  3LRY A;  2JYL A;  3G21 A;  2M8P A;  4U0D A;  4PH1 A;  1E6J P;  3G29 A;  5HGL A;  4PH0 A;  3DS3 A;  4QNB A;  1EOQ A;  4WYM A;  5HGM A;  5JPA A;  3G1I A;  3G0V A;  2M8N A;  3DS2 A;  2JO0 A;  3DS4 A;  3G26 A;  4M0I A;  3DPH A;  4XFY A;  4XRQ A;  4XRO A;  3G1G A;  4XFZ A;  4COP A;  3H47 A;  3H4E A;  3MGE A;  1AUM A;  2ONT A;  3G28 A;  4U0F A;  4U0B A;  2XV6 A;  1A43 A;  1EIA A;  2M8L A;  4COC A;  3DS1 A;  5HGN A;  3P05 A;  4U0A A;  4U0C A;  2JYG A;  3DTJ A;  2XXM A;  5DCK A;  2LF4 A;  2XT1 A;  3VRL C;  1QRJ A;  1BAJ A;  1A8O A;  4XFX A;  2BUO A;  3NTE A;  3DS0 A;  4U0E A;  5HGO A;  1D1D A; 
#chains in the Genus database with same CATH topology
 2KOD A;  3B4Q A;  1K8A Q;  1ZMB A;  4U0D A;  1E6J P;  5HV8 A;  2EHS A;  2LTE A;  2NO8 A;  2GZJ A;  3G0V A;  4M0I A;  4XRO A;  2JB0 A;  4XRQ A;  2M5R A;  4XFZ A;  1VQM P;  4U0F A;  1UNK A;  1VKU A;  1YHQ P;  1FR2 A;  1Q82 Q;  2KR5 A;  2Z45 A;  2GDY A;  4U0C A;  1BAJ A;  5BS1 A;  2K2Q A;  3B5I A;  3CCM P;  1M6E X;  1NQ4 A;  3CCQ P;  4H2W C;  4PH0 A;  2FAE A;  2L22 A;  1EMV A;  2KGC A;  3CD6 P;  2MR8 A;  3GKL C;  4H2X C;  2KW2 A;  2XZ1 C;  3CCS P;  3MGE A;  1YI2 P;  3EJB A;  2Z44 A;  2FAD A;  2GDW A;  2PEJ A;  2PEM A;  2M8P A;  3CC4 P;  1K9M Q;  4MRT C;  4XFY A;  2DGY A;  3G1G A;  2LPK A;  2K92 A;  2XV6 A;  3HZQ A;  5DCK A;  1E0H A;  2KOR A;  2LOL A;  5F2N A;  2LKI A;  2E1M A;  2JYL A;  1MZ8 A;  1YJN P;  3RG6 C;  3G1I A;  3CE7 A;  4COP A;  2AVA A;  2GDX A;  2KG8 A;  3I55 P;  2KGD A;  1A8O A;  1UJZ A;  5HGO A;  5I4T G;  1S72 P;  2VLQ A;  1F80 D;  1N8R Q;  2L4B A;  1VQO P;  2FVF A;  4WYM A;  1ACP A;  3H47 A;  2N5H A;  2VSQ A;  4U0B A;  1A43 A;  1Q86 Q;  2PY8 A;  2VLO A;  1VQL P;  1M6N A;  3U43 A;  1M74 A;  2EFJ A;  2JGP A;  1JJ2 O;  1VQ8 P;  1IMQ A;  1VQ4 P;  1YIT P;  5HVC A;  4R0M A;  1YJW P;  3EJE A;  2DNW A;  2K0X A;  1M1K Q;  2CG5 B;  2JU2 A;  3EJD A;  4F37 A;  5EW5 E;  3CCJ P;  1GXG A;  2GZI A;  1RO0 A;  3HYB A;  3G4S P;  7CEI A;  2JYG A;  3DTJ A;  2LL8 A;  2AF8 A;  2N6Z A;  1GXH A;  2EG5 A;  4IPY A;  4UHP B;  3CC2 P;  2FQ1 A;  2FQ2 A;  5HGL A;  1HQB A;  3CCV P;  1VHN A;  2FQ0 A;  1DV5 A;  3H4E A;  2KOP A;  1T8K A;  1QRJ A;  5F2K A;  1KC8 Q;  3I56 P;  3GZL A;  1YJ9 P;  3CCU P;  3GZM A;  2JQ4 A;  2QEX P;  1IUQ A;  5JPA A;  1VQ7 P;  3G28 A;  2KOO A;  4QKO A;  3CME P;  1Q81 Q;  2JBG A;  2VLP A;  1VQN P;  4DG9 A;  3CC7 P;  5EJD A;  2MF4 A;  2K5X A;  4PH1 A;  1VQP P;  4HKG A;  2M8N A;  4COC A;  3CPW O;  3DPH A;  3G71 P;  5KP7 B;  3H0D A;  4BPF A;  4BPH A;  4U0E A;  5CZD B;  3DS5 A;  4BPG A;  2OTJ P;  1CEI A;  2LIW A;  2CQ8 A;  2JO0 A;  1VQ9 P;  1HY8 A;  2OTL P;  2N5I A;  3G6E P;  4PXH B;  2MY5 A;  2GZE A;  2CGQ A;  2BUO A;  1KQS O;  2XZ0 D;  2FAC A;  1Q7Y Q;  2L9F A;  2QNW A;  5KP6 B;  2QA4 P;  2CNR A;  2Z46 A;  5HGM A;  2K94 A;  5F2O A;  3CXC O;  1K30 A;  2PNG A;  2LML A;  2X2B A;  2EHT A;  2FVA A;  2K93 A;  3DS0 A;  1AYI A;  2FVE A;  2ROQ A;  1M90 Q;  3G29 A;  3Q20 A;  2N6Y A;  3DS3 A;  2KG9 A;  2WPT A;  2JU1 A;  2P9X A;  3DS4 A;  2AFE A;  2K0Y A;  1EIA A;  5HGN A;  2MD9 A;  2LF4 A;  2XT1 A;  4IZ6 A;  3NTE A;  1ZNV A;  2N98 A;  1L0I A;  3LRY A;  3G21 A;  2N50 A;  4QNB A;  2KOS A;  1VQ6 P;  3G26 A;  3E2D A;  2PEK A;  2LIU A;  1OR5 A;  1X3O A;  1GPJ A;  1VQ5 P;  1W2B O;  3VRL C;  4U0A A;  2XXM A;  1KD1 Q;  2VLN A;  4XFX A;  1NJI Q;  2KWL A;  2GZF A;  2BHV A;  1BXI A;  2EIA A;  4GR2 A;  2KGE A;  2PEN A;  2MVU A;  4PWV B;  3DS2 A;  3CMA P;  2KGA A;  3M1M A;  2KOQ A;  1L0H A;  5BS2 A;  3CCL P;  3DS1 A;  5KP8 B;  2L0Q A;  3WBH A;  1QVF O;  2MR7 A;  1D1D A;  2L6E A;  1K73 Q;  2PEI A;  2K0D X;  3OW2 O;  1EOQ A;  1RO2 A;  2ERH A;  3GJN A;  1Z6M A;  3RG2 A;  2GYK A;  3CCR P;  2PEO A;  2GZG A;  2PEQ A;  2KG6 A;  2FHS C;  1YIJ P;  2AFD A;  3CCE P;  4CA3 A;  1DNY A;  1RNI A;  2CWO A;  4NEO A;  1QVG O;  2JAZ A;  2MVV A;  1IMP A;  1AF8 A;  1AUM A;  2ONT A;  4H2Y C;  2OAR A;  2M8L A;  3P05 A;  3LMO A;  3NY7 B;  1KLP A;  1VQK P;  4GR6 A; 
#chains in the Genus database with same CATH homology
 5I4T G;  2KOD A;  1S72 P;  1N8R Q;  3LRY A;  3G21 A;  1K8A Q;  1ZMB A;  4U0D A;  4PH1 A;  1E6J P;  1VQO P;  4QNB A;  1VQP P;  1VQ6 P;  4WYM A;  3G26 A;  3G0V A;  2M8N A;  3E2D A;  4M0I A;  4XRO A;  4COC A;  3DPH A;  2PEK A;  4XRQ A;  3CPW O;  4XFZ A;  3H47 A;  1VQM P;  4U0F A;  4U0B A;  3G71 P;  1A43 A;  1YHQ P;  1Q82 Q;  1VQ5 P;  3H0D A;  2Z45 A;  3VRL C;  4U0A A;  4U0C A;  1W2B O;  2XXM A;  1Q86 Q;  1KD1 Q;  1BAJ A;  5BS1 A;  2PY8 A;  4XFX A;  1VQL P;  4U0E A;  1NJI Q;  1M6N A;  3B5I A;  1M74 A;  2EFJ A;  3CCM P;  3DS5 A;  2BHV A;  1JJ2 O;  1M6E X;  1VQ8 P;  2OTJ P;  2EIA A;  1VQ4 P;  3CCQ P;  4GR2 A;  2PEN A;  4PH0 A;  1YIT P;  1YJW P;  1M1K Q;  3CD6 P;  3DS2 A;  2JO0 A;  3CMA P;  3CCJ P;  1VQ9 P;  3CCS P;  3M1M A;  3MGE A;  2OTL P;  5BS2 A;  1YI2 P;  1RO0 A;  3CCL P;  3HYB A;  3G4S P;  3DS1 A;  3G6E P;  2JYG A;  3DTJ A;  3WBH A;  1QVF O;  2BUO A;  1KQS O;  2Z44 A;  1D1D A;  2L6E A;  1Q7Y Q;  2PEI A;  2EG5 A;  2PEJ A;  4IPY A;  1K73 Q;  3CC2 P;  2PEM A;  2M8P A;  3OW2 O;  3CC4 P;  1K9M Q;  5HGL A;  2QA4 P;  1EOQ A;  2Z46 A;  5HGM A;  4XFY A;  2DGY A;  3CCV P;  1RO2 A;  5F2O A;  3G1G A;  3CXC O;  3H4E A;  2XV6 A;  1K30 A;  3HZQ A;  3CCR P;  2PEO A;  5DCK A;  2PEQ A;  1QRJ A;  5F2K A;  1KC8 Q;  3I56 P;  3DS0 A;  1YJ9 P;  5F2N A;  2E1M A;  3CCU P;  1YIJ P;  3CCE P;  1RNI A;  2CWO A;  2JYL A;  1M90 Q;  2QEX P;  3G29 A;  3Q20 A;  1IUQ A;  1YJN P;  3DS3 A;  1QVG O;  3RG6 C;  5JPA A;  2P9X A;  3G1I A;  3DS4 A;  4COP A;  1VQ7 P;  1AUM A;  2ONT A;  3G28 A;  3CME P;  1EIA A;  1Q81 Q;  2OAR A;  2M8L A;  5HGN A;  3P05 A;  3I55 P;  2LF4 A;  2XT1 A;  1A8O A;  3NTE A;  1VQN P;  5HGO A;  3CC7 P;  1VQK P;  4GR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...