3CCLP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cclP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cclP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cclP02
1VQKP 1K8AQ 1VQ4P 3CC7P 1Q81Q 3CMAP 1JJ2O 3CCQP 1QVGO 3CC4P 1YJWP 2OTLP 1VQOP 3I55P 3G6EP 3CCVP 1S72P 1Q7YQ 1N8RQ 1KQSO 1YHQP 3CCUP 3CCRP 3CD6P 1VQ9P 1VQ7P 3CMEP 3CCSP 1YIJP 1K9MQ 1QVFO 1Q86Q 1VQNP 1YITP 1W2BO 3G4SP 3CCJP 1VQ6P 3OW2O 1VQ5P 1YI2P 1YJNP 1VQMP 1K73Q 1M1KQ 1NJIQ 2QA4P 1VQPP 3CXCO 3CCEP 1KC8Q 3CCLP 1VQ8P 3I56P 3G71P 3CC2P 2OTJP 2QEXP 1VQLP 1YJ9P 3CPWO 3CCMP 1KD1Q 1Q82Q 1M90Q
chains in the Genus database with same CATH superfamily
1OR5A 1NOHA 1GU5A 3CC7P 2QSIA 5KLVK 1S9KE 3GZLA 1YTZT 1W2EA 2AXTH 1U7MA 2HR3A 2KS1B 1GZLA 3II6A 3L75E 3L37A 3G4SP 1BGYD 2H8PD 1KILA 1R5SA 1MFTA 1HGZA 2N50A 2N9YB 4QKOA 4BPHA 3D71A 5AW0B 3CC2P 1SQPG 3H6PA 4WB4A 4GR6A 5F2KA 2KNCB 2B9BA 2GUVA 5AW3B 3MTUE 2OTLP 5HV8A 4GR2A 2IZ1A 1AJYA 1NQ4A 1P84I 2FQ2A 3U59A 2Z4EA 2MY5A 4GKGA 2XT1A 1L4AA 1ZV8A 1FDOA 4EIJA 4YXWH 2JEEA 4PD4E 4KJMA 5AW2B 5AVRB 1L4AB 1KILD 2X2BA 4K3AA 2BEQD 2KGEA 2J58A 3L75J 3GZMA 3VN0A 1NTZD 2KOGA 4OVNF 3GHGA 2Y9YA 4GOEA 2G8YA 2K0DX 1ZMEC 1YHQP 1EXIA 3WU2H 3VMAA 1DV5A 2IBZE 3L35A 2OYIB 4B86A 1Y9BA 5AW9B 1EDIA 1EIAA 1N73C 1KB9E 1J1DC 1YJ9P 2Z5IA 1YBKA 2O1JA 3G6EP 1LJ2A 1AYIA 4QNBA 1U57A 3CCLP 4JPZB 2AEJA 1JCDA 1Q82Q 3LMOA 1OW7A 3GHGC 3L73G 1PPJD 1ZN5A 3JCUE 3L74J 5CCGD 2IPPA 1LTBC 2AFDA 3B5NB 1JM0A 1RF1A 5BS1A 3Q2YA 2JU2A 4QMAA 3T97B 1CW5A 1SQQE 2P9XA 1BCCJ 1KILB 3DS1A 4BWNA 2XKMA 3QWOC 4BPGA 5C39A 2QJKB 5F2OA 4L73A 2ZXEB 1FS0E 3RK2D 2VLPA 3RBXA 3PRJA 4IFFA 3SWKA 5EJDA 1DD3A 2BASA 2QJYC 1KD1Q 1BSHA 1LGHB 2A06E 1J1EB 1M57D 4XFYA 2PP6A 1IK9A 5AW1B 4U3FE 3N7NA 2Q3EA 2Q5UA 2Z46A 2K5XA 2KODA 2QIWA 1JY2N 5KLIC 2PEJA 1HTLC 4K35A 3FWNA 5APXA 1IMPA 3LRYA 1SQXK 1IFJA 2FYNC 1URQA 1PZQA 1CSBA 3G3ZA 1KORA 1VQOP 2GDYA 3VP9A 1KILC 4H2WC 2K3RA 3AE6C 1DEEG 1LP1A 4DJGA 1AFOA 4DZOA 1JO5A 2LXBA 3SFDC 4H2YC 1NU1J 2M0BA 3KDPB 4YPCA 2HG5D 2P58A 2M3EA 1JUNA 4U3FJ 4C46A 2H88C 5CMZA 3RL0g 1JY3O 2XZRA 4PD4D 3FWLA 3KYQA 3MGNA 4EI2A 3G9RA 1HWTC 1SQPK 5TISH 3BVHA 3VMZA 3WUVA 3H1IJ 3V2RA 4H0LC 5GTIE 1AA0A 1NTMD 1Q81Q 1T2KC 3CCQP 3G1IA 1RNIA 1N8RQ 1EDKA 3LW5H 3DPHA 2CPSA 1L2PA 1AVOA 5HGMA 3NTEA 1XTGB 3E1IA 3KXDA 2ZYDA 1SQVG 2VRSA 1WT6A 3L73J 4XFJA 1IJDB 5APWA 4JF7A 2W6AA 4PH1A 1GTWA 4H0LD 1A02F 3CC4P 5APQA 1VF5C 3UIAA 1L0LK 3E1RA 3HRNA 1FZCC 2WSCJ 1JY2O 1RE3A 1NU1G 5HGLA 3PHLA 2XZ1C 3A3YB 4IFDK 3LIDA 1HF9A 4A7PA 1IFMA 2CPBA 1SP4A 1X22A 2FXPA 3CCUP 3M9BA 4COCA 4KHXA 2SPZA 1E6JP 3KPEA 1WMKA 3BCCE 1JOCA 2KR5A 2Z5HA 2PNGA 3I56P 4R0MA 3RG2A 2N9BA 5AW7B 3B4QA 5KP8B 1T3JA 4PD4H 5HGOA 3TYYA 1M6EX 5AW4B 3VMXA 1EZVD 2WPVB 1HH0A 1H88A 2E74D 1FZCA 3B5NC 3CLQA 3TGUG 4HJGH 4F37A 2B88A 1UJZA 2E75B 4WY4A 3L74E 1ZLLA 4XFXA 3AEDC 2AXCA 3V5BA 4LLHA 1M8OB 1KB9H 2E76B 3M0DA 2EG5A 1YITP 3AE1C 1EXJA 3OW2O 2P10A 4IFMA 3EJDA 3V2NA 2XU6A 1PEOA 4U0FA 3LIEA 3SWFA 2M5RA 1NTKK 2KYVA 2N6ZA 1LT9B 1G1JA 1MZ9A 1DX7A 5E79H 2K94A 1S72P 2W27A 1KB9I 5GTIH 3M9QA 3GLMA 3HTKB 4UB6H 1EDLA 5CCGC 1VF5B 2XNDH 5AVSB 3GF3A 3K5BA 4NEOA 3AEFC 2C9NY 1NO4A 2WSFH 3RK3E 2WTYA 3M0DC 4H44D 2KG8A 3S9OA 1KYOH 5B5EE 1YTZI 2XNXA 1PP9D 2JWDA 2KLVA 1E5WA 4D6TD 4U0BA 1DD4A 2QM7A 2KZJA 1NTZG 1RF1C 3V4WA 5HVCA 3HYBA 2E74C 2FQ1A 2J5UA 3H1HE 4IOIH 1ZOYC 2Y0CA 3TNUB 2JKVA 1RF0C 3PLNA 2KNCA 3P05A 1MV8A 2EFJA 3L70E 5KJ7D 2YO2A 2AVAA 4DCKA 4HKZH 1RE3C 1NTMK 2YKQA 1L0IA 2Y0DA 2LKIA 1SFCD 1VQ5P 3P7KA 1VF5D 4OWFA 1SQVJ 2A45G 3CXCO 2N5IA 2R3CA 2MVUA 1VQ8P 2CK3H 4PV1B 2N6YA 3H4EA 5H2FE 3H1LJ 2DNWA 1GL2C 3L74G 2R3SA 2M5AB 4R4MA 3H0DA 3TGUE 4AUWA 2HLOA 3HUSB 1PFIA 3GJNA 3GF7A 1LWUC 1K05A 2OTKE 3L71J 1KC8Q 5CHXA 1ZR2A 2M8PA 3HTKA 1A02J 4M3LA 1EZVG 2POHA 2QVAA 1DEBA 3D6ZA 1TU3F 2Q9IA 1KV4A 2QG4A 5AVWB 1HQBA 1HBWA 2DW3A 2R5DA 5DCKA 3L72D 2GZJA 3H1IG 2Z45A 1IFIA 2GA1A 2JYLA 3A5TA 4C7NB 2M8RA 1EZVE 3RK3B 1JY3N 1PEQA 1KILE 1G1IA 2P1JA 5APTA 2FKWB 3A0BH 5CJ0A 2NPSC 3OJAB 3GHGB 4IZ6A 4H44B 1GD2E 2ZYAA 1OW6A 5KAIH 1MKMA 1N7SC 3ABVC 1YI2P 1YJNP 3U43A 2OYIC 4HKGA 1ZP0C 2GZGA 2N98A 1X3OA 3DS2A 5KTBA 2MD9A 1A8OA 2OARA 3G1GA 2FBWC 2FAEA 3MP7B 1FZEA 4D6TG 2BEZF 3HD7A 3AEGC 2BHVA 1VQ6P 4WBAA 3HE5A 1U7JA 2A06D 2WPRA 3MZWB 3L75G 1NKNA 2JBGA 5CZDB 2OTJP 4L74A 3V2PA 1NTZE 3BATA 3G26A 2AEMA 3AE3C 5KLVE 1KYOI 3DS4A 2NZ2A 3JSVC 3A0HE 1YIJP 2EHTA 2R5BA 1VQNP 2V7QH 3A2AA 2FYUG 3M0AA 2E42A 1X79B 1YQ4C 3GKLC 1USDA 4H13C 1JY2P 1QGKB 3OA7A 1FJKA 1NYHA 3S1KA 1PP9G 1ZXGA 3AEEC 3CD6P 1GL2A 1L0LJ 2K1AA 3G29A 2YMKA 2O01N 5KLVJ 3Q1MA 2A45H 2BCCE 2FXMA 3CWBJ 1EOQA 3PTZA 1OX3A 1P84H 1E79H 2W6JH 1K30A 1WRGA 2HODA 2PEOA 2GZFA 4Y99B 5KP7B 4BXLA 3CCVP 1Q7YQ 4TT3H 4I1LA 1LNQA 2IYPA 5BVZA 5GTHE 1URQC 2WSFJ 3A0HH 2OYHC 2KZIA 2Q7CA 5AVYB 3RK2C 1Y8AA 1N2DC 2HPCA 2HPCB 1AVYA 2K88A 3MIWA 2JGPA 2I1JA 3AE4C 5B66E 2KGAA 2LKMA 3HE4A 2D2CC 3T97A 3CX5H 1NU1K 4NPDA 5AVXB 3F5HA 3MGEA 1PEUA 1RQUA 3CCRP 1AQ5A 2KSJA 2C0XA 2CQ8A 1HJ0A 2B87A 2VLOA 3DS0A 4H13D 2KW2A 4H2XC 1SQXJ 4GIFA 1SQBD 1NAYA 1VPCA 2PGDA 3CXHE 1QEXA 3H1JG 3H1JD 4D6TJ 3KHUA 3L71E 2KP8A 1DNYA 2K37A 2WSEJ 1GL2D 3L70G 2OYIA 1S2EA 3NMDA 2N1TD 3TGUD 3KZIH 1FAVA 1H89A 2OQQA 4CA3A 2GZEA 5BU5A 5K5GB 3HE5B 3CX5I 1L0LE 2KUBA 3V4QA 1F80D 2KWLA 2W6BA 2CWOA 2PY8A 1PIXA 2EIAA 1ZR4A 3RG6C 3G21A 4RO0A 1CEIA 4N3YB 2YKPA 3B5NA 3L70J 1SQVE 2FYNB 2BCCD 2WMMA 1GK4A 1JB0J 1NTZK 2QM8A 3HD7D 3BCCG 4PD4I 2RN0A 2JWAA 3RK2B 2DGYA 3EFGA 2EHSA 1RQVA 3SFEC 1UIXA 4PV1D 3A7OA 3RGUA 1YYCA 1Y47A 2QE7H 3IAOA 2KB7P 2WPTA 1KN7A 3WUUA 1RE4C 2B89A 1CI6A 4TLFA 2ZT9D 3H1KG 5DJTB 2LL8A 3V2QA 1ACPA 3CPWO 2K92A 1N7SA 1N7SB 2FACA 3RL0B 3M91A 4IL6E 4ASWA 2IFMA 3CMAP 1RF0A 4HYTB 2O1KA 4I7ZC 3MUDA 3I55P 1PGOA 3GMAA 5KLVD 4ASVA 3BCCD 5CCHD 2YNYA 1GW4A 4LGDE 2UWJE 2KG6A 3AEAC 1LP1B 2LF4A 4UB8E 2AFEA 5CBNA 2WITA 3H1KE 3LW5J 2YIUB 3L71D 1MZ8A 1LT9A 1KQGB 3HUSA 1SQVD 2E74B 1AQTA 1T3UA 2BUOA 1JCCA 3PJSK 1USEA 1ZMBA 2ZT9C 3B8EB 4GODA 3TDKA 2I1KA 4NPFX 1BGYE 1LTTC 2M8LA 2GUSA 4WYMA 1L0NK 4LC1A 5APSA 3L73D 3MUDC 3IF4A 1KZUB 1J1DB 4XROA 2ITAA 1W2BO 2WWWA 2L6EA 5KJ7A 3DTJA 2XDJA 3JCUH 3F89A 1SQVK 3FGAD 4D6TE 1A43A 1L0NE 2R32A 1HY8A 3H47A 2H43A 1KQLA 3H32A 2Q1KA 3L36A 1SQXG 1PL5A 3B4SA 3SWYA 2L22A 3L4FA 2N5HA 2KSEA 5APYA 4EDFA 5EW5E 2M8NA 5KJ7C 3NTNA 1UIIA 1LTAC 4WWIA 1PGJA 1JY3P 3WU2E 2YKOA 3L72J 3C8VA 1N7SD 3TGUJ 1M1JA 2XV5A 3AE7C 3H1KD 2PEKA 2ZXXA 2L91A 2NO8A 5B66H 2KOOA 2D2CB 4L76A 3DS3A 3CMEP 1L0NJ 4RESB 4IPYA 2YIUC 2LTEA 1FBMA 4OGQB 3L73E 2FFDC 2AF8A 2LIWA 4U7JA 3AE9C 1CI6B 5KAFE 1H8AA 2PEIA 2OYHB 1RH5B 1HGVA 1SQBG 2O3JA 1BDDA 1RO2A 3H1HJ 3V6IA 1E0HA 3VOPA 1BDCA 1KMIZ 3G28A 2Q6QA 1BGYJ 1GU4A 4XRQA 2IBZG 2K93A 2JU1A 4Z1MH 5M1BA 1VQKP 1PP9J 2IDBA 2FYUE 1SQPE 2IFNA 1MUUA 2PFXA 1SVFA 1RF1B 3FXDA 1IC2A 2QRXA 1VKUA 1GMJA 2W90A 5EFWB 5KLVG 2PRRA 4KT0J 2HODB 1PPJG 2IBZI 2PEQA 5KAIE 4GDOA 3VP8A 2E1MA 2XV6A 4H13B 2L0QA 1FZBA 2FYZA 1FDMA 1RHZB 2D2CD 1KQFB 2JYGA 2N1TA 4DOJA 3TK1A 1VQ9P 2Y0EA 1KFMA 3VYIA 3KQGA 4YXDC 1ZNVA 1OVUA 2LOLA 3CCJP 4PJ0E 1NAFA 3M06A 3GW6A 2N1TB 2GYKA 5CJ4A 1PP9E 2HYNA 2FYUJ 2KGCA 4YTPC 1SQQG 2W8ZA 1IK7A 2JP3A 3H1IE 1EDJA 4Y99C 7CEIA 2FFDB 1SQBJ 1N7LA 2FHSC 2L5GB 2ERHA 4C7RA 1QLED 1M1KQ 2XXMA 5AVQB 1NTME 3EJEA 4PH0A 2O01H 1KLPA 1IZNB 2FVFA 3RBZA 1KFNA 2Y9ZA 1BAJA 3CXHI 1UNKA 1SQQJ 1YJWP 5KKZC 3U1CA 2WT7A 4JYBA 2QJPC 3L72G 1LTIC 1BCCE 3CWBE 1LTJA 4DG9A 1M1JB 1GL2B 4RJTA 4PV1C 2WQYC 5KLIB 1SQBE 5AVZB 1PEMA 1DH3A 1Z6MA 1Q90D 1RY3A 4U0CA 1GXGA 3L74D 2WVRA 2J59M 2W83C 2ZFCA 1L0LG 4MN4C 3CX5E 1J2JB 1ZRTE 1Z56A 4UB8H 2JO0A 1URQD 2CGQA 2JAZA 1NJIQ 2GDXA 1FC2C 5BS2A 2IYOA 1FZAA 3OAKA 5BU8B 1AF8A 4ZMDA 4PJ0H 1IFNA 1VQ4P 3KZIE 2JB0A 1QVGO 1OVVA 2K9YA 4OH8B 2P2UA 1X8YA 1K9MQ 5GTHH 1G2CB 3WUTA 1D1DA 1OW8A 3HE4B 1IFPA 2KOSA 1BXIA 1FJPA 3CI9A 3H1HD 4W7YA 1P84E 2H89C 1S1CX 1SQQD 2E5YA 4R4LA 3L70D 1IMQA 1PGQA 1HVVA 1RO0A 3H1LE 4M0IA 5I4TG 3Q3DA 1K73Q 3AECC 2ZAEB 1OWAA 2OGUA 3RL0D 2MF4A 1OZHA 3GG2A 2ONTA 1CZQA 1URQB 1VQ7P 2K2QA 1VQMP 2MR7A 1D7MA 3MHVA 4IL6H 2LPKA 2V7QJ 1R5LA 4BRYA 2KOPA 1OFCX 3TNUA 2JQ4A 2QJKC 3RL0C 3BRTB 2IBZD 2QNWA 4I7ZB 1NTKD 4ZKPA 2FYUD 2PEMA 3M9HA 3WMM0 2QJYB 5L8RJ 2AEFA 3VRLC 5E79E 3HD7C 3BCCJ 2NPSA 1S5LX 1BSNA 1L0LD 3EQ2A 1AV1A 5APUA 4ZNCA 4AYCA 1BE3E 2CNRA 2HFED 3E7KA 2WSEH 1HJBA 1LT9C 1LWUB 1H0TA 1M7LA 4W80A 4EOTA 2NPSB 1HUCA 2FYUK 2E75C 3EWKA 3H1JE 3BASA 1NTKE 1SLQA 3NXSA 3TSIA 2P67A 2IZ0A 1BCCG 3EFFK 1FOSE 4XE5B 2OYOA 1EC5A 2KK7A 2QEXP 2FQ0A 3A0BE 1KB9D 3AE5C 4JYCA 3H1HG 1KYOD 1L4AD 1SFCA 4U0EA 2IX7C 3H32B 1M74A 1NH4A 1X0TA 3HD7B 1T8ZA 1Q2NA 2ZYGA 1SFCB 3CCEP 2YXRB 2R44A 1L0ND 1LTJC 3CX5D 3RK3C 5B5EH 4PWVB 3AE8C 1OIPA 3H1KJ 1L4AC 1S5LE 4HB1A 5AW5B 4PXHB 3QH9A 4JBZA 1GXHA 3CXHH 1QL1A 2JDIH 3TF5A 3JC22 1DIPA 2NPSD 3D6YA 1SQXE 4BPFA 2YMYA 5H2FH 1EZVI 3CWBD 5CCHA 2LMLA 2MVVA 1BE3D 2P7JA 2L4BA 2ROQA 4OGQD 4XFZA 1QX8A 2CG5B 1FZGA 3CL3D 4JQ0D 1IO4A 3VTPC 2FADA 1S3JA 2MJZA 1M56D 2K9JA 3H1LD 1LTSC 3P8CD 3O6QB 3G0VA 2KLUA 2E75D 3L71G 3Q20A 3IFMA 1N86A 1AUMA 1SQPJ 4OGQC 3D70A 4EYYQ 2M3BA 1L0HA 4BRYB 2E5TA 2E76D 1JMMA 4N78D 2K0YA 3P8CE 4HH2A 5KKZB 3U1AA 1T8KA 1LWUA 1NGMB 3VMYA 1PGPA 1SFCC 3B5ND 1VQPP 2JR8A 1EMVA 3W68A 1FU1A 3CCMP 2BCCJ 1LT1A 4WY4D 1GDTA 3AEBC 1G2CA 4WVZA 5CCHC 4I6MC 2LR2A 3ITKA 2LIUA 1T2KD 1FR2A 5F2NA 3W67A 3CE7A 1VDFA 2BQ1E 2KIKA 3H1LG 1BGYG 3H25A 3ZDMA 2JO1A 3N4XA 1BE3J 4U3FD 4U3FG 3Q5SA 2GM4A 1JJ2O 3B5IA 4WY4C 2KI7B 4Y28J 2K0XA 2VSQA 5KAFH 1QVFO 1OVRA 2QJPB 4N6JA 2A45I 2N1TC 3Q5PA 1NHLA 1KYOE 1NTZJ 2E43A 2V4HA 3SSUA 2Q3IA 2B87B 1SQXD 5CBOA 3EJBA 1XTCC 2AXTE 2WZ7A 5HGNA 5TISE 1JTHA 3R2PA 1K8AQ 4U0AA 3I5CA 3H1ID 1IFDA 1N73B 2FVEA 3Q5RA 2LXCB 4H0LB 1Q86Q 1JTHB 3PH0A 1QRJA 1EQ7A 1SQPD 3E2DA 4AQRD 2YXQB 4GT1A 1LTJB 1GW3A 1X9VA 4IL6X 2VLQA 1R8EA 4DT0A 2FFDA 2GDWA 1VHNA 1KQSO 3P8MC 4W7ZA 2O01J 1FZCB 2JJLA 4NPEA 2KS1A 2Z44A 1OXZA 5JPAA 3C9IA 4U0DA 2GZIA 1T6AA 2KORA 2YO3A 1GK6A 1YQ3C 4WY4B 3B71A 3CWBG 4CPGA 3P32A 2NRGA 2KXPB 2VLNA 3H1JJ 5AVUB 5KP6B 3DS5A 1NU1D 2WPSA 3BRVB 5AVTB 2FY8A 1K04A 2KGDA 4COPA 2WSCH 1L0NG 4ZKUA 2RKLA 1GPJA 1NTKJ 3MD0A 3FXEA 1M90Q 1OMIA 1JNMA 2KG9A 4XA4A 2WT7B 3WBHA 1FDIA 1IUQA 3NY7B 3HUSC 5AW8B 1NU1E 3CCSP 3HZQA 1P84D 3NFQA 2RH0A 3O8ZA 2XZ0D 2ZVNB 2QA4P 1BE3G 1QL2A 3CXHD 1VQLP 4UB6E 1S5LH 1LTGC 4L75A 1RE4A 2I8DA 3IR9A 4RKUJ 3L75D 1SS1A 3USSA 3O6QA 1FE6A 2RMZA 1PPJE 1BCCD 4O9BA 3PP5A 5AVVB 2OYHA 1N73A 3R4YA 3M1MA 1JEKA 2H7HA 2WPQA 2BCCG 3AE2C 3C1LA 2FVAA 1NKZB 3G71P 2K9JB 1FOSF 4GOFA 1M6NA 1NTMJ 4I2LC 1PV3A 1NWQA 5CCGA 3L72E 1ZW0A 5AW6B 1JMBA 2C9LY 2PENA 2ZVOB 5APVA 2FXOA 1MFZA 4N78E 2ZT9B 1H0TB 1VL2A 2G3AA 2KOQA 4C7NA 1J1EC 1SQQK 1NTKG 1NVOA 4H44C 1ZRTD 2ZJSE 2MR8A 1KTMA 4UHPB 1S4XA 3FX0A 2L9FA 1W5CE 1S9KD 1NTMG 2M5AA 4MRTC 5TJHA 2E76C 1SQBK 2PAJA 2WSSH 5DJUB 2A06G 1FZFA 1M1JC 3IN6A 2C0WA 2MKVA 3S4RA 3RK3D
chains in the Genus database with same CATH topology
2PEKA 1EOQA 1VQ4P 5HGOA 3CC7P 2LF4A 1M6EX 4U0BA 1K30A 1QVGO 2PEOA 3WBHA 3CCVP 1Q7YQ 3G0VA 1IUQA 2CWOA 3DS3A 3CMEP 3CCSP 4IPYA 1K9MQ 3HZQA 3Q20A 3HYBA 2PY8A 3G4SP 1AUMA 1YI2P 1YJNP 1D1DA 2EIAA 1M1KQ 5BS1A 2XXMA 2QA4P 2P9XA 2BUOA 4PH0A 3RG6C 3DS2A 5HGNA 3CC2P 3G21A 4XFXA 2QEXP 1VQLP 3P05A 3DS1A 1ZMBA 2PEIA 1A8OA 2OARA 2EFJA 4GR6A 5F2KA 3G1GA 1BAJA 2M8LA 1K8AQ 4U0AA 4WYMA 1Q81Q 3CCQP 5F2OA 3G1IA 1RNIA 1YJWP 2OTLP 1RO0A 1RO2A 4GR2A 4U0EA 1N8RQ 3DPHA 3G28A 4XROA 1M74A 1Q86Q 2XT1A 2BHVA 2EG5A 1QRJA 4M0IA 5HGMA 5I4TG 1YITP 1W2BO 3M1MA 3OW2O 1VQ5P 1K73Q 1VQ6P 2L6EA 3E2DA 2DGYA 3DTJA 3NTEA 4XRQA 1VQPP 1PEOA 4U0FA 3CXCO 3CCEP 1VQ8P 3G71P 2OTJP 3H4EA 3CCMP 1KD1Q 1M6NA 1A43A 3MGEA 1VQKP 1PEUA 3G26A 4PH1A 3CC4P 4XFYA 3H0DA 3DS4A 3H47A 1S72P 2PENA 1KQSO 1YHQP 2ONTA 3CCRP 1VQ7P 1PEQA 1YIJP 2Z44A 5F2NA 5JPAA 1VQNP 4U0DA 1PEMA 1VQMP 3DS0A 2BQ1E 2Z46A 5HGLA 2KODA 1KC8Q 2PEQA 4U0CA 2PEJA 1EIAA 2M8PA 1YJ9P 3CPWO 2XV6A 2E1MA 3LRYA 3CMAP 2M8NA 3B5IA 1JJ2O 2JYGA 1VQOP 3I55P 3DS5A 3G6EP 3CCUP 3CD6P 1VQ9P 2PEMA 4XFZA 4COCA 1QVFO 2JO0A 3VRLC 4COPA 3CCJP 5DCKA 1E6JP 3G29A 1NJIQ 4QNBA 2Z45A 5BS2A 2JYLA 3CCLP 3I56P 1Q82Q 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK P;  1K8A Q;  1VQ4 P;  3CC7 P;  1Q81 Q;  3CMA P;  1JJ2 O;  3CCQ P;  1QVG O;  3CC4 P;  1YJW P;  2OTL P;  1VQO P;  3I55 P;  3G6E P;  3CCV P;  1S72 P;  1Q7Y Q;  1N8R Q;  1KQS O;  1YHQ P;  3CCU P;  3CCR P;  3CD6 P;  1VQ9 P;  1VQ7 P;  3CME P;  3CCS P;  1YIJ P;  1K9M Q;  1QVF O;  1Q86 Q;  1VQN P;  1YIT P;  1W2B O;  3G4S P;  3CCJ P;  1VQ6 P;  3OW2 O;  1VQ5 P;  1YI2 P;  1YJN P;  1VQM P;  1K73 Q;  1M1K Q;  1NJI Q;  2QA4 P;  1VQP P;  3CXC O;  3CCE P;  1KC8 Q;  3CCL P;  1VQ8 P;  3I56 P;  3G71 P;  3CC2 P;  2OTJ P;  2QEX P;  1VQL P;  1YJ9 P;  3CPW O;  3CCM P;  1KD1 Q;  1Q82 Q;  1M90 Q; 
#chains in the Genus database with same CATH topology
 1OR5 A;  1NOH A;  1GU5 A;  3CC7 P;  2QSI A;  5KLV K;  1S9K E;  3GZL A;  1YTZ T;  1W2E A;  2AXT H;  1U7M A;  2HR3 A;  2KS1 B;  1GZL A;  3II6 A;  3L75 E;  3L37 A;  3G4S P;  1BGY D;  2H8P D;  1KIL A;  1R5S A;  1MFT A;  1HGZ A;  2N50 A;  2N9Y B;  4QKO A;  4BPH A;  3D71 A;  5AW0 B;  3CC2 P;  1SQP G;  3H6P A;  4WB4 A;  4GR6 A;  5F2K A;  2KNC B;  2B9B A;  2GUV A;  5AW3 B;  3MTU E;  2OTL P;  5HV8 A;  4GR2 A;  2IZ1 A;  1AJY A;  1NQ4 A;  1P84 I;  2FQ2 A;  3U59 A;  2Z4E A;  2MY5 A;  4GKG A;  2XT1 A;  1L4A A;  1ZV8 A;  1FDO A;  4EIJ A;  4YXW H;  2JEE A;  4PD4 E;  4KJM A;  5AW2 B;  5AVR B;  1L4A B;  1KIL D;  2X2B A;  4K3A A;  2BEQ D;  2KGE A;  2J58 A;  3L75 J;  3GZM A;  3VN0 A;  1NTZ D;  2KOG A;  4OVN F;  3GHG A;  2Y9Y A;  4GOE A;  2G8Y A;  2K0D X;  1ZME C;  1YHQ P;  1EXI A;  3WU2 H;  3VMA A;  1DV5 A;  2IBZ E;  3L35 A;  2OYI B;  4B86 A;  1Y9B A;  5AW9 B;  1EDI A;  1EIA A;  1N73 C;  1KB9 E;  1J1D C;  1YJ9 P;  2Z5I A;  1YBK A;  2O1J A;  3G6E P;  1LJ2 A;  1AYI A;  4QNB A;  1U57 A;  3CCL P;  4JPZ B;  2AEJ A;  1JCD A;  1Q82 Q;  3LMO A;  1OW7 A;  3GHG C;  3L73 G;  1PPJ D;  1ZN5 A;  3JCU E;  3L74 J;  5CCG D;  2IPP A;  1LTB C;  2AFD A;  3B5N B;  1JM0 A;  1RF1 A;  5BS1 A;  3Q2Y A;  2JU2 A;  4QMA A;  3T97 B;  1CW5 A;  1SQQ E;  2P9X A;  1BCC J;  1KIL B;  3DS1 A;  4BWN A;  2XKM A;  3QWO C;  4BPG A;  5C39 A;  2QJK B;  5F2O A;  4L73 A;  2ZXE B;  1FS0 E;  3RK2 D;  2VLP A;  3RBX A;  3PRJ A;  4IFF A;  3SWK A;  5EJD A;  1DD3 A;  2BAS A;  2QJY C;  1KD1 Q;  1BSH A;  1LGH B;  2A06 E;  1J1E B;  1M57 D;  4XFY A;  2PP6 A;  1IK9 A;  5AW1 B;  4U3F E;  3N7N A;  2Q3E A;  2Q5U A;  2Z46 A;  2K5X A;  2KOD A;  2QIW A;  1JY2 N;  5KLI C;  2PEJ A;  1HTL C;  4K35 A;  3FWN A;  5APX A;  1IMP A;  3LRY A;  1SQX K;  1IFJ A;  2FYN C;  1URQ A;  1PZQ A;  1CSB A;  3G3Z A;  1KOR A;  1VQO P;  2GDY A;  3VP9 A;  1KIL C;  4H2W C;  2K3R A;  3AE6 C;  1DEE G;  1LP1 A;  4DJG A;  1AFO A;  4DZO A;  1JO5 A;  2LXB A;  3SFD C;  4H2Y C;  1NU1 J;  2M0B A;  3KDP B;  4YPC A;  2HG5 D;  2P58 A;  2M3E A;  1JUN A;  4U3F J;  4C46 A;  2H88 C;  5CMZ A;  3RL0 g;  1JY3 O;  2XZR A;  4PD4 D;  3FWL A;  3KYQ A;  3MGN A;  4EI2 A;  3G9R A;  1HWT C;  1SQP K;  5TIS H;  3BVH A;  3VMZ A;  3WUV A;  3H1I J;  3V2R A;  4H0L C;  5GTI E;  1AA0 A;  1NTM D;  1Q81 Q;  1T2K C;  3CCQ P;  3G1I A;  1RNI A;  1N8R Q;  1EDK A;  3LW5 H;  3DPH A;  2CPS A;  1L2P A;  1AVO A;  5HGM A;  3NTE A;  1XTG B;  3E1I A;  3KXD A;  2ZYD A;  1SQV G;  2VRS A;  1WT6 A;  3L73 J;  4XFJ A;  1IJD B;  5APW A;  4JF7 A;  2W6A A;  4PH1 A;  1GTW A;  4H0L D;  1A02 F;  3CC4 P;  5APQ A;  1VF5 C;  3UIA A;  1L0L K;  3E1R A;  3HRN A;  1FZC C;  2WSC J;  1JY2 O;  1RE3 A;  1NU1 G;  5HGL A;  3PHL A;  2XZ1 C;  3A3Y B;  4IFD K;  3LID A;  1HF9 A;  4A7P A;  1IFM A;  2CPB A;  1SP4 A;  1X22 A;  2FXP A;  3CCU P;  3M9B A;  4COC A;  4KHX A;  2SPZ A;  1E6J P;  3KPE A;  1WMK A;  3BCC E;  1JOC A;  2KR5 A;  2Z5H A;  2PNG A;  3I56 P;  4R0M A;  3RG2 A;  2N9B A;  5AW7 B;  3B4Q A;  5KP8 B;  1T3J A;  4PD4 H;  5HGO A;  3TYY A;  1M6E X;  5AW4 B;  3VMX A;  1EZV D;  2WPV B;  1HH0 A;  1H88 A;  2E74 D;  1FZC A;  3B5N C;  3CLQ A;  3TGU G;  4HJG H;  4F37 A;  2B88 A;  1UJZ A;  2E75 B;  4WY4 A;  3L74 E;  1ZLL A;  4XFX A;  3AED C;  2AXC A;  3V5B A;  4LLH A;  1M8O B;  1KB9 H;  2E76 B;  3M0D A;  2EG5 A;  1YIT P;  3AE1 C;  1EXJ A;  3OW2 O;  2P10 A;  4IFM A;  3EJD A;  3V2N A;  2XU6 A;  1PEO A;  4U0F A;  3LIE A;  3SWF A;  2M5R A;  1NTK K;  2KYV A;  2N6Z A;  1LT9 B;  1G1J A;  1MZ9 A;  1DX7 A;  5E79 H;  2K94 A;  1S72 P;  2W27 A;  1KB9 I;  5GTI H;  3M9Q A;  3GLM A;  3HTK B;  4UB6 H;  1EDL A;  5CCG C;  1VF5 B;  2XND H;  5AVS B;  3GF3 A;  3K5B A;  4NEO A;  3AEF C;  2C9N Y;  1NO4 A;  2WSF H;  3RK3 E;  2WTY A;  3M0D C;  4H44 D;  2KG8 A;  3S9O A;  1KYO H;  5B5E E;  1YTZ I;  2XNX A;  1PP9 D;  2JWD A;  2KLV A;  1E5W A;  4D6T D;  4U0B A;  1DD4 A;  2QM7 A;  2KZJ A;  1NTZ G;  1RF1 C;  3V4W A;  5HVC A;  3HYB A;  2E74 C;  2FQ1 A;  2J5U A;  3H1H E;  4IOI H;  1ZOY C;  2Y0C A;  3TNU B;  2JKV A;  1RF0 C;  3PLN A;  2KNC A;  3P05 A;  1MV8 A;  2EFJ A;  3L70 E;  5KJ7 D;  2YO2 A;  2AVA A;  4DCK A;  4HKZ H;  1RE3 C;  1NTM K;  2YKQ A;  1L0I A;  2Y0D A;  2LKI A;  1SFC D;  1VQ5 P;  3P7K A;  1VF5 D;  4OWF A;  1SQV J;  2A45 G;  3CXC O;  2N5I A;  2R3C A;  2MVU A;  1VQ8 P;  2CK3 H;  4PV1 B;  2N6Y A;  3H4E A;  5H2F E;  3H1L J;  2DNW A;  1GL2 C;  3L74 G;  2R3S A;  2M5A B;  4R4M A;  3H0D A;  3TGU E;  4AUW A;  2HLO A;  3HUS B;  1PFI A;  3GJN A;  3GF7 A;  1LWU C;  1K05 A;  2OTK E;  3L71 J;  1KC8 Q;  5CHX A;  1ZR2 A;  2M8P A;  3HTK A;  1A02 J;  4M3L A;  1EZV G;  2POH A;  2QVA A;  1DEB A;  3D6Z A;  1TU3 F;  2Q9I A;  1KV4 A;  2QG4 A;  5AVW B;  1HQB A;  1HBW A;  2DW3 A;  2R5D A;  5DCK A;  3L72 D;  2GZJ A;  3H1I G;  2Z45 A;  1IFI A;  2GA1 A;  2JYL A;  3A5T A;  4C7N B;  2M8R A;  1EZV E;  3RK3 B;  1JY3 N;  1PEQ A;  1KIL E;  1G1I A;  2P1J A;  5APT A;  2FKW B;  3A0B H;  5CJ0 A;  2NPS C;  3OJA B;  3GHG B;  4IZ6 A;  4H44 B;  1GD2 E;  2ZYA A;  1OW6 A;  5KAI H;  1MKM A;  1N7S C;  3ABV C;  1YI2 P;  1YJN P;  3U43 A;  2OYI C;  4HKG A;  1ZP0 C;  2GZG A;  2N98 A;  1X3O A;  3DS2 A;  5KTB A;  2MD9 A;  1A8O A;  2OAR A;  3G1G A;  2FBW C;  2FAE A;  3MP7 B;  1FZE A;  4D6T G;  2BEZ F;  3HD7 A;  3AEG C;  2BHV A;  1VQ6 P;  4WBA A;  3HE5 A;  1U7J A;  2A06 D;  2WPR A;  3MZW B;  3L75 G;  1NKN A;  2JBG A;  5CZD B;  2OTJ P;  4L74 A;  3V2P A;  1NTZ E;  3BAT A;  3G26 A;  2AEM A;  3AE3 C;  5KLV E;  1KYO I;  3DS4 A;  2NZ2 A;  3JSV C;  3A0H E;  1YIJ P;  2EHT A;  2R5B A;  1VQN P;  2V7Q H;  3A2A A;  2FYU G;  3M0A A;  2E42 A;  1X79 B;  1YQ4 C;  3GKL C;  1USD A;  4H13 C;  1JY2 P;  1QGK B;  3OA7 A;  1FJK A;  1NYH A;  3S1K A;  1PP9 G;  1ZXG A;  3AEE C;  3CD6 P;  1GL2 A;  1L0L J;  2K1A A;  3G29 A;  2YMK A;  2O01 N;  5KLV J;  3Q1M A;  2A45 H;  2BCC E;  2FXM A;  3CWB J;  1EOQ A;  3PTZ A;  1OX3 A;  1P84 H;  1E79 H;  2W6J H;  1K30 A;  1WRG A;  2HOD A;  2PEO A;  2GZF A;  4Y99 B;  5KP7 B;  4BXL A;  3CCV P;  1Q7Y Q;  4TT3 H;  4I1L A;  1LNQ A;  2IYP A;  5BVZ A;  5GTH E;  1URQ C;  2WSF J;  3A0H H;  2OYH C;  2KZI A;  2Q7C A;  5AVY B;  3RK2 C;  1Y8A A;  1N2D C;  2HPC A;  2HPC B;  1AVY A;  2K88 A;  3MIW A;  2JGP A;  2I1J A;  3AE4 C;  5B66 E;  2KGA A;  2LKM A;  3HE4 A;  2D2C C;  3T97 A;  3CX5 H;  1NU1 K;  4NPD A;  5AVX B;  3F5H A;  3MGE A;  1PEU A;  1RQU A;  3CCR P;  1AQ5 A;  2KSJ A;  2C0X A;  2CQ8 A;  1HJ0 A;  2B87 A;  2VLO A;  3DS0 A;  4H13 D;  2KW2 A;  4H2X C;  1SQX J;  4GIF A;  1SQB D;  1NAY A;  1VPC A;  2PGD A;  3CXH E;  1QEX A;  3H1J G;  3H1J D;  4D6T J;  3KHU A;  3L71 E;  2KP8 A;  1DNY A;  2K37 A;  2WSE J;  1GL2 D;  3L70 G;  2OYI A;  1S2E A;  3NMD A;  2N1T D;  3TGU D;  3KZI H;  1FAV A;  1H89 A;  2OQQ A;  4CA3 A;  2GZE A;  5BU5 A;  5K5G B;  3HE5 B;  3CX5 I;  1L0L E;  2KUB A;  3V4Q A;  1F80 D;  2KWL A;  2W6B A;  2CWO A;  2PY8 A;  1PIX A;  2EIA A;  1ZR4 A;  3RG6 C;  3G21 A;  4RO0 A;  1CEI A;  4N3Y B;  2YKP A;  3B5N A;  3L70 J;  1SQV E;  2FYN B;  2BCC D;  2WMM A;  1GK4 A;  1JB0 J;  1NTZ K;  2QM8 A;  3HD7 D;  3BCC G;  4PD4 I;  2RN0 A;  2JWA A;  3RK2 B;  2DGY A;  3EFG A;  2EHS A;  1RQV A;  3SFE C;  1UIX A;  4PV1 D;  3A7O A;  3RGU A;  1YYC A;  1Y47 A;  2QE7 H;  3IAO A;  2KB7 P;  2WPT A;  1KN7 A;  3WUU A;  1RE4 C;  2B89 A;  1CI6 A;  4TLF A;  2ZT9 D;  3H1K G;  5DJT B;  2LL8 A;  3V2Q A;  1ACP A;  3CPW O;  2K92 A;  1N7S A;  1N7S B;  2FAC A;  3RL0 B;  3M91 A;  4IL6 E;  4ASW A;  2IFM A;  3CMA P;  1RF0 A;  4HYT B;  2O1K A;  4I7Z C;  3MUD A;  3I55 P;  1PGO A;  3GMA A;  5KLV D;  4ASV A;  3BCC D;  5CCH D;  2YNY A;  1GW4 A;  4LGD E;  2UWJ E;  2KG6 A;  3AEA C;  1LP1 B;  2LF4 A;  4UB8 E;  2AFE A;  5CBN A;  2WIT A;  3H1K E;  3LW5 J;  2YIU B;  3L71 D;  1MZ8 A;  1LT9 A;  1KQG B;  3HUS A;  1SQV D;  2E74 B;  1AQT A;  1T3U A;  2BUO A;  1JCC A;  3PJS K;  1USE A;  1ZMB A;  2ZT9 C;  3B8E B;  4GOD A;  3TDK A;  2I1K A;  4NPF X;  1BGY E;  1LTT C;  2M8L A;  2GUS A;  4WYM A;  1L0N K;  4LC1 A;  5APS A;  3L73 D;  3MUD C;  3IF4 A;  1KZU B;  1J1D B;  4XRO A;  2ITA A;  1W2B O;  2WWW A;  2L6E A;  5KJ7 A;  3DTJ A;  2XDJ A;  3JCU H;  3F89 A;  1SQV K;  3FGA D;  4D6T E;  1A43 A;  1L0N E;  2R32 A;  1HY8 A;  3H47 A;  2H43 A;  1KQL A;  3H32 A;  2Q1K A;  3L36 A;  1SQX G;  1PL5 A;  3B4S A;  3SWY A;  2L22 A;  3L4F A;  2N5H A;  2KSE A;  5APY A;  4EDF A;  5EW5 E;  2M8N A;  5KJ7 C;  3NTN A;  1UII A;  1LTA C;  4WWI A;  1PGJ A;  1JY3 P;  3WU2 E;  2YKO A;  3L72 J;  3C8V A;  1N7S D;  3TGU J;  1M1J A;  2XV5 A;  3AE7 C;  3H1K D;  2PEK A;  2ZXX A;  2L91 A;  2NO8 A;  5B66 H;  2KOO A;  2D2C B;  4L76 A;  3DS3 A;  3CME P;  1L0N J;  4RES B;  4IPY A;  2YIU C;  2LTE A;  1FBM A;  4OGQ B;  3L73 E;  2FFD C;  2AF8 A;  2LIW A;  4U7J A;  3AE9 C;  1CI6 B;  5KAF E;  1H8A A;  2PEI A;  2OYH B;  1RH5 B;  1HGV A;  1SQB G;  2O3J A;  1BDD A;  1RO2 A;  3H1H J;  3V6I A;  1E0H A;  3VOP A;  1BDC A;  1KMI Z;  3G28 A;  2Q6Q A;  1BGY J;  1GU4 A;  4XRQ A;  2IBZ G;  2K93 A;  2JU1 A;  4Z1M H;  5M1B A;  1VQK P;  1PP9 J;  2IDB A;  2FYU E;  1SQP E;  2IFN A;  1MUU A;  2PFX A;  1SVF A;  1RF1 B;  3FXD A;  1IC2 A;  2QRX A;  1VKU A;  1GMJ A;  2W90 A;  5EFW B;  5KLV G;  2PRR A;  4KT0 J;  2HOD B;  1PPJ G;  2IBZ I;  2PEQ A;  5KAI E;  4GDO A;  3VP8 A;  2E1M A;  2XV6 A;  4H13 B;  2L0Q A;  1FZB A;  2FYZ A;  1FDM A;  1RHZ B;  2D2C D;  1KQF B;  2JYG A;  2N1T A;  4DOJ A;  3TK1 A;  1VQ9 P;  2Y0E A;  1KFM A;  3VYI A;  3KQG A;  4YXD C;  1ZNV A;  1OVU A;  2LOL A;  3CCJ P;  4PJ0 E;  1NAF A;  3M06 A;  3GW6 A;  2N1T B;  2GYK A;  5CJ4 A;  1PP9 E;  2HYN A;  2FYU J;  2KGC A;  4YTP C;  1SQQ G;  2W8Z A;  1IK7 A;  2JP3 A;  3H1I E;  1EDJ A;  4Y99 C;  7CEI A;  2FFD B;  1SQB J;  1N7L A;  2FHS C;  2L5G B;  2ERH A;  4C7R A;  1QLE D;  1M1K Q;  2XXM A;  5AVQ B;  1NTM E;  3EJE A;  4PH0 A;  2O01 H;  1KLP A;  1IZN B;  2FVF A;  3RBZ A;  1KFN A;  2Y9Z A;  1BAJ A;  3CXH I;  1UNK A;  1SQQ J;  1YJW P;  5KKZ C;  3U1C A;  2WT7 A;  4JYB A;  2QJP C;  3L72 G;  1LTI C;  1BCC E;  3CWB E;  1LTJ A;  4DG9 A;  1M1J B;  1GL2 B;  4RJT A;  4PV1 C;  2WQY C;  5KLI B;  1SQB E;  5AVZ B;  1PEM A;  1DH3 A;  1Z6M A;  1Q90 D;  1RY3 A;  4U0C A;  1GXG A;  3L74 D;  2WVR A;  2J59 M;  2W83 C;  2ZFC A;  1L0L G;  4MN4 C;  3CX5 E;  1J2J B;  1ZRT E;  1Z56 A;  4UB8 H;  2JO0 A;  1URQ D;  2CGQ A;  2JAZ A;  1NJI Q;  2GDX A;  1FC2 C;  5BS2 A;  2IYO A;  1FZA A;  3OAK A;  5BU8 B;  1AF8 A;  4ZMD A;  4PJ0 H;  1IFN A;  1VQ4 P;  3KZI E;  2JB0 A;  1QVG O;  1OVV A;  2K9Y A;  4OH8 B;  2P2U A;  1X8Y A;  1K9M Q;  5GTH H;  1G2C B;  3WUT A;  1D1D A;  1OW8 A;  3HE4 B;  1IFP A;  2KOS A;  1BXI A;  1FJP A;  3CI9 A;  3H1H D;  4W7Y A;  1P84 E;  2H89 C;  1S1C X;  1SQQ D;  2E5Y A;  4R4L A;  3L70 D;  1IMQ A;  1PGQ A;  1HVV A;  1RO0 A;  3H1L E;  4M0I A;  5I4T G;  3Q3D A;  1K73 Q;  3AEC C;  2ZAE B;  1OWA A;  2OGU A;  3RL0 D;  2MF4 A;  1OZH A;  3GG2 A;  2ONT A;  1CZQ A;  1URQ B;  1VQ7 P;  2K2Q A;  1VQM P;  2MR7 A;  1D7M A;  3MHV A;  4IL6 H;  2LPK A;  2V7Q J;  1R5L A;  4BRY A;  2KOP A;  1OFC X;  3TNU A;  2JQ4 A;  2QJK C;  3RL0 C;  3BRT B;  2IBZ D;  2QNW A;  4I7Z B;  1NTK D;  4ZKP A;  2FYU D;  2PEM A;  3M9H A;  3WMM 0;  2QJY B;  5L8R J;  2AEF A;  3VRL C;  5E79 E;  3HD7 C;  3BCC J;  2NPS A;  1S5L X;  1BSN A;  1L0L D;  3EQ2 A;  1AV1 A;  5APU A;  4ZNC A;  4AYC A;  1BE3 E;  2CNR A;  2HFE D;  3E7K A;  2WSE H;  1HJB A;  1LT9 C;  1LWU B;  1H0T A;  1M7L A;  4W80 A;  4EOT A;  2NPS B;  1HUC A;  2FYU K;  2E75 C;  3EWK A;  3H1J E;  3BAS A;  1NTK E;  1SLQ A;  3NXS A;  3TSI A;  2P67 A;  2IZ0 A;  1BCC G;  3EFF K;  1FOS E;  4XE5 B;  2OYO A;  1EC5 A;  2KK7 A;  2QEX P;  2FQ0 A;  3A0B E;  1KB9 D;  3AE5 C;  4JYC A;  3H1H G;  1KYO D;  1L4A D;  1SFC A;  4U0E A;  2IX7 C;  3H32 B;  1M74 A;  1NH4 A;  1X0T A;  3HD7 B;  1T8Z A;  1Q2N A;  2ZYG A;  1SFC B;  3CCE P;  2YXR B;  2R44 A;  1L0N D;  1LTJ C;  3CX5 D;  3RK3 C;  5B5E H;  4PWV B;  3AE8 C;  1OIP A;  3H1K J;  1L4A C;  1S5L E;  4HB1 A;  5AW5 B;  4PXH B;  3QH9 A;  4JBZ A;  1GXH A;  3CXH H;  1QL1 A;  2JDI H;  3TF5 A;  3JC2 2;  1DIP A;  2NPS D;  3D6Y A;  1SQX E;  4BPF A;  2YMY A;  5H2F H;  1EZV I;  3CWB D;  5CCH A;  2LML A;  2MVV A;  1BE3 D;  2P7J A;  2L4B A;  2ROQ A;  4OGQ D;  4XFZ A;  1QX8 A;  2CG5 B;  1FZG A;  3CL3 D;  4JQ0 D;  1IO4 A;  3VTP C;  2FAD A;  1S3J A;  2MJZ A;  1M56 D;  2K9J A;  3H1L D;  1LTS C;  3P8C D;  3O6Q B;  3G0V A;  2KLU A;  2E75 D;  3L71 G;  3Q20 A;  3IFM A;  1N86 A;  1AUM A;  1SQP J;  4OGQ C;  3D70 A;  4EYY Q;  2M3B A;  1L0H A;  4BRY B;  2E5T A;  2E76 D;  1JMM A;  4N78 D;  2K0Y A;  3P8C E;  4HH2 A;  5KKZ B;  3U1A A;  1T8K A;  1LWU A;  1NGM B;  3VMY A;  1PGP A;  1SFC C;  3B5N D;  1VQP P;  2JR8 A;  1EMV A;  3W68 A;  1FU1 A;  3CCM P;  2BCC J;  1LT1 A;  4WY4 D;  1GDT A;  3AEB C;  1G2C A;  4WVZ A;  5CCH C;  4I6M C;  2LR2 A;  3ITK A;  2LIU A;  1T2K D;  1FR2 A;  5F2N A;  3W67 A;  3CE7 A;  1VDF A;  2BQ1 E;  2KIK A;  3H1L G;  1BGY G;  3H25 A;  3ZDM A;  2JO1 A;  3N4X A;  1BE3 J;  4U3F D;  4U3F G;  3Q5S A;  2GM4 A;  1JJ2 O;  3B5I A;  4WY4 C;  2KI7 B;  4Y28 J;  2K0X A;  2VSQ A;  5KAF H;  1QVF O;  1OVR A;  2QJP B;  4N6J A;  2A45 I;  2N1T C;  3Q5P A;  1NHL A;  1KYO E;  1NTZ J;  2E43 A;  2V4H A;  3SSU A;  2Q3I A;  2B87 B;  1SQX D;  5CBO A;  3EJB A;  1XTC C;  2AXT E;  2WZ7 A;  5HGN A;  5TIS E;  1JTH A;  3R2P A;  1K8A Q;  4U0A A;  3I5C A;  3H1I D;  1IFD A;  1N73 B;  2FVE A;  3Q5R A;  2LXC B;  4H0L B;  1Q86 Q;  1JTH B;  3PH0 A;  1QRJ A;  1EQ7 A;  1SQP D;  3E2D A;  4AQR D;  2YXQ B;  4GT1 A;  1LTJ B;  1GW3 A;  1X9V A;  4IL6 X;  2VLQ A;  1R8E A;  4DT0 A;  2FFD A;  2GDW A;  1VHN A;  1KQS O;  3P8M C;  4W7Z A;  2O01 J;  1FZC B;  2JJL A;  4NPE A;  2KS1 A;  2Z44 A;  1OXZ A;  5JPA A;  3C9I A;  4U0D A;  2GZI A;  1T6A A;  2KOR A;  2YO3 A;  1GK6 A;  1YQ3 C;  4WY4 B;  3B71 A;  3CWB G;  4CPG A;  3P32 A;  2NRG A;  2KXP B;  2VLN A;  3H1J J;  5AVU B;  5KP6 B;  3DS5 A;  1NU1 D;  2WPS A;  3BRV B;  5AVT B;  2FY8 A;  1K04 A;  2KGD A;  4COP A;  2WSC H;  1L0N G;  4ZKU A;  2RKL A;  1GPJ A;  1NTK J;  3MD0 A;  3FXE A;  1M90 Q;  1OMI A;  1JNM A;  2KG9 A;  4XA4 A;  2WT7 B;  3WBH A;  1FDI A;  1IUQ A;  3NY7 B;  3HUS C;  5AW8 B;  1NU1 E;  3CCS P;  3HZQ A;  1P84 D;  3NFQ A;  2RH0 A;  3O8Z A;  2XZ0 D;  2ZVN B;  2QA4 P;  1BE3 G;  1QL2 A;  3CXH D;  1VQL P;  4UB6 E;  1S5L H;  1LTG C;  4L75 A;  1RE4 A;  2I8D A;  3IR9 A;  4RKU J;  3L75 D;  1SS1 A;  3USS A;  3O6Q A;  1FE6 A;  2RMZ A;  1PPJ E;  1BCC D;  4O9B A;  3PP5 A;  5AVV B;  2OYH A;  1N73 A;  3R4Y A;  3M1M A;  1JEK A;  2H7H A;  2WPQ A;  2BCC G;  3AE2 C;  3C1L A;  2FVA A;  1NKZ B;  3G71 P;  2K9J B;  1FOS F;  4GOF A;  1M6N A;  1NTM J;  4I2L C;  1PV3 A;  1NWQ A;  5CCG A;  3L72 E;  1ZW0 A;  5AW6 B;  1JMB A;  2C9L Y;  2PEN A;  2ZVO B;  5APV A;  2FXO A;  1MFZ A;  4N78 E;  2ZT9 B;  1H0T B;  1VL2 A;  2G3A A;  2KOQ A;  4C7N A;  1J1E C;  1SQQ K;  1NTK G;  1NVO A;  4H44 C;  1ZRT D;  2ZJS E;  2MR8 A;  1KTM A;  4UHP B;  1S4X A;  3FX0 A;  2L9F A;  1W5C E;  1S9K D;  1NTM G;  2M5A A;  4MRT C;  5TJH A;  2E76 C;  1SQB K;  2PAJ A;  2WSS H;  5DJU B;  2A06 G;  1FZF A;  1M1J C;  3IN6 A;  2C0W A;  2MKV A;  3S4R A;  3RK3 D; 
#chains in the Genus database with same CATH homology
 2PEK A;  1EOQ A;  1VQ4 P;  5HGO A;  3CC7 P;  2LF4 A;  1M6E X;  4U0B A;  1K30 A;  1QVG O;  2PEO A;  3WBH A;  3CCV P;  1Q7Y Q;  3G0V A;  1IUQ A;  2CWO A;  3DS3 A;  3CME P;  3CCS P;  4IPY A;  1K9M Q;  3HZQ A;  3Q20 A;  3HYB A;  2PY8 A;  3G4S P;  1AUM A;  1YI2 P;  1YJN P;  1D1D A;  2EIA A;  1M1K Q;  5BS1 A;  2XXM A;  2QA4 P;  2P9X A;  2BUO A;  4PH0 A;  3RG6 C;  3DS2 A;  5HGN A;  3CC2 P;  3G21 A;  4XFX A;  2QEX P;  1VQL P;  3P05 A;  3DS1 A;  1ZMB A;  2PEI A;  1A8O A;  2OAR A;  2EFJ A;  4GR6 A;  5F2K A;  3G1G A;  1BAJ A;  2M8L A;  1K8A Q;  4U0A A;  4WYM A;  1Q81 Q;  3CCQ P;  5F2O A;  3G1I A;  1RNI A;  1YJW P;  2OTL P;  1RO0 A;  1RO2 A;  4GR2 A;  4U0E A;  1N8R Q;  3DPH A;  3G28 A;  4XRO A;  1M74 A;  1Q86 Q;  2XT1 A;  2BHV A;  2EG5 A;  1QRJ A;  4M0I A;  5HGM A;  5I4T G;  1YIT P;  1W2B O;  3M1M A;  3OW2 O;  1VQ5 P;  1K73 Q;  1VQ6 P;  2L6E A;  3E2D A;  2DGY A;  3DTJ A;  3NTE A;  4XRQ A;  1VQP P;  1PEO A;  4U0F A;  3CXC O;  3CCE P;  1VQ8 P;  3G71 P;  2OTJ P;  3H4E A;  3CCM P;  1KD1 Q;  1M6N A;  1A43 A;  3MGE A;  1VQK P;  1PEU A;  3G26 A;  4PH1 A;  3CC4 P;  4XFY A;  3H0D A;  3DS4 A;  3H47 A;  1S72 P;  2PEN A;  1KQS O;  1YHQ P;  2ONT A;  3CCR P;  1VQ7 P;  1PEQ A;  1YIJ P;  2Z44 A;  5F2N A;  5JPA A;  1VQN P;  4U0D A;  1PEM A;  1VQM P;  3DS0 A;  2BQ1 E;  2Z46 A;  5HGL A;  2KOD A;  1KC8 Q;  2PEQ A;  4U0C A;  2PEJ A;  1EIA A;  2M8P A;  1YJ9 P;  3CPW O;  2XV6 A;  2E1M A;  3LRY A;  3CMA P;  2M8N A;  3B5I A;  1JJ2 O;  2JYG A;  1VQO P;  3I55 P;  3DS5 A;  3G6E P;  3CCU P;  3CD6 P;  1VQ9 P;  2PEM A;  4XFZ A;  4COC A;  1QVF O;  2JO0 A;  3VRL C;  4COP A;  3CCJ P;  5DCK A;  1E6J P;  3G29 A;  1NJI Q;  4QNB A;  2Z45 A;  5BS2 A;  2JYL A;  3CCL P;  3I56 P;  1Q82 Q;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...