3CCLP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cclP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cclP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cclP02
2QA4P 1N8RQ 3I55P 3CCEP 1Q81Q 3CC2P 1QVGO 1W2BO 3CXCO 1YJ9P 3CC4P 3CCLP 1KQSO 1VQPP 1VQ6P 3CCRP 1M90Q 1NJIQ 2OTJP 3CCMP 3I56P 3CMAP 3G6EP 3G4SP 3CCJP 3CCVP 1VQ9P 3CMEP 1YIJP 1K8AQ 1VQMP 1M1KQ 3CD6P 1VQOP 1YHQP 1YJWP 1JJ2O 1VQLP 1YI2P 1K73Q 1YJNP 1S72P 1KC8Q 1Q7YQ 1Q82Q 1VQ8P 3CC7P 1VQ7P 1VQKP 1QVFO 1KD1Q 2QEXP 1YITP 1Q86Q 1VQ4P 2OTLP 3CCSP 1VQ5P 1K9MQ 3CCQP 3CPWO 3CCUP 1VQNP 3OW2O 3G71P
chains in the Genus database with same CATH superfamily
2SPZA 2IBZG 1NGMB 2Y0EA 2IFNA 1FAVA 3ABVC 1M8OB 4H13C 4HB1A 1HTLC 2H8PD 1S72P 3IFMA 5APUA 2B87B 2OYIB 3GLMA 1N7SB 1Z6MA 1QEXA 4C7RA 2IZ1A 4EIJA 5APYA 2QJKB 2ZT9B 3HD7D 3H1IG 3MD0A 3RK2C 1NKNA 3CXHI 1EQ7A 1OX3A 2BEQD 4D6TJ 2RMZA 4UB8H 1WT6A 2FYUD 3HZQA 1Y8AA 5AW2B 3TGUJ 1X0TA 1RQUA 2I8DA 3AE2C 1AYIA 1N73B 4GKGA 1GD2E 2OYOA 1PL5A 1BCCD 2K9JA 2IPPA 4I7ZB 2L5GB 1DIPA 4XFJA 1GL2B 1ZP0C 1UJZA 3H1JD 1NTZD 2WSFJ 5AW1B 3P8MC 3U1CA 5E79E 3P05A 2WITA 4OWFA 2QIWA 2FVEA 2JP3A 3AE3C 2KW2A 1IO4A 4HKGA 3VMZA 4N6JA 2A06G 2NPSA 1Q82Q 3M06A 5AW6B 5K5GB 2P58A 2MF4A 3AE4C 2NRGA 3HD7A 2GDYA 4IL6X 2PP6A 3MUDA 4JPZB 3HUSB 2LL8A 2IZ0A 2GM4A 2VLOA 5AW8B 1TU3F 5B66H 1GL2D 5KAIE 2OQQA 2E43A 5KP7B 1USDA 1E0HA 2YKPA 3AE1C 2E75C 4PD4E 4Y99B 1IMPA 3WUVA 2GDWA 1FDOA 2L22A 1T8ZA 3H32A 3IR9A 3TGUD 1T8KA 2PEJA 2NO8A 1FS0E 4PH0A 2Q6QA 2VRSA 3M0AA 2YKQA 2YIUC 3A2AA 4BWNA 1CI6A 2R32A 1NU1E 2OYHB 1EOQA 2E74C 5AVRB 4C7NA 3T97A 2M8NA 2DNWA 1GK4A 3GHGC 2FFDB 2KI7B 2PNGA 3FXEA 5CMZA 2JR8A 4ASVA 3AEGC 1DD3A 5CJ0A 4IZ6A 1LP1B 1W2BO 1J1EB 3KXDA 2QG4A 3B5NB 1F80D 2JDIH 2WPQA 2K2QA 1NOHA 2JQ4A 3HTKA 1ZLLA 1GPJA 2N6YA 3E1IA 3M0DA 4GOFA 2N50A 1L0NK 1QRJA 1SQQE 1DNYA 4UHPB 1NHLA 4IFFA 1W5CE 1K05A 2IFMA 1L4AC 3L72J 1MFTA 2FXPA 2PEKA 5TJHA 2H43A 4PWVB 3KYQA 2P2UA 4K35A 4IFMA 5KLIB 2E42A 4H2XC 2GA1A 2KP8A 1SQVG 2M5AA 2KIKA 2Q3IA 2E76B 1EZVG 1KQFB 3U1AA 2IBZI 2FADA 4YXWH 1FZEA 1NU1J 2K37A 1KYOH 5APVA 2GDXA 1K9MQ 1GMJA 3F89A 1JM0A 3PRJA 3VN0A 3A5TA 1JMBA 3P32A 1YJ9P 2N1TC 4PH1A 3CE7A 3II6A 3KQGA 1GZLA 2XDJA 2FACA 1AF8A 4UB8E 4EDFA 1OWAA 1QGKB 5KAFE 1LTJB 1IFIA 1N8RQ 5CJ4A 3BVHA 2UWJE 2QJPC 3H0DA 1H89A 2ZAEB 4RO0A 3VYIA 5APWA 4IFDK 2Z4EA 2KK7A 1ZOYC 1EDLA 4PV1C 1SQQJ 4XFZA 4RESB 2FVFA 2KG6A 4JQ0D 5KKZB 3RK3C 1J2JB 1AFOA 1DD4A 3HE4A 2XNDH 2QNWA 3VMYA 2A45H 3H25A 3B4SA 1HUCA 4JBZA 3L72D 3MGNA 2FVAA 4O9BA 1IFPA 2Z46A 1R5LA 3VMAA 1OW7A 3L70E 1LGHB 4PD4D 2G3AA 1JCDA 1L0LE 3SWFA 2WSCJ 1IC2A 2L6EA 2I1JA 4OGQB 3M91A 1M1JB 1OFCX 1BSNA 3AECC 5AVYB 1SQBK 5CBNA 1EIAA 2ZVNB 1NU1D 1S9KE 2KGAA 1X79B 2ZJSE 2ZYAA 3NXSA 2Q7CA 3NY7B 2HPCA 1NTME 2JO1A 1S3JA 4JYBA 3ITKA 4U0DA 1KC8Q 1KFMA 5AW4B 2O1JA 3LRYA 1G2CA 3P7KA 1SQVK 1QLED 1M74A 3H1LE 4MRTC 2W6AA 2JKVA 1RE3A 4GDOA 3S9OA 3CCLP 2AEFA 3FWNA 1Z56A 3B8EB 1KB9E 3D6ZA 4HKZH 4WY4B 1W2EA 2KORA 4PD4I 4OVNF 4XFXA 1Q86Q 1VQ4P 1Q81Q 1P84E 2FXMA 3CWBE 2R5BA 1PZQA 1PEMA 5KJ7D 4JYCA 2K5XA 1M90Q 2O01J 2C0XA 2BQ1E 1RF1A 2NZ2A 2L9FA 1AV1A 3LW5J 3HD7C 1MV8A 1VQ7P 3GHGA 3LIDA 1PGJA 4ASWA 3L70J 2CK3H 4QKOA 1L0LJ 2KGDA 1KV4A 3E7KA 1BCCG 4AUWA 3HYBA 2ITAA 3CD6P 2PGDA 1X3OA 3TK1A 1SLQA 2ZXEB 2YKOA 1EZVD 3H47A 2WQYC 5KAIH 3BCCE 4Z1MH 1NTZG 5KLVK 2ZYDA 3VMXA 1NTMJ 2XT1A 3V2RA 3B4QA 1IZNB 3A0BH 2OYIC 2LMLA 2FY8A 2KODA 2ZT9C 3L36A 4GIFA 2Y0DA 2C0WA 4WB4A 2Z5HA 3PP5A 3H1LJ 3L73E 1SQXE 1NAFA 1OVUA 1L4AA 2FQ0A 4IPYA 3H1KE 2YMYA 2L0QA 3KDPB 1HH0A 1JTHB 1FE6A 2O3JA 3V2QA 2R3SA 2KGCA 1KYOE 1SQPG 3CWBJ 3NMDA 2FYZA 4B86A 1EZVI 1VF5D 2KS1A 1LTGC 1JY2N 4D6TG 3VOPA 1J1DB 3GW6A 3M0DC 1VQPP 1GL2C 3TGUG 5CCHD 4ZNCA 3PJSK 3C9IA 3L70D 4I2LC 1LTTC 1JCCA 1L0LD 2N1TA 5F2KA 2OTLP 2M8LA 4PJ0H 1VQ6P 1A02J 2EHSA 2E5YA 4EI2A 2FYUK 3CCJP 3BCCJ 2CQ8A 1NTMD 3Q5RA 2K0DX 2QVAA 3HUSC 1HVVA 3CPWO 1AVOA 2OTKE 2Z44A 1EDKA 2WSCH 2WVRA 1D7MA 1LTSC 4U3FE 3RL0g 5I4TG 1M7LA 3H1LD 4GOEA 5CBOA 1SQXJ 3RBXA 1KILE 1L2PA 3W68A 1NTKE 3D71A 4Y99C 1CSBA 1NTZK 3UIAA 2KLVA 1M6EX 4BPFA 3H1KJ 1NQ4A 1NKZB 3KPEA 1RQVA 4EYYQ 5BU5A 3CC2P 4U0EA 3CWBD 5CCHA 1SQPJ 3D70A 2HYNA 4COCA 3MIWA 2J5UA 2MR7A 4I6MC 3B5IA 2FFDC 3RL0D 1YITP 5KAFH 1OW8A 2Y9YA 3O6QB 3OW2O 3Q3DA 1JMMA 4DT0A 5EJDA 3GMAA 2X2BA 3C1LA 1CZQA 3CLQA 2YMKA 4NPEA 3WUUA 2N6ZA 1FU1A 2V4HA 2M5RA 2GUVA 2ZFCA 2WMMA 1KORA 4W7YA 5AW5B 2FYNB 3AE9C 2O01H 1SFCB 2DW3A 3L75E 3M9HA 1NAYA 2R3CA 1N7SD 3JSVC 3LW5H 3U59A 5CZDB 2ZT9D 3BCCD 5HV8A 3SWYA 3SFDC 2QE7H 3O8ZA 2KUBA 1EC5A 2XV6A 2PEIA 3EFGA 3RG2A 3KZIE 2JAZA 2LKIA 4CPGA 1KN7A 4U3FJ 1L0NE 2KZJA 1H8AA 2HODA 1SQXD 2BCCE 3RG6C 2B88A 4W7ZA 1NTKJ 3H1KD 2W83C 4CA3A 2XZ1C 5KLIC 1N86A 4BPGA 3RBZA 5F2NA 2O1KA 1SFCD 1RE3C 5F2OA 1HBWA 4H2YC 2BHVA 1R5SA 1XTGB 2JO0A 1SQPD 3G71P 1KYOD 3L72G 1LWUB 5C39A 1LT9B 2CPSA 4D6TD 3A0BE 1AQ5A 3C8VA 4U0AA 4H0LB 1KB9H 1YJWP 3L74E 1GK6A 1VQ8P 1RF0A 2K0XA 2M8PA 1KD1Q 2GZFA 2B87A 2OYIA 1RF1C 1KILB 1GU4A 1NU1G 1P84H 4H13B 2PEMA 1IMQA 4NEOA 1PEOA 4Y28J 3TNUB 2M0BA 3CCMP 3EWKA 3EQ2A 2AVAA 3L75J 4ZKUA 3H1HE 1YQ4C 3TSIA 2GZGA 4UB6H 4XRQA 1USEA 1IFNA 2AFDA 3IAOA 2GZIA 3S4RA 2KZIA 1X9VA 1OR5A 1KYOI 3EJDA 4QMAA 3GZMA 3AE8C 3JCUH 1OZHA 4U3FD 1GW4A 1KQGB 1QL2A 1Y9BA 1X22A 1L0NJ 1HJ0A 1AJYA 2BCCJ 1FZCB 3F5HA 1KILD 1GL2A 1NTKD 2AXTE 1YBKA 4PJ0E 2WT7B 1SQQG 1JNMA 1K30A 2WZ7A 3R4YA 1DEBA 4H2WC 2FQ1A 1T2KD 2YXQB 1JJ2O 1BAJA 3M9QA 5KJ7C 4QNBA 2LXBA 1PEQA 2M8RA 1HJBA 4OH8B 1FJKA 1FZBA 3CCEP 4M3LA 1VL2A 3L74J 1SQBE 3B5ND 4BRYB 2RN0A 1URQB 3HUSA 3CCVP 1ZMBA 4TLFA 2QM8A 2Z5IA 3CI9A 3R2PA 5APSA 3USSA 3P8CE 3GZLA 1DV5A 2WPVB 3L75D 1MFZA 3M9BA 1BGYE 3H1HJ 7CEIA 2JYLA 2K88A 1LNQA 4KT0J 2ONTA 5GTIE 5GTHE 1FOSF 4H44B 1EXIA 1NU1K 2OYHA 1R8EA 3N4XA 2MJZA 3AEFC 1PP9E 1PPJE 1KMIZ 1IFJA 2FFDA 2BCCD 2E76D 2HG5D 1YHQP 3BRVB 2N9YB 2JYGA 1VDFA 1LP1A 3DS4A 4GR6A 3B5NA 1BE3E 3V2NA 1U57A 3FWLA 1FOSE 1VF5C 1M6NA 2OARA 3L70G 4U0CA 1L0LG 3IN6A 4H44D 1D1DA 3GKLC 1QVFO 3G26A 3L74D 5M1BA 3HE5B 5L8RJ 2AF8A 5CCHC 1SQBJ 4DG9A 3V2PA 2G8YA 5KLVE 2OGUA 2MKVA 2B9BA 3QH9A 3S1KA 4BXLA 1NTMG 3AEAC 2CG5B 1FZAA 3H1HD 4XE5B 3V4WA 1YYCA 4GODA 5APTA 1IUQA 2KLUA 1ZXGA 3H1LG 1L0IA 2Y0CA 3Q5SA 2EIAA 2JU2A 1IK7A 3Q1MA 1CEIA 2IYOA 3L71E 2LIWA 3JC22 1FJPA 1PGOA 4KJMA 2KWLA 2N5HA 3G29A 4OGQD 3GF7A 1PP9J 1H88A 3H4EA 5AVSB 5AVQB 5APXA 3CWBG 2GZJA 1SQQD 2CGQA 3EFFK 5BVZA 3E1RA 4GT1A 1IFMA 5TISE 1E6JP 4NPDA 3KZIH 3GJNA 1LTJA 4DOJA 1FDIA 1DEEG 3BRTB 1OVVA 2H7HA 1BE3J 2IDBA 4UB6E 1X8YA 2WSEH 2HLOA 1QVGO 1JY3P 2PEQA 3RL0C 1T3JA 3JCUE 2ERHA 1SQBD 2FYUE 4WY4D 3VP8A 2W6BA 3H6PA 4DCKA 5KLVJ 1AQTA 2GZEA 3OAKA 3BCCG 1VQNP 4WWIA 2AEMA 3P8CD 1MZ9A 4PV1B 2K93A 1RF0C 2O01N 4MN4C 2KNCA 1L0LK 1N7SC 2Q3EA 1S1CX 2N5IA 2QJKC 4N78E 1G1IA 1Q7YQ 4YTPC 1VQKP 2K92A 3H1JE 1M57D 3L73G 1A43A 1GW3A 1M1JA 1SQXG 4HJGH 3L71J 3H1KG 3AEDC 4XROA 5KJ7A 5APQA 1NTMK 4DJGA 3CCRP 2D2CB 1NJIQ 2GUSA 2RKLA 2V7QH 1PP9D 1VQ9P 4HH2A 3M1MA 2IX7C 1N73C 2K9YA 2AFEA 1RHZB 3WU2E 1T3UA 3DS5A 4WVZA 2PEOA 2XXMA 1OIPA 3BATA 5BS2A 4A7PA 1SFCC 1JY2O 3AE5C 1HQBA 4I7ZC 3PTZA 3G3ZA 2W27A 2GYKA 2K9JB 3SFEC 2XKMA 2L91A 4RKUJ 3FX0A 3CCSP 1RH5B 2AXTH 5EW5E 1ZR2A 2BASA 4LC1A 1ZRTE 3VRLC 1N7LA 5CHXA 2EHTA 3G28A 2XU6A 2YXRB 1UIIA 2JGPA 1S9KD 2Z45A 2NPSB 3N7NA 5KTBA 2I1KA 1LJ2A 1JY3N 2QEXP 5KP8B 1YTZI 3EJEA 5AVXB 5HGNA 3ZDMA 1VPCA 2A45G 2AEJA 1GDTA 3E2DA 3HD7B 4U3FG 2KSEA 4K3AA 1FZGA 3PHLA 3K5BA 3L73J 1LT9C 1KB9D 1NTKG 3L71D 1RNIA 3MHVA 2KXPB 1S2EA 2JB0A 4LLHA 5HGMA 2IBZE 2MVUA 3PLNA 1YQ3C 3CXCO 2FXOA 1ZR4A 5CCGD 4XA4A 2EG5A 1KILC 1P84D 3I56P 2LTEA 2OYHC 3H32B 3BASA 2NPSD 2WSSH 5GTIH 3RGUA 5GTHH 2YO2A 1SQXK 2PFXA 4ZMDA 3CX5H 1OW6A 2WPTA 1T2KC 2R5DA 1CI6B 1FDMA 2FAEA 4C7NB 3T97B 1H0TA 3H1IE 5DJUB 1NVOA 3G1IA 1KTMA 1JTHA 3DPHA 3EJBA 2MD9A 1FC2C 1SQPK 4GR2A 1J1EC 2XZRA 3G0VA 2BUOA 3B5NC 2Q9IA 3L75G 5DCKA 1KB9I 1PIXA 3NTNA 1FZCC 1JEKA 2J58A 4NPFX 1GTWA 4EOTA 4IOIH 1P84I 3HTKB 2KYVA 3TYYA 4N78D 2CNRA 1KFNA 2JJLA 1L0NG 1RE4C 3L73D 1N2DC 2BCCG 3I5CA 1T6AA 2H89C 2VLQA 5KP6B 5CCGA 5AW7B 2LOLA 3G4SP 3OJAB 1GXGA 4YPCA 3CMEP 2A06E 3SSUA 2JEEA 4LGDE 2PY8A 1URQC 3L35A 3Q20A 2Y9ZA 4HYTB 2E76C 4ZKPA 2XNXA 1PGPA 3CXHH 2QJYB 2WTYA 2M5AB 1HGZA 2PENA 2DGYA 1NTKK 5DJTB 1Q2NA 3L74G 4C46A 2POHA 2QM7A 4TT3H 2M3EA 2P10A 1LTIC 1NO4A 3D6YA 3L72E 2AXCA 3H1IJ 1N7SA 3L4FA 2P9XA 4H44C 3A3YB 2B89A 1KZUB 3DTJA 1LTJC 1ZRTD 1K8AQ 2N9BA 1SP4A 3H1HG 2XV5A 1E79H 5TISH 3LMOA 4AYCA 1LTBC 2Q1KA 3O6QA 1AA0A 1HY8A 3RK2B 1KQLA 2K1AA 1N73A 1MKMA 5KKZC 3MZWB 2KOPA 5H2FE 1XTCC 4IL6H 1UNKA 4H0LD 1BXIA 2LKMA 2VLNA 3NTEA 1K73Q 1JB0J 2QSIA 1SFCA 1GU5A 2KG8A 1AVYA 2WSEJ 1YTZT 3A7OA 3FXDA 3HE4B 3U43A 1U7JA 4H13D 2EFJA 5AW0B 1S5LE 2IBZD 2H88C 4OGQC 5AVUB 3GG2A 3A0HE 1M1JC 1AUMA 2N98A 1EMVA 3WMM0 1Q90D 2MVVA 1IJDB 4PXHB 2MR8A 3AE6C 5B5EH 3RK2D 2KR5A 2XZ0D 1SQBG 1FBMA 2HFED 2W6JH 1KLPA 3CMAP 1NH4A 2HPCB 4L73A 4XFYA 3H1ID 3TDKA 1S4XA 1WMKA 4L76A 2A45I 3NFQA 3WU2H 1K04A 3G9RA 2K94A 2LF4A 2KGEA 1G2CB 4AQRD 1LWUA 2YO3A 2V7QJ 4WY4C 2J59M 1LT9A 4JF7A 1BGYG 1SQVE 3AEBC 1EZVE 1PGQA 1ZN5A 3DS3A 4W80A 3TF5A 1DX7A 1NYHA 2FBWC 2Q5UA 1JOCA 3CX5E 2E75B 1KILA 2YNYA 2KOQA 2LIUA 5AVTB 3AEEC 3TNUA 1L0ND 1PP9G 1PPJG 2C9NY 1OXZA 1QL1A 1URQD 2BEZF 2YIUB 2KOSA 1RF1B 4BPHA 1HWTC 2E74B 2A06D 3G21A 2KOGA 1E5WA 2K0YA 2PAJA 3GHGB 4DZOA 4RJTA 3RK3E 2MY5A 3VTPC 2ROQA 1BE3G 1ZW0A 2WSFH 1BSHA 2CWOA 5AW9B 1FZCA 2E75D 3MGEA 2JWDA 2W90A 5BU8B 1SQQK 2JBGA 2WT7A 3CCUP 3OA7A 2JWAA 2M3BA 1OMIA 5KLVG 2P7JA 2KNCB 1DH3A 1M1KQ 1BDCA 1ZV8A 2E74D 1EXJA 5EFWB 1RE4A 5AVVB 4U0FA 2D2CC 4U7JA 1A8OA 1BGYJ 1SQVJ 3CXHE 3HRNA 1L4AB 5HGLA 4KHXA 4BRYA 1FR2A 1URQA 1ZMEC 4U0BA 1HGVA 3L71G 1J1DC 1SVFA 4WBAA 1SS1A 5B66E 1LTAC 1PEUA 2KS1B 2VSQA 1JUNA 4F37A 2WWWA 3B71A 3Q5PA 4R4LA 2OTJP 1JO5A 1JY2P 2ZYGA 3G6EP 1A02F 3GF3A 3KHUA 3CC7P 5CCGC 4COPA 3DS0A 1RO0A 3L37A 2N1TB 1VQ5P 2ZXXA 3PH0A 2NPSC 1L4AD 3I55P 5E79H 2VLPA 2P1JA 1IFDA 1G1JA 2R44A 5JPAA 3AE7C 4IL6E 1VHNA 4I1LA 3MTUE 2FYUG 2FHSC 2JU1A 1YI2P 1YJNP 3V4QA 2QJPB 1MUUA 1U7MA 3MUDC 1ZNVA 5AW3B 1OVRA 1PV3A 2W8ZA 4R0MA 2QA4P 1Y47A 2L4BA 5BS1A 1KQSO 1BCCE 4R4MA 2LR2A 3RK3B 1BGYD 1SQVD 1VQMP 1RO2A 1VQOP 4WYMA 2KOOA 3HE5A 2N1TD 3H1JG 1WRGA 1NTZE 1FZFA 5B5EE 1VF5B 3CX5D 1GXHA 3LIEA 1LT1A 3MP7B 1S5LX 1PFIA 4PD4H 3WBHA 3CL3D 2ZVOB 3VP9A 2K3RA 1CW5A 1PPJD 3V5BA 3W67A 5AVWB 3WUTA 1QX8A 2P67A 3CCQP 1HF9A 2FQ2A 2RH0A 2FYNC 2HR3A 4PV1D 4L74A 2QRXA 2E5TA 3CC4P 1H0TB 1ACPA 4YXDC 5H2FH 3RK3D 1RY3A 1VQLP 5HVCA 1BE3D 1UIXA 4WY4A 1SQPE 1MZ8A 4M0IA 2WPRA 4L75A 1M56D 5AVZB 5HGOA 3FGAD 4D6TE 1EDJA 1S5LH 2FYUJ 3CX5I 3TGUE 2D2CD 5KLVD 3A0HH 1YIJP 3DS2A 2C9LY 3SWKA 3QWOC 1IK9A 1JY3O 2KG9A 2LXCB 3Q2YA 1BCCJ 2HODB 2CPBA 3G1GA 2KB7P 1L0HA 3CXHD 1NWQA 1VKUA 3V6IA 1LWUC 3H1JJ 1NTZJ 2IYPA 2QJYC 3IF4A 2KSJA 4N3YB 1BDDA 3DS1A 2PRRA 2FKWB 3RL0B 4H0LC 2E1MA 1EDIA 2LPKA 2WPSA
chains in the Genus database with same CATH topology
2P9XA 5BS2A 5HGLA 3DTJA 2Z46A 3WBHA 3G1IA 4U0BA 3DPHA 3CCJP 3DS3A 3HYBA 1K8AQ 3CD6P 1YHQP 2XV6A 4GR2A 1S72P 2PEIA 2PEKA 1E6JP 3G0VA 2BUOA 3H47A 2JYGA 2L6EA 3CCSP 1PEUA 5DCKA 3CCQP 3CPWO 3DS4A 2Z44A 4GR6A 3RG6C 2XT1A 1EIAA 1QVGO 3VRLC 2PEQA 3CC4P 5I4TG 1K30A 2OTJP 3G28A 3G6EP 1M6NA 2OARA 2KODA 3NTEA 4U0CA 2PEJA 2Z45A 5F2NA 1JJ2O 1VQLP 1K73Q 4U0DA 1BAJA 1KC8Q 1D1DA 4QNBA 3CC7P 4PH0A 5F2OA 4COPA 1M6EX 3DS0A 3G26A 1QVFO 1RO0A 3G21A 3HZQA 4M0IA 1PEQA 3LRYA 2QEXP 1VQ5P 1K9MQ 2BHVA 5HGOA 1VQNP 2JO0A 5HGNA 1EOQA 3G71P 1M74A 2EFJA 3I55P 3CCEP 4IPYA 3CC2P 3E2DA 2M8NA 4U0EA 1YJ9P 3CCLP 5JPAA 4PH1A 4U0AA 1AUMA 3CCVP 3G4SP 1ZMBA 1YIJP 3CMEP 4COCA 3DS2A 1YJWP 2CWOA 1YI2P 1YJNP 1Q7YQ 1VQ8P 2PY8A 3B5IA 3MGEA 1VQKP 3Q20A 2M8PA 4XFXA 1KD1Q 1RNIA 1YITP 1Q86Q 1VQ4P 1IUQA 1A43A 1Q81Q 3CCUP 5HGMA 3OW2O 2QA4P 1N8RQ 3H0DA 2PEMA 3P05A 4XROA 1PEMA 5BS1A 1W2BO 3CXCO 1PEOA 1KQSO 1VQPP 2EG5A 2JYLA 3CCRP 1M90Q 2EIAA 3G1GA 1NJIQ 2PENA 3CCMP 3I56P 2BQ1E 3CMAP 2DGYA 1VQ9P 1M1KQ 4XFYA 1VQMP 1RO2A 1VQOP 3M1MA 2ONTA 4WYMA 3DS1A 4XFZA 4U0FA 1Q82Q 1VQ7P 1A8OA 3DS5A 3G29A 2LF4A 5F2KA 2PEOA 2OTLP 2XXMA 2E1MA 2M8LA 1QRJA 1VQ6P 4XRQA 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 P;  1N8R Q;  3I55 P;  3CCE P;  1Q81 Q;  3CC2 P;  1QVG O;  1W2B O;  3CXC O;  1YJ9 P;  3CC4 P;  3CCL P;  1KQS O;  1VQP P;  1VQ6 P;  3CCR P;  1M90 Q;  1NJI Q;  2OTJ P;  3CCM P;  3I56 P;  3CMA P;  3G6E P;  3G4S P;  3CCJ P;  3CCV P;  1VQ9 P;  3CME P;  1YIJ P;  1K8A Q;  1VQM P;  1M1K Q;  3CD6 P;  1VQO P;  1YHQ P;  1YJW P;  1JJ2 O;  1VQL P;  1YI2 P;  1K73 Q;  1YJN P;  1S72 P;  1KC8 Q;  1Q7Y Q;  1Q82 Q;  1VQ8 P;  3CC7 P;  1VQ7 P;  1VQK P;  1QVF O;  1KD1 Q;  2QEX P;  1YIT P;  1Q86 Q;  1VQ4 P;  2OTL P;  3CCS P;  1VQ5 P;  1K9M Q;  3CCQ P;  3CPW O;  3CCU P;  1VQN P;  3OW2 O;  3G71 P; 
#chains in the Genus database with same CATH topology
 2SPZ A;  2IBZ G;  1NGM B;  2Y0E A;  2IFN A;  1FAV A;  3ABV C;  1M8O B;  4H13 C;  4HB1 A;  1HTL C;  2H8P D;  1S72 P;  3IFM A;  5APU A;  2B87 B;  2OYI B;  3GLM A;  1N7S B;  1Z6M A;  1QEX A;  4C7R A;  2IZ1 A;  4EIJ A;  5APY A;  2QJK B;  2ZT9 B;  3HD7 D;  3H1I G;  3MD0 A;  3RK2 C;  1NKN A;  3CXH I;  1EQ7 A;  1OX3 A;  2BEQ D;  4D6T J;  2RMZ A;  4UB8 H;  1WT6 A;  2FYU D;  3HZQ A;  1Y8A A;  5AW2 B;  3TGU J;  1X0T A;  1RQU A;  2I8D A;  3AE2 C;  1AYI A;  1N73 B;  4GKG A;  1GD2 E;  2OYO A;  1PL5 A;  1BCC D;  2K9J A;  2IPP A;  4I7Z B;  2L5G B;  1DIP A;  4XFJ A;  1GL2 B;  1ZP0 C;  1UJZ A;  3H1J D;  1NTZ D;  2WSF J;  5AW1 B;  3P8M C;  3U1C A;  5E79 E;  3P05 A;  2WIT A;  4OWF A;  2QIW A;  2FVE A;  2JP3 A;  3AE3 C;  2KW2 A;  1IO4 A;  4HKG A;  3VMZ A;  4N6J A;  2A06 G;  2NPS A;  1Q82 Q;  3M06 A;  5AW6 B;  5K5G B;  2P58 A;  2MF4 A;  3AE4 C;  2NRG A;  3HD7 A;  2GDY A;  4IL6 X;  2PP6 A;  3MUD A;  4JPZ B;  3HUS B;  2LL8 A;  2IZ0 A;  2GM4 A;  2VLO A;  5AW8 B;  1TU3 F;  5B66 H;  1GL2 D;  5KAI E;  2OQQ A;  2E43 A;  5KP7 B;  1USD A;  1E0H A;  2YKP A;  3AE1 C;  2E75 C;  4PD4 E;  4Y99 B;  1IMP A;  3WUV A;  2GDW A;  1FDO A;  2L22 A;  1T8Z A;  3H32 A;  3IR9 A;  3TGU D;  1T8K A;  2PEJ A;  2NO8 A;  1FS0 E;  4PH0 A;  2Q6Q A;  2VRS A;  3M0A A;  2YKQ A;  2YIU C;  3A2A A;  4BWN A;  1CI6 A;  2R32 A;  1NU1 E;  2OYH B;  1EOQ A;  2E74 C;  5AVR B;  4C7N A;  3T97 A;  2M8N A;  2DNW A;  1GK4 A;  3GHG C;  2FFD B;  2KI7 B;  2PNG A;  3FXE A;  5CMZ A;  2JR8 A;  4ASV A;  3AEG C;  1DD3 A;  5CJ0 A;  4IZ6 A;  1LP1 B;  1W2B O;  1J1E B;  3KXD A;  2QG4 A;  3B5N B;  1F80 D;  2JDI H;  2WPQ A;  2K2Q A;  1NOH A;  2JQ4 A;  3HTK A;  1ZLL A;  1GPJ A;  2N6Y A;  3E1I A;  3M0D A;  4GOF A;  2N50 A;  1L0N K;  1QRJ A;  1SQQ E;  1DNY A;  4UHP B;  1NHL A;  4IFF A;  1W5C E;  1K05 A;  2IFM A;  1L4A C;  3L72 J;  1MFT A;  2FXP A;  2PEK A;  5TJH A;  2H43 A;  4PWV B;  3KYQ A;  2P2U A;  4K35 A;  4IFM A;  5KLI B;  2E42 A;  4H2X C;  2GA1 A;  2KP8 A;  1SQV G;  2M5A A;  2KIK A;  2Q3I A;  2E76 B;  1EZV G;  1KQF B;  3U1A A;  2IBZ I;  2FAD A;  4YXW H;  1FZE A;  1NU1 J;  2K37 A;  1KYO H;  5APV A;  2GDX A;  1K9M Q;  1GMJ A;  3F89 A;  1JM0 A;  3PRJ A;  3VN0 A;  3A5T A;  1JMB A;  3P32 A;  1YJ9 P;  2N1T C;  4PH1 A;  3CE7 A;  3II6 A;  3KQG A;  1GZL A;  2XDJ A;  2FAC A;  1AF8 A;  4UB8 E;  4EDF A;  1OWA A;  1QGK B;  5KAF E;  1LTJ B;  1IFI A;  1N8R Q;  5CJ4 A;  3BVH A;  2UWJ E;  2QJP C;  3H0D A;  1H89 A;  2ZAE B;  4RO0 A;  3VYI A;  5APW A;  4IFD K;  2Z4E A;  2KK7 A;  1ZOY C;  1EDL A;  4PV1 C;  1SQQ J;  4XFZ A;  4RES B;  2FVF A;  2KG6 A;  4JQ0 D;  5KKZ B;  3RK3 C;  1J2J B;  1AFO A;  1DD4 A;  3HE4 A;  2XND H;  2QNW A;  3VMY A;  2A45 H;  3H25 A;  3B4S A;  1HUC A;  4JBZ A;  3L72 D;  3MGN A;  2FVA A;  4O9B A;  1IFP A;  2Z46 A;  1R5L A;  3VMA A;  1OW7 A;  3L70 E;  1LGH B;  4PD4 D;  2G3A A;  1JCD A;  1L0L E;  3SWF A;  2WSC J;  1IC2 A;  2L6E A;  2I1J A;  4OGQ B;  3M91 A;  1M1J B;  1OFC X;  1BSN A;  3AEC C;  5AVY B;  1SQB K;  5CBN A;  1EIA A;  2ZVN B;  1NU1 D;  1S9K E;  2KGA A;  1X79 B;  2ZJS E;  2ZYA A;  3NXS A;  2Q7C A;  3NY7 B;  2HPC A;  1NTM E;  2JO1 A;  1S3J A;  4JYB A;  3ITK A;  4U0D A;  1KC8 Q;  1KFM A;  5AW4 B;  2O1J A;  3LRY A;  1G2C A;  3P7K A;  1SQV K;  1QLE D;  1M74 A;  3H1L E;  4MRT C;  2W6A A;  2JKV A;  1RE3 A;  4GDO A;  3S9O A;  3CCL P;  2AEF A;  3FWN A;  1Z56 A;  3B8E B;  1KB9 E;  3D6Z A;  4HKZ H;  4WY4 B;  1W2E A;  2KOR A;  4PD4 I;  4OVN F;  4XFX A;  1Q86 Q;  1VQ4 P;  1Q81 Q;  1P84 E;  2FXM A;  3CWB E;  2R5B A;  1PZQ A;  1PEM A;  5KJ7 D;  4JYC A;  2K5X A;  1M90 Q;  2O01 J;  2C0X A;  2BQ1 E;  1RF1 A;  2NZ2 A;  2L9F A;  1AV1 A;  3LW5 J;  3HD7 C;  1MV8 A;  1VQ7 P;  3GHG A;  3LID A;  1PGJ A;  4ASW A;  3L70 J;  2CK3 H;  4QKO A;  1L0L J;  2KGD A;  1KV4 A;  3E7K A;  1BCC G;  4AUW A;  3HYB A;  2ITA A;  3CD6 P;  2PGD A;  1X3O A;  3TK1 A;  1SLQ A;  2ZXE B;  2YKO A;  1EZV D;  3H47 A;  2WQY C;  5KAI H;  3BCC E;  4Z1M H;  1NTZ G;  5KLV K;  2ZYD A;  3VMX A;  1NTM J;  2XT1 A;  3V2R A;  3B4Q A;  1IZN B;  3A0B H;  2OYI C;  2LML A;  2FY8 A;  2KOD A;  2ZT9 C;  3L36 A;  4GIF A;  2Y0D A;  2C0W A;  4WB4 A;  2Z5H A;  3PP5 A;  3H1L J;  3L73 E;  1SQX E;  1NAF A;  1OVU A;  1L4A A;  2FQ0 A;  4IPY A;  3H1K E;  2YMY A;  2L0Q A;  3KDP B;  1HH0 A;  1JTH B;  1FE6 A;  2O3J A;  3V2Q A;  2R3S A;  2KGC A;  1KYO E;  1SQP G;  3CWB J;  3NMD A;  2FYZ A;  4B86 A;  1EZV I;  1VF5 D;  2KS1 A;  1LTG C;  1JY2 N;  4D6T G;  3VOP A;  1J1D B;  3GW6 A;  3M0D C;  1VQP P;  1GL2 C;  3TGU G;  5CCH D;  4ZNC A;  3PJS K;  3C9I A;  3L70 D;  4I2L C;  1LTT C;  1JCC A;  1L0L D;  2N1T A;  5F2K A;  2OTL P;  2M8L A;  4PJ0 H;  1VQ6 P;  1A02 J;  2EHS A;  2E5Y A;  4EI2 A;  2FYU K;  3CCJ P;  3BCC J;  2CQ8 A;  1NTM D;  3Q5R A;  2K0D X;  2QVA A;  3HUS C;  1HVV A;  3CPW O;  1AVO A;  2OTK E;  2Z44 A;  1EDK A;  2WSC H;  2WVR A;  1D7M A;  1LTS C;  4U3F E;  3RL0 g;  5I4T G;  1M7L A;  3H1L D;  4GOE A;  5CBO A;  1SQX J;  3RBX A;  1KIL E;  1L2P A;  3W68 A;  1NTK E;  3D71 A;  4Y99 C;  1CSB A;  1NTZ K;  3UIA A;  2KLV A;  1M6E X;  4BPF A;  3H1K J;  1NQ4 A;  1NKZ B;  3KPE A;  1RQV A;  4EYY Q;  5BU5 A;  3CC2 P;  4U0E A;  3CWB D;  5CCH A;  1SQP J;  3D70 A;  2HYN A;  4COC A;  3MIW A;  2J5U A;  2MR7 A;  4I6M C;  3B5I A;  2FFD C;  3RL0 D;  1YIT P;  5KAF H;  1OW8 A;  2Y9Y A;  3O6Q B;  3OW2 O;  3Q3D A;  1JMM A;  4DT0 A;  5EJD A;  3GMA A;  2X2B A;  3C1L A;  1CZQ A;  3CLQ A;  2YMK A;  4NPE A;  3WUU A;  2N6Z A;  1FU1 A;  2V4H A;  2M5R A;  2GUV A;  2ZFC A;  2WMM A;  1KOR A;  4W7Y A;  5AW5 B;  2FYN B;  3AE9 C;  2O01 H;  1SFC B;  2DW3 A;  3L75 E;  3M9H A;  1NAY A;  2R3C A;  1N7S D;  3JSV C;  3LW5 H;  3U59 A;  5CZD B;  2ZT9 D;  3BCC D;  5HV8 A;  3SWY A;  3SFD C;  2QE7 H;  3O8Z A;  2KUB A;  1EC5 A;  2XV6 A;  2PEI A;  3EFG A;  3RG2 A;  3KZI E;  2JAZ A;  2LKI A;  4CPG A;  1KN7 A;  4U3F J;  1L0N E;  2KZJ A;  1H8A A;  2HOD A;  1SQX D;  2BCC E;  3RG6 C;  2B88 A;  4W7Z A;  1NTK J;  3H1K D;  2W83 C;  4CA3 A;  2XZ1 C;  5KLI C;  1N86 A;  4BPG A;  3RBZ A;  5F2N A;  2O1K A;  1SFC D;  1RE3 C;  5F2O A;  1HBW A;  4H2Y C;  2BHV A;  1R5S A;  1XTG B;  2JO0 A;  1SQP D;  3G71 P;  1KYO D;  3L72 G;  1LWU B;  5C39 A;  1LT9 B;  2CPS A;  4D6T D;  3A0B E;  1AQ5 A;  3C8V A;  4U0A A;  4H0L B;  1KB9 H;  1YJW P;  3L74 E;  1GK6 A;  1VQ8 P;  1RF0 A;  2K0X A;  2M8P A;  1KD1 Q;  2GZF A;  2B87 A;  2OYI A;  1RF1 C;  1KIL B;  1GU4 A;  1NU1 G;  1P84 H;  4H13 B;  2PEM A;  1IMQ A;  4NEO A;  1PEO A;  4Y28 J;  3TNU B;  2M0B A;  3CCM P;  3EWK A;  3EQ2 A;  2AVA A;  3L75 J;  4ZKU A;  3H1H E;  1YQ4 C;  3TSI A;  2GZG A;  4UB6 H;  4XRQ A;  1USE A;  1IFN A;  2AFD A;  3IAO A;  2GZI A;  3S4R A;  2KZI A;  1X9V A;  1OR5 A;  1KYO I;  3EJD A;  4QMA A;  3GZM A;  3AE8 C;  3JCU H;  1OZH A;  4U3F D;  1GW4 A;  1KQG B;  1QL2 A;  1Y9B A;  1X22 A;  1L0N J;  1HJ0 A;  1AJY A;  2BCC J;  1FZC B;  3F5H A;  1KIL D;  1GL2 A;  1NTK D;  2AXT E;  1YBK A;  4PJ0 E;  2WT7 B;  1SQQ G;  1JNM A;  1K30 A;  2WZ7 A;  3R4Y A;  1DEB A;  4H2W C;  2FQ1 A;  1T2K D;  2YXQ B;  1JJ2 O;  1BAJ A;  3M9Q A;  5KJ7 C;  4QNB A;  2LXB A;  1PEQ A;  2M8R A;  1HJB A;  4OH8 B;  1FJK A;  1FZB A;  3CCE P;  4M3L A;  1VL2 A;  3L74 J;  1SQB E;  3B5N D;  4BRY B;  2RN0 A;  1URQ B;  3HUS A;  3CCV P;  1ZMB A;  4TLF A;  2QM8 A;  2Z5I A;  3CI9 A;  3R2P A;  5APS A;  3USS A;  3P8C E;  3GZL A;  1DV5 A;  2WPV B;  3L75 D;  1MFZ A;  3M9B A;  1BGY E;  3H1H J;  7CEI A;  2JYL A;  2K88 A;  1LNQ A;  4KT0 J;  2ONT A;  5GTI E;  5GTH E;  1FOS F;  4H44 B;  1EXI A;  1NU1 K;  2OYH A;  1R8E A;  3N4X A;  2MJZ A;  3AEF C;  1PP9 E;  1PPJ E;  1KMI Z;  1IFJ A;  2FFD A;  2BCC D;  2E76 D;  2HG5 D;  1YHQ P;  3BRV B;  2N9Y B;  2JYG A;  1VDF A;  1LP1 A;  3DS4 A;  4GR6 A;  3B5N A;  1BE3 E;  3V2N A;  1U57 A;  3FWL A;  1FOS E;  1VF5 C;  1M6N A;  2OAR A;  3L70 G;  4U0C A;  1L0L G;  3IN6 A;  4H44 D;  1D1D A;  3GKL C;  1QVF O;  3G26 A;  3L74 D;  5M1B A;  3HE5 B;  5L8R J;  2AF8 A;  5CCH C;  1SQB J;  4DG9 A;  3V2P A;  2G8Y A;  5KLV E;  2OGU A;  2MKV A;  2B9B A;  3QH9 A;  3S1K A;  4BXL A;  1NTM G;  3AEA C;  2CG5 B;  1FZA A;  3H1H D;  4XE5 B;  3V4W A;  1YYC A;  4GOD A;  5APT A;  1IUQ A;  2KLU A;  1ZXG A;  3H1L G;  1L0I A;  2Y0C A;  3Q5S A;  2EIA A;  2JU2 A;  1IK7 A;  3Q1M A;  1CEI A;  2IYO A;  3L71 E;  2LIW A;  3JC2 2;  1FJP A;  1PGO A;  4KJM A;  2KWL A;  2N5H A;  3G29 A;  4OGQ D;  3GF7 A;  1PP9 J;  1H88 A;  3H4E A;  5AVS B;  5AVQ B;  5APX A;  3CWB G;  2GZJ A;  1SQQ D;  2CGQ A;  3EFF K;  5BVZ A;  3E1R A;  4GT1 A;  1IFM A;  5TIS E;  1E6J P;  4NPD A;  3KZI H;  3GJN A;  1LTJ A;  4DOJ A;  1FDI A;  1DEE G;  3BRT B;  1OVV A;  2H7H A;  1BE3 J;  2IDB A;  4UB6 E;  1X8Y A;  2WSE H;  2HLO A;  1QVG O;  1JY3 P;  2PEQ A;  3RL0 C;  1T3J A;  3JCU E;  2ERH A;  1SQB D;  2FYU E;  4WY4 D;  3VP8 A;  2W6B A;  3H6P A;  4DCK A;  5KLV J;  1AQT A;  2GZE A;  3OAK A;  3BCC G;  1VQN P;  4WWI A;  2AEM A;  3P8C D;  1MZ9 A;  4PV1 B;  2K93 A;  1RF0 C;  2O01 N;  4MN4 C;  2KNC A;  1L0L K;  1N7S C;  2Q3E A;  1S1C X;  2N5I A;  2QJK C;  4N78 E;  1G1I A;  1Q7Y Q;  4YTP C;  1VQK P;  2K92 A;  3H1J E;  1M57 D;  3L73 G;  1A43 A;  1GW3 A;  1M1J A;  1SQX G;  4HJG H;  3L71 J;  3H1K G;  3AED C;  4XRO A;  5KJ7 A;  5APQ A;  1NTM K;  4DJG A;  3CCR P;  2D2C B;  1NJI Q;  2GUS A;  2RKL A;  2V7Q H;  1PP9 D;  1VQ9 P;  4HH2 A;  3M1M A;  2IX7 C;  1N73 C;  2K9Y A;  2AFE A;  1RHZ B;  3WU2 E;  1T3U A;  3DS5 A;  4WVZ A;  2PEO A;  2XXM A;  1OIP A;  3BAT A;  5BS2 A;  4A7P A;  1SFC C;  1JY2 O;  3AE5 C;  1HQB A;  4I7Z C;  3PTZ A;  3G3Z A;  2W27 A;  2GYK A;  2K9J B;  3SFE C;  2XKM A;  2L91 A;  4RKU J;  3FX0 A;  3CCS P;  1RH5 B;  2AXT H;  5EW5 E;  1ZR2 A;  2BAS A;  4LC1 A;  1ZRT E;  3VRL C;  1N7L A;  5CHX A;  2EHT A;  3G28 A;  2XU6 A;  2YXR B;  1UII A;  2JGP A;  1S9K D;  2Z45 A;  2NPS B;  3N7N A;  5KTB A;  2I1K A;  1LJ2 A;  1JY3 N;  2QEX P;  5KP8 B;  1YTZ I;  3EJE A;  5AVX B;  5HGN A;  3ZDM A;  1VPC A;  2A45 G;  2AEJ A;  1GDT A;  3E2D A;  3HD7 B;  4U3F G;  2KSE A;  4K3A A;  1FZG A;  3PHL A;  3K5B A;  3L73 J;  1LT9 C;  1KB9 D;  1NTK G;  3L71 D;  1RNI A;  3MHV A;  2KXP B;  1S2E A;  2JB0 A;  4LLH A;  5HGM A;  2IBZ E;  2MVU A;  3PLN A;  1YQ3 C;  3CXC O;  2FXO A;  1ZR4 A;  5CCG D;  4XA4 A;  2EG5 A;  1KIL C;  1P84 D;  3I56 P;  2LTE A;  2OYH C;  3H32 B;  3BAS A;  2NPS D;  2WSS H;  5GTI H;  3RGU A;  5GTH H;  2YO2 A;  1SQX K;  2PFX A;  4ZMD A;  3CX5 H;  1OW6 A;  2WPT A;  1T2K C;  2R5D A;  1CI6 B;  1FDM A;  2FAE A;  4C7N B;  3T97 B;  1H0T A;  3H1I E;  5DJU B;  1NVO A;  3G1I A;  1KTM A;  1JTH A;  3DPH A;  3EJB A;  2MD9 A;  1FC2 C;  1SQP K;  4GR2 A;  1J1E C;  2XZR A;  3G0V A;  2BUO A;  3B5N C;  2Q9I A;  3L75 G;  5DCK A;  1KB9 I;  1PIX A;  3NTN A;  1FZC C;  1JEK A;  2J58 A;  4NPF X;  1GTW A;  4EOT A;  4IOI H;  1P84 I;  3HTK B;  2KYV A;  3TYY A;  4N78 D;  2CNR A;  1KFN A;  2JJL A;  1L0N G;  1RE4 C;  3L73 D;  1N2D C;  2BCC G;  3I5C A;  1T6A A;  2H89 C;  2VLQ A;  5KP6 B;  5CCG A;  5AW7 B;  2LOL A;  3G4S P;  3OJA B;  1GXG A;  4YPC A;  3CME P;  2A06 E;  3SSU A;  2JEE A;  4LGD E;  2PY8 A;  1URQ C;  3L35 A;  3Q20 A;  2Y9Z A;  4HYT B;  2E76 C;  4ZKP A;  2XNX A;  1PGP A;  3CXH H;  2QJY B;  2WTY A;  2M5A B;  1HGZ A;  2PEN A;  2DGY A;  1NTK K;  5DJT B;  1Q2N A;  3L74 G;  4C46 A;  2POH A;  2QM7 A;  4TT3 H;  2M3E A;  2P10 A;  1LTI C;  1NO4 A;  3D6Y A;  3L72 E;  2AXC A;  3H1I J;  1N7S A;  3L4F A;  2P9X A;  4H44 C;  3A3Y B;  2B89 A;  1KZU B;  3DTJ A;  1LTJ C;  1ZRT D;  1K8A Q;  2N9B A;  1SP4 A;  3H1H G;  2XV5 A;  1E79 H;  5TIS H;  3LMO A;  4AYC A;  1LTB C;  2Q1K A;  3O6Q A;  1AA0 A;  1HY8 A;  3RK2 B;  1KQL A;  2K1A A;  1N73 A;  1MKM A;  5KKZ C;  3MZW B;  2KOP A;  5H2F E;  1XTC C;  4IL6 H;  1UNK A;  4H0L D;  1BXI A;  2LKM A;  2VLN A;  3NTE A;  1K73 Q;  1JB0 J;  2QSI A;  1SFC A;  1GU5 A;  2KG8 A;  1AVY A;  2WSE J;  1YTZ T;  3A7O A;  3FXD A;  3HE4 B;  3U43 A;  1U7J A;  4H13 D;  2EFJ A;  5AW0 B;  1S5L E;  2IBZ D;  2H88 C;  4OGQ C;  5AVU B;  3GG2 A;  3A0H E;  1M1J C;  1AUM A;  2N98 A;  1EMV A;  3WMM 0;  1Q90 D;  2MVV A;  1IJD B;  4PXH B;  2MR8 A;  3AE6 C;  5B5E H;  3RK2 D;  2KR5 A;  2XZ0 D;  1SQB G;  1FBM A;  2HFE D;  2W6J H;  1KLP A;  3CMA P;  1NH4 A;  2HPC B;  4L73 A;  4XFY A;  3H1I D;  3TDK A;  1S4X A;  1WMK A;  4L76 A;  2A45 I;  3NFQ A;  3WU2 H;  1K04 A;  3G9R A;  2K94 A;  2LF4 A;  2KGE A;  1G2C B;  4AQR D;  1LWU A;  2YO3 A;  2V7Q J;  4WY4 C;  2J59 M;  1LT9 A;  4JF7 A;  1BGY G;  1SQV E;  3AEB C;  1EZV E;  1PGQ A;  1ZN5 A;  3DS3 A;  4W80 A;  3TF5 A;  1DX7 A;  1NYH A;  2FBW C;  2Q5U A;  1JOC A;  3CX5 E;  2E75 B;  1KIL A;  2YNY A;  2KOQ A;  2LIU A;  5AVT B;  3AEE C;  3TNU A;  1L0N D;  1PP9 G;  1PPJ G;  2C9N Y;  1OXZ A;  1QL1 A;  1URQ D;  2BEZ F;  2YIU B;  2KOS A;  1RF1 B;  4BPH A;  1HWT C;  2E74 B;  2A06 D;  3G21 A;  2KOG A;  1E5W A;  2K0Y A;  2PAJ A;  3GHG B;  4DZO A;  4RJT A;  3RK3 E;  2MY5 A;  3VTP C;  2ROQ A;  1BE3 G;  1ZW0 A;  2WSF H;  1BSH A;  2CWO A;  5AW9 B;  1FZC A;  2E75 D;  3MGE A;  2JWD A;  2W90 A;  5BU8 B;  1SQQ K;  2JBG A;  2WT7 A;  3CCU P;  3OA7 A;  2JWA A;  2M3B A;  1OMI A;  5KLV G;  2P7J A;  2KNC B;  1DH3 A;  1M1K Q;  1BDC A;  1ZV8 A;  2E74 D;  1EXJ A;  5EFW B;  1RE4 A;  5AVV B;  4U0F A;  2D2C C;  4U7J A;  1A8O A;  1BGY J;  1SQV J;  3CXH E;  3HRN A;  1L4A B;  5HGL A;  4KHX A;  4BRY A;  1FR2 A;  1URQ A;  1ZME C;  4U0B A;  1HGV A;  3L71 G;  1J1D C;  1SVF A;  4WBA A;  1SS1 A;  5B66 E;  1LTA C;  1PEU A;  2KS1 B;  2VSQ A;  1JUN A;  4F37 A;  2WWW A;  3B71 A;  3Q5P A;  4R4L A;  2OTJ P;  1JO5 A;  1JY2 P;  2ZYG A;  3G6E P;  1A02 F;  3GF3 A;  3KHU A;  3CC7 P;  5CCG C;  4COP A;  3DS0 A;  1RO0 A;  3L37 A;  2N1T B;  1VQ5 P;  2ZXX A;  3PH0 A;  2NPS C;  1L4A D;  3I55 P;  5E79 H;  2VLP A;  2P1J A;  1IFD A;  1G1J A;  2R44 A;  5JPA A;  3AE7 C;  4IL6 E;  1VHN A;  4I1L A;  3MTU E;  2FYU G;  2FHS C;  2JU1 A;  1YI2 P;  1YJN P;  3V4Q A;  2QJP B;  1MUU A;  1U7M A;  3MUD C;  1ZNV A;  5AW3 B;  1OVR A;  1PV3 A;  2W8Z A;  4R0M A;  2QA4 P;  1Y47 A;  2L4B A;  5BS1 A;  1KQS O;  1BCC E;  4R4M A;  2LR2 A;  3RK3 B;  1BGY D;  1SQV D;  1VQM P;  1RO2 A;  1VQO P;  4WYM A;  2KOO A;  3HE5 A;  2N1T D;  3H1J G;  1WRG A;  1NTZ E;  1FZF A;  5B5E E;  1VF5 B;  3CX5 D;  1GXH A;  3LIE A;  1LT1 A;  3MP7 B;  1S5L X;  1PFI A;  4PD4 H;  3WBH A;  3CL3 D;  2ZVO B;  3VP9 A;  2K3R A;  1CW5 A;  1PPJ D;  3V5B A;  3W67 A;  5AVW B;  3WUT A;  1QX8 A;  2P67 A;  3CCQ P;  1HF9 A;  2FQ2 A;  2RH0 A;  2FYN C;  2HR3 A;  4PV1 D;  4L74 A;  2QRX A;  2E5T A;  3CC4 P;  1H0T B;  1ACP A;  4YXD C;  5H2F H;  3RK3 D;  1RY3 A;  1VQL P;  5HVC A;  1BE3 D;  1UIX A;  4WY4 A;  1SQP E;  1MZ8 A;  4M0I A;  2WPR A;  4L75 A;  1M56 D;  5AVZ B;  5HGO A;  3FGA D;  4D6T E;  1EDJ A;  1S5L H;  2FYU J;  3CX5 I;  3TGU E;  2D2C D;  5KLV D;  3A0H H;  1YIJ P;  3DS2 A;  2C9L Y;  3SWK A;  3QWO C;  1IK9 A;  1JY3 O;  2KG9 A;  2LXC B;  3Q2Y A;  1BCC J;  2HOD B;  2CPB A;  3G1G A;  2KB7 P;  1L0H A;  3CXH D;  1NWQ A;  1VKU A;  3V6I A;  1LWU C;  3H1J J;  1NTZ J;  2IYP A;  2QJY C;  3IF4 A;  2KSJ A;  4N3Y B;  1BDD A;  3DS1 A;  2PRR A;  2FKW B;  3RL0 B;  4H0L C;  2E1M A;  1EDI A;  2LPK A;  2WPS A; 
#chains in the Genus database with same CATH homology
 2P9X A;  5BS2 A;  5HGL A;  3DTJ A;  2Z46 A;  3WBH A;  3G1I A;  4U0B A;  3DPH A;  3CCJ P;  3DS3 A;  3HYB A;  1K8A Q;  3CD6 P;  1YHQ P;  2XV6 A;  4GR2 A;  1S72 P;  2PEI A;  2PEK A;  1E6J P;  3G0V A;  2BUO A;  3H47 A;  2JYG A;  2L6E A;  3CCS P;  1PEU A;  5DCK A;  3CCQ P;  3CPW O;  3DS4 A;  2Z44 A;  4GR6 A;  3RG6 C;  2XT1 A;  1EIA A;  1QVG O;  3VRL C;  2PEQ A;  3CC4 P;  5I4T G;  1K30 A;  2OTJ P;  3G28 A;  3G6E P;  1M6N A;  2OAR A;  2KOD A;  3NTE A;  4U0C A;  2PEJ A;  2Z45 A;  5F2N A;  1JJ2 O;  1VQL P;  1K73 Q;  4U0D A;  1BAJ A;  1KC8 Q;  1D1D A;  4QNB A;  3CC7 P;  4PH0 A;  5F2O A;  4COP A;  1M6E X;  3DS0 A;  3G26 A;  1QVF O;  1RO0 A;  3G21 A;  3HZQ A;  4M0I A;  1PEQ A;  3LRY A;  2QEX P;  1VQ5 P;  1K9M Q;  2BHV A;  5HGO A;  1VQN P;  2JO0 A;  5HGN A;  1EOQ A;  3G71 P;  1M74 A;  2EFJ A;  3I55 P;  3CCE P;  4IPY A;  3CC2 P;  3E2D A;  2M8N A;  4U0E A;  1YJ9 P;  3CCL P;  5JPA A;  4PH1 A;  4U0A A;  1AUM A;  3CCV P;  3G4S P;  1ZMB A;  1YIJ P;  3CME P;  4COC A;  3DS2 A;  1YJW P;  2CWO A;  1YI2 P;  1YJN P;  1Q7Y Q;  1VQ8 P;  2PY8 A;  3B5I A;  3MGE A;  1VQK P;  3Q20 A;  2M8P A;  4XFX A;  1KD1 Q;  1RNI A;  1YIT P;  1Q86 Q;  1VQ4 P;  1IUQ A;  1A43 A;  1Q81 Q;  3CCU P;  5HGM A;  3OW2 O;  2QA4 P;  1N8R Q;  3H0D A;  2PEM A;  3P05 A;  4XRO A;  1PEM A;  5BS1 A;  1W2B O;  3CXC O;  1PEO A;  1KQS O;  1VQP P;  2EG5 A;  2JYL A;  3CCR P;  1M90 Q;  2EIA A;  3G1G A;  1NJI Q;  2PEN A;  3CCM P;  3I56 P;  2BQ1 E;  3CMA P;  2DGY A;  1VQ9 P;  1M1K Q;  4XFY A;  1VQM P;  1RO2 A;  1VQO P;  3M1M A;  2ONT A;  4WYM A;  3DS1 A;  4XFZ A;  4U0F A;  1Q82 Q;  1VQ7 P;  1A8O A;  3DS5 A;  3G29 A;  2LF4 A;  5F2K A;  2PEO A;  2OTL P;  2XXM A;  2E1M A;  2M8L A;  1QRJ A;  1VQ6 P;  4XRQ A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...