2JYGA

Solution structure of the w184a/m185a mutant of the carboxy-terminal dimerization domain of the hiv-1 capsid protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of a Double Mutant of the Carboxy-Terminal Dimerization Domain of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
total genus 16
structure length 84
sequence length 84
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2jygA00
4XROA 4U0BA 1QRJA 3H4EA 1A43A 2JYLA 3G1IA 3H47A 2BUOA 2XXMA 4XFXA 1AUMA 3G1GA 4U0DA 5JPAA 2XV6A 2KODA 3DS3A 3DS0A 3G29A 3VRLC 4COCA 1EOQA 3DS2A 2ONTA 2JYGA 3NTEA 2LF4A 4PH0A 5HGOA 3G28A 5HGLA 3G26A 5HGNA 1A8OA 3P05A 4XFYA 4XRQA 4U0EA 2JO0A 2M8PA 3DS5A 4XFZA 3DS4A 4COPA 3DPHA 3G21A 1E6JP 3MGEA 4U0FA 4WYMA 5HGMA 1BAJA 2M8NA 1D1DA 4U0AA 2M8LA 2L6EA 2EIAA 4M0IA 3DTJA 3LRYA 4QNBA 5I4TG 4IPYA 5DCKA 2XT1A 4PH1A 3DS1A 4U0CA 3G0VA 1EIAA
chains in the Genus database with same CATH superfamily
2GZGA 4GR6A 3H47A 2JYLA 1VQ8P 2ROQA 2L9FA 3I55P 1GXGA 2JB0A 5HGNA 4MRTC 2LKIA 2M8NA 1KD1Q 1VQLP 2CG5B 3G4SP 2GZIA 1M6EX 1IUQA 1F80D 3NTEA 3G26A 1IMQA 1FR2A 1VQ7P 2MR7A 2EIAA 2FVFA 2PEOA 4IPYA 3NY7B 2N6ZA 1L0IA 3DS1A 3G0VA 2FQ2A 7CEIA 4XROA 4U0BA 3G1IA 4BPHA 1ZNVA 2MVVA 3CD6P 5HV8A 3OW2O 2OTJP 2PENA 1UJZA 1IMPA 2MD9A 2DGYA 1MZ8A 3M1MA 2VLOA 4UHPB 4BPFA 2LIWA 1RO0A 1Q86Q 5BS1A 1OR5A 3CCSP 3U43A 1Q7YQ 1A8OA 2GZFA 3G6EP 2PEKA 1VQ5P 3DS4A 2MVUA 2X2BA 4GR2A 5HGMA 3WBHA 2GDYA 2LTEA 2K5XA 2K92A 4U0FA 1QRJA 3H4EA 3CCUP 3G71P 2XV6A 2K0YA 2JAZA 3DS2A 5HGOA 3HYBA 5HGLA 1VQ4P 4F37A 2M8PA 1KC8Q 3G21A 3CC7P 1HQBA 4U0AA 2LIUA 3DTJA 1YITP 2PEJA 3CCJP 1EIAA 2DNWA 2GDWA 2AFDA 2XXMA 2FQ1A 3B4QA 2N5HA 2KGAA 2VLPA 1E6JP 2LPKA 3CCRP 2GYKA 5EW5E 2QNWA 2KR5A 1K30A 4PH1A 1DNYA 1RO2A 4PWVB 1N8RQ 2N50A 1M90Q 2AFEA 3CMAP 2N5IA 5BS2A 2MF4A 4PH0A 2KG9A 3CC4P 2NO8A 2L4BA 4DG9A 1YJNP 2AVAA 2JGPA 1D1DA 2PNGA 1VQ9P 2KGDA 3HZQA 5CZDB 1BXIA 4H2YC 2CQ8A 1GPJA 2FVAA 3E2DA 2FACA 4XFXA 1YHQP 1VQOP 3G29A 2XZ1C 3CCVP 1ACPA 4R0MA 2MY5A 3I56P 1GXHA 2EHSA 1DV5A 2KORA 1ZMBA 2L6EA 2LL8A 2Z45A 3CMEP 2XT1A 1VKUA 1E0HA 1A43A 2KG6A 1CEIA 1AUMA 4BPGA 1Q82Q 1Z6MA 4H2WC 3P05A 1KLPA 1M74A 3DS5A 2KW2A 2M8LA 1QVFO 3Q20A 3LRYA 1EMVA 2K0DX 2Z46A 2BUOA 2K93A 5KP7B 3G1GA 2KGEA 1EOQA 2QA4P 4XRQA 1QVGO 1RNIA 5EJDA 2M5RA 2CNRA 2E1MA 4H2XC 2KOPA 2KOSA 4HKGA 3DS3A 3DS0A 2XZ0D 2FQ0A 2L22A 3VRLC 4COCA 3GKLC 3CCQP 2JYGA 2GZEA 3G28A 4XFYA 1VQMP 2JU1A 4XFZA 2Z44A 3MGEA 2GDXA 3RG6C 2K0XA 4QNBA 2PEQA 2GZJA 2K94A 5KP8B 3GZMA 5F2KA 3CXCO 2OTLP 1K73Q 2LF4A 1K8AQ 1VQNP 2JQ4A 3DPHA 1NQ4A 4IZ6A 2EFJA 1Q81Q 2P9XA 5I4TG 2KOQA 3CC2P 5HVCA 2CWOA 2N98A 2EG5A 2FAEA 5JPAA 2LOLA 2L0QA 2JBGA 2FVEA 2VSQA 1NJIQ 2QEXP 3CCMP 1M6NA 4M0IA 1JJ2O 4NEOA 2FHSC 5DCKA 3CPWO 3EJEA 1M1KQ 1W2BO 1K9MQ 2KODA 1AF8A 2VLQA 1L0HA 1VQKP 2VLNA 2CGQA 2BHVA 3CCLP 2KWLA 3B5IA 2JU2A 1AYIA 1YJWP 3RG2A 2PEMA 2MR8A 1VHNA 1T8KA 2KGCA 2N6YA 3EJBA 2ERHA 2KOOA 2K2QA 4U0CA 1KQSO 2WPTA 3CE7A 2LMLA 4U0DA 5F2OA 2KG8A 2ONTA 1YJ9P 2PY8A 2EHTA 4COPA 1VQPP 1S72P 2OARA 1X3OA 4CA3A 3CCEP 3EJDA 1UNKA 5F2NA 2FADA 3H0DA 1YIJP 3GJNA 3GZLA 4U0EA 2JO0A 3LMOA 4PXHB 5KP6B 4WYMA 1BAJA 1HY8A 2AF8A 1VQ6P 2PEIA 1YI2P 4QKOA
chains in the Genus database with same CATH topology
2EG5A 1QRJA 3H4EA 4GR6A 1A43A 2JYLA 3H47A 3G71P 3CCUP 1VQ8P 1AUMA 5JPAA 2XV6A 1Q82Q 3I55P 3DS2A 5HGOA 3HYBA 5HGLA 5HGNA 3P05A 1VQ4P 1NJIQ 2M8PA 1M74A 3DS5A 2QEXP 1KC8Q 3G21A 3CCMP 3CC7P 2M8NA 1M6NA 4U0AA 1KD1Q 2M8LA 1QVFO 1VQLP 4M0IA 3Q20A 3DTJA 3LRYA 1JJ2O 5DCKA 3CPWO 1YITP 2PEJA 3CCJP 2Z46A 1EIAA 3G4SP 2BUOA 2XXMA 1W2BO 1M1KQ 1K9MQ 3G1GA 1M6EX 2KODA 1VQKP 1IUQA 1EOQA 3NTEA 2BHVA 3G26A 3CCLP 2QA4P 4XRQA 1QVGO 3B5IA 1YJWP 1RNIA 2PEMA 1E6JP 1VQ7P 3CCRP 2EIAA 2PEOA 4IPYA 1K30A 4PH1A 2E1MA 1RO2A 3DS1A 3G0VA 4U0CA 4XROA 4U0BA 1N8RQ 1KQSO 3G1IA 1M90Q 4U0DA 5F2OA 3DS3A 3DS0A 3CMAP 5BS2A 3VRLC 4COCA 2ONTA 3CCQP 2JYGA 4PH0A 1YJ9P 2PY8A 3G28A 3CC4P 4XFYA 1VQMP 4XFZA 2Z44A 4COPA 3MGEA 1VQPP 3CD6P 1S72P 1YJNP 2OARA 3OW2O 2OTJP 2PENA 3RG6C 1D1DA 3CCEP 2DGYA 4QNBA 1VQ9P 3M1MA 3HZQA 2PEQA 3E2DA 5F2NA 4XFXA 1YHQP 1RO0A 3H0DA 1VQOP 1Q86Q 5BS1A 3G29A 5F2KA 3CXCO 3CCSP 2OTLP 1YIJP 1Q7YQ 1K73Q 2LF4A 1K8AQ 1A8OA 3CCVP 1VQNP 3G6EP 4U0EA 2JO0A 2PEKA 3DS4A 1VQ5P 3DPHA 3I56P 4GR2A 4WYMA 5HGMA 3WBHA 1BAJA 1ZMBA 2L6EA 2EFJA 1Q81Q 2P9XA 5I4TG 3CC2P 2Z45A 3CMEP 2XT1A 1VQ6P 2PEIA 1YI2P 2CWOA 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRO A;  4U0B A;  1QRJ A;  3H4E A;  1A43 A;  2JYL A;  3G1I A;  3H47 A;  2BUO A;  2XXM A;  4XFX A;  1AUM A;  3G1G A;  4U0D A;  5JPA A;  2XV6 A;  2KOD A;  3DS3 A;  3DS0 A;  3G29 A;  3VRL C;  4COC A;  1EOQ A;  3DS2 A;  2ONT A;  2JYG A;  3NTE A;  2LF4 A;  4PH0 A;  5HGO A;  3G28 A;  5HGL A;  3G26 A;  5HGN A;  1A8O A;  3P05 A;  4XFY A;  4XRQ A;  4U0E A;  2JO0 A;  2M8P A;  3DS5 A;  4XFZ A;  3DS4 A;  4COP A;  3DPH A;  3G21 A;  1E6J P;  3MGE A;  4U0F A;  4WYM A;  5HGM A;  1BAJ A;  2M8N A;  1D1D A;  4U0A A;  2M8L A;  2L6E A;  2EIA A;  4M0I A;  3DTJ A;  3LRY A;  4QNB A;  5I4T G;  4IPY A;  5DCK A;  2XT1 A;  4PH1 A;  3DS1 A;  4U0C A;  3G0V A;  1EIA A; 
#chains in the Genus database with same CATH topology
 2GZG A;  4GR6 A;  3H47 A;  2JYL A;  1VQ8 P;  2ROQ A;  2L9F A;  3I55 P;  1GXG A;  2JB0 A;  5HGN A;  4MRT C;  2LKI A;  2M8N A;  1KD1 Q;  1VQL P;  2CG5 B;  3G4S P;  2GZI A;  1M6E X;  1IUQ A;  1F80 D;  3NTE A;  3G26 A;  1IMQ A;  1FR2 A;  1VQ7 P;  2MR7 A;  2EIA A;  2FVF A;  2PEO A;  4IPY A;  3NY7 B;  2N6Z A;  1L0I A;  3DS1 A;  3G0V A;  2FQ2 A;  7CEI A;  4XRO A;  4U0B A;  3G1I A;  4BPH A;  1ZNV A;  2MVV A;  3CD6 P;  5HV8 A;  3OW2 O;  2OTJ P;  2PEN A;  1UJZ A;  1IMP A;  2MD9 A;  2DGY A;  1MZ8 A;  3M1M A;  2VLO A;  4UHP B;  4BPF A;  2LIW A;  1RO0 A;  1Q86 Q;  5BS1 A;  1OR5 A;  3CCS P;  3U43 A;  1Q7Y Q;  1A8O A;  2GZF A;  3G6E P;  2PEK A;  1VQ5 P;  3DS4 A;  2MVU A;  2X2B A;  4GR2 A;  5HGM A;  3WBH A;  2GDY A;  2LTE A;  2K5X A;  2K92 A;  4U0F A;  1QRJ A;  3H4E A;  3CCU P;  3G71 P;  2XV6 A;  2K0Y A;  2JAZ A;  3DS2 A;  5HGO A;  3HYB A;  5HGL A;  1VQ4 P;  4F37 A;  2M8P A;  1KC8 Q;  3G21 A;  3CC7 P;  1HQB A;  4U0A A;  2LIU A;  3DTJ A;  1YIT P;  2PEJ A;  3CCJ P;  1EIA A;  2DNW A;  2GDW A;  2AFD A;  2XXM A;  2FQ1 A;  3B4Q A;  2N5H A;  2KGA A;  2VLP A;  1E6J P;  2LPK A;  3CCR P;  2GYK A;  5EW5 E;  2QNW A;  2KR5 A;  1K30 A;  4PH1 A;  1DNY A;  1RO2 A;  4PWV B;  1N8R Q;  2N50 A;  1M90 Q;  2AFE A;  3CMA P;  2N5I A;  5BS2 A;  2MF4 A;  4PH0 A;  2KG9 A;  3CC4 P;  2NO8 A;  2L4B A;  4DG9 A;  1YJN P;  2AVA A;  2JGP A;  1D1D A;  2PNG A;  1VQ9 P;  2KGD A;  3HZQ A;  5CZD B;  1BXI A;  4H2Y C;  2CQ8 A;  1GPJ A;  2FVA A;  3E2D A;  2FAC A;  4XFX A;  1YHQ P;  1VQO P;  3G29 A;  2XZ1 C;  3CCV P;  1ACP A;  4R0M A;  2MY5 A;  3I56 P;  1GXH A;  2EHS A;  1DV5 A;  2KOR A;  1ZMB A;  2L6E A;  2LL8 A;  2Z45 A;  3CME P;  2XT1 A;  1VKU A;  1E0H A;  1A43 A;  2KG6 A;  1CEI A;  1AUM A;  4BPG A;  1Q82 Q;  1Z6M A;  4H2W C;  3P05 A;  1KLP A;  1M74 A;  3DS5 A;  2KW2 A;  2M8L A;  1QVF O;  3Q20 A;  3LRY A;  1EMV A;  2K0D X;  2Z46 A;  2BUO A;  2K93 A;  5KP7 B;  3G1G A;  2KGE A;  1EOQ A;  2QA4 P;  4XRQ A;  1QVG O;  1RNI A;  5EJD A;  2M5R A;  2CNR A;  2E1M A;  4H2X C;  2KOP A;  2KOS A;  4HKG A;  3DS3 A;  3DS0 A;  2XZ0 D;  2FQ0 A;  2L22 A;  3VRL C;  4COC A;  3GKL C;  3CCQ P;  2JYG A;  2GZE A;  3G28 A;  4XFY A;  1VQM P;  2JU1 A;  4XFZ A;  2Z44 A;  3MGE A;  2GDX A;  3RG6 C;  2K0X A;  4QNB A;  2PEQ A;  2GZJ A;  2K94 A;  5KP8 B;  3GZM A;  5F2K A;  3CXC O;  2OTL P;  1K73 Q;  2LF4 A;  1K8A Q;  1VQN P;  2JQ4 A;  3DPH A;  1NQ4 A;  4IZ6 A;  2EFJ A;  1Q81 Q;  2P9X A;  5I4T G;  2KOQ A;  3CC2 P;  5HVC A;  2CWO A;  2N98 A;  2EG5 A;  2FAE A;  5JPA A;  2LOL A;  2L0Q A;  2JBG A;  2FVE A;  2VSQ A;  1NJI Q;  2QEX P;  3CCM P;  1M6N A;  4M0I A;  1JJ2 O;  4NEO A;  2FHS C;  5DCK A;  3CPW O;  3EJE A;  1M1K Q;  1W2B O;  1K9M Q;  2KOD A;  1AF8 A;  2VLQ A;  1L0H A;  1VQK P;  2VLN A;  2CGQ A;  2BHV A;  3CCL P;  2KWL A;  3B5I A;  2JU2 A;  1AYI A;  1YJW P;  3RG2 A;  2PEM A;  2MR8 A;  1VHN A;  1T8K A;  2KGC A;  2N6Y A;  3EJB A;  2ERH A;  2KOO A;  2K2Q A;  4U0C A;  1KQS O;  2WPT A;  3CE7 A;  2LML A;  4U0D A;  5F2O A;  2KG8 A;  2ONT A;  1YJ9 P;  2PY8 A;  2EHT A;  4COP A;  1VQP P;  1S72 P;  2OAR A;  1X3O A;  4CA3 A;  3CCE P;  3EJD A;  1UNK A;  5F2N A;  2FAD A;  3H0D A;  1YIJ P;  3GJN A;  3GZL A;  4U0E A;  2JO0 A;  3LMO A;  4PXH B;  5KP6 B;  4WYM A;  1BAJ A;  1HY8 A;  2AF8 A;  1VQ6 P;  2PEI A;  1YI2 P;  4QKO A; 
#chains in the Genus database with same CATH homology
 2EG5 A;  1QRJ A;  3H4E A;  4GR6 A;  1A43 A;  2JYL A;  3H47 A;  3G71 P;  3CCU P;  1VQ8 P;  1AUM A;  5JPA A;  2XV6 A;  1Q82 Q;  3I55 P;  3DS2 A;  5HGO A;  3HYB A;  5HGL A;  5HGN A;  3P05 A;  1VQ4 P;  1NJI Q;  2M8P A;  1M74 A;  3DS5 A;  2QEX P;  1KC8 Q;  3G21 A;  3CCM P;  3CC7 P;  2M8N A;  1M6N A;  4U0A A;  1KD1 Q;  2M8L A;  1QVF O;  1VQL P;  4M0I A;  3Q20 A;  3DTJ A;  3LRY A;  1JJ2 O;  5DCK A;  3CPW O;  1YIT P;  2PEJ A;  3CCJ P;  2Z46 A;  1EIA A;  3G4S P;  2BUO A;  2XXM A;  1W2B O;  1M1K Q;  1K9M Q;  3G1G A;  1M6E X;  2KOD A;  1VQK P;  1IUQ A;  1EOQ A;  3NTE A;  2BHV A;  3G26 A;  3CCL P;  2QA4 P;  4XRQ A;  1QVG O;  3B5I A;  1YJW P;  1RNI A;  2PEM A;  1E6J P;  1VQ7 P;  3CCR P;  2EIA A;  2PEO A;  4IPY A;  1K30 A;  4PH1 A;  2E1M A;  1RO2 A;  3DS1 A;  3G0V A;  4U0C A;  4XRO A;  4U0B A;  1N8R Q;  1KQS O;  3G1I A;  1M90 Q;  4U0D A;  5F2O A;  3DS3 A;  3DS0 A;  3CMA P;  5BS2 A;  3VRL C;  4COC A;  2ONT A;  3CCQ P;  2JYG A;  4PH0 A;  1YJ9 P;  2PY8 A;  3G28 A;  3CC4 P;  4XFY A;  1VQM P;  4XFZ A;  2Z44 A;  4COP A;  3MGE A;  1VQP P;  3CD6 P;  1S72 P;  1YJN P;  2OAR A;  3OW2 O;  2OTJ P;  2PEN A;  3RG6 C;  1D1D A;  3CCE P;  2DGY A;  4QNB A;  1VQ9 P;  3M1M A;  3HZQ A;  2PEQ A;  3E2D A;  5F2N A;  4XFX A;  1YHQ P;  1RO0 A;  3H0D A;  1VQO P;  1Q86 Q;  5BS1 A;  3G29 A;  5F2K A;  3CXC O;  3CCS P;  2OTL P;  1YIJ P;  1Q7Y Q;  1K73 Q;  2LF4 A;  1K8A Q;  1A8O A;  3CCV P;  1VQN P;  3G6E P;  4U0E A;  2JO0 A;  2PEK A;  3DS4 A;  1VQ5 P;  3DPH A;  3I56 P;  4GR2 A;  4WYM A;  5HGM A;  3WBH A;  1BAJ A;  1ZMB A;  2L6E A;  2EFJ A;  1Q81 Q;  2P9X A;  5I4T G;  3CC2 P;  2Z45 A;  3CME P;  2XT1 A;  1VQ6 P;  2PEI A;  1YI2 P;  2CWO A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...