3CCLP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cclP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cclP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cclP02
1KD1Q 3CCLP 1VQLP 1Q86Q 1VQMP 3CMEP 3CCSP 1N8RQ 1VQKP 1VQ6P 1VQPP 1VQ7P 1K73Q 2OTJP 2QEXP 3CCUP 3G71P 1YJ9P 2OTLP 1KC8Q 3CD6P 1S72P 3OW2O 1YIJP 1Q81Q 3CCVP 3CC2P 1YJWP 1K8AQ 1Q7YQ 1VQ4P 1QVFO 1QVGO 1M1KQ 3I55P 3CMAP 1YHQP 1YJNP 3CPWO 3G4SP 1VQ5P 3CCJP 1JJ2O 1VQNP 3CCEP 3CCQP 2QA4P 1KQSO 1VQOP 3G6EP 3I56P 1VQ8P 1YI2P 1W2BO 1NJIQ 3CC4P 1M90Q 1K9MQ 3CC7P 1Q82Q 1YITP 3CCRP 3CXCO 1VQ9P 3CCMP
chains in the Genus database with same CATH superfamily
2BCCJ 3N7NA 1L4AD 1PPJG 1KD1Q 2KOSA 4L74A 1OR5A 1K73Q 2KP8A 2QVAA 2XNXA 2OTLP 1FZAA 3AE1C 1L0LE 2Z4EA 1EC5A 2MF4A 1PGJA 1ZXGA 5AVWB 2KLUA 3GHGB 3SFEC 1ZR2A 1IC2A 4U0CA 4PD4I 3G28A 1R8EA 2FY8A 2ERHA 4R4LA 3OA7A 2W6JH 4C7NA 1GU4A 1SQXE 2YXQB 3IF4A 3PRJA 3A0BH 2K37A 2LOLA 1KQFB 3AE2C 1RY3A 1W2EA 5KJ7C 4F37A 3AEEC 3G6EP 1VQ8P 3D70A 3L70G 4CA3A 3L72E 3S9OA 2IFNA 3L71G 1FR2A 3AE9C 4YPCA 1GL2A 1FZCA 3RK3D 1SP4A 3F5HA 3CXHH 4N6JA 2XZ0D 4PV1C 2OYIA 1MFTA 1JY2O 2B88A 4D6TD 1KMIZ 1JOCA 1JMBA 5E79E 3WUTA 2BHVA 2W8ZA 5KKZB 3HE4B 1GD2E 5B5EH 1XTCC 4EYYQ 5HVCA 2J59M 1KILA 5AVQB 1AUMA 1NU1K 3V4QA 4PH0A 3G1IA 1FJKA 1OW7A 2GDYA 3WU2H 3GF3A 3AEFC 3U1CA 3H1KJ 2KG8A 2FACA 5GTIE 5HGMA 3LW5J 1NTKD 3H1LE 1LTJB 2E42A 3VMAA 1SQBK 4RESB 2JBGA 1FZGA 1DX7A 1KILD 4IL6X 2KZIA 2K0DX 1QX8A 2KNCB 1IMPA 1CI6B 2IBZE 3LIDA 2JYLA 3KZIH 5BU5A 2M8LA 2MJZA 2FYUD 2JO1A 1VQ5P 1SFCA 4U0DA 1KQSO 2K92A 2ZT9B 4H13B 3V5BA 1IK9A 1AQ5A 4HJGH 2N50A 2OARA 3HTKA 2LTEA 2N1TA 3GJNA 1DD3A 1J1DB 2PEJA 5APVA 2AXTH 3F89A 4N78E 1QRJA 4GODA 1LT9C 1P84I 1RF1C 1KB9I 3CE7A 4IFMA 4KJMA 2W90A 1JCDA 1GMJA 5EFWB 2X2BA 2KZJA 3H1ID 2N1TD 5M1BA 2KGEA 1GW4A 3LMOA 1A02F 2K0XA 2H88C 2LIUA 3A0HE 3HUSC 1Q90D 5EJDA 2KOGA 1LWUA 3OJAB 2MR8A 5B66E 1DV5A 2KGAA 4OGQB 2WSFH 1D7MA 2EFJA 2JYGA 2YXRB 4L73A 3FGAD 3H1IJ 1Q7YQ 1KQLA 3H1HE 4IL6E 2HODB 2Y0DA 2BEQD 1R5LA 1HF9A 1AF8A 3CX5I 1SQPG 1AV1A 2GZJA 3P05A 3SWKA 1OIPA 3ABVC 1NWQA 2L9FA 3L70D 1JY2P 1KTMA 3DS4A 3M9HA 5CJ4A 3S4RA 2E75D 3SWYA 1M56D 2M5RA 4WWIA 1EDIA 1PEOA 4BWNA 1PP9E 5CBOA 5HGNA 2M5AA 5AVYB 2AEMA 3NMDA 1JB0J 1FJPA 3MP7B 1CI6A 2NZ2A 2JO0A 1DNYA 1GZLA 1JO5A 1BGYJ 3L71J 3USSA 2QIWA 4CPGA 3CCMP 4RO0A 4JPZB 3CCSP 1QL2A 1VF5C 3TNUB 3TGUG 4IFDK 1N7SC 3AE4C 1GK4A 2E43A 5CBNA 2KGCA 2K5XA 1CEIA 3L75E 3N4XA 2RKLA 3UIAA 2H89C 3HD7C 1HGVA 2ZT9D 2J58A 1AYIA 1VQPP 1OVUA 4PWVB 3G0VA 1YTZI 3Q3DA 3LRYA 1MV8A 5CJ0A 1EXIA 4BPGA 1NTZD 3B5NB 3FXEA 2WSCJ 3MGNA 1KYOE 3CXCO 2AFEA 1G1IA 2NPSC 1SQQD 3TYYA 2ZXEB 5GTIH 5H2FH 5HGOA 1NU1E 3DTJA 1L0LK 4BRYB 1BE3G 2IYPA 1IFPA 1PEUA 4AUWA 1ZP0C 3A5TA 4EDFA 2R3CA 1XTGB 3GZLA 4IFFA 5KAFH 2QE7H 1SQBE 2Z44A 1EDJA 3L35A 5TJHA 4OGQD 1U57A 2ZVNB 2LKMA 1M1JA 1BCCE 2ZXXA 1K8AQ 2FXPA 5KP6B 5CCGD 3A0BE 1PGPA 1MZ8A 2WSCH 5HGLA 1JM0A 2CK3H 4GOEA 2MY5A 2A06E 1SQVJ 2BEZF 5BS2A 4O9BA 1Q86Q 1LP1A 2BCCE 2Q6QA 4PD4D 1SQPD 3GW6A 3VTPC 1DH3A 2HPCB 3WUUA 1T8KA 2PEMA 3CXHE 1LT1A 1ZMEC 4I7ZC 1L4AB 4U3FD 1ZRTE 1RE3C 1NTMJ 1IJDB 1ZMBA 5B5EE 3U43A 3CWBJ 1FU1A 2FYNC 4H0LC 5AVXB 4DZOA 4GR2A 3EFFK 3WU2E 3SWFA 2O1JA 2LMLA 2E74B 4XFZA 2FXOA 3L73J 3AEDC 2WSEJ 2R32A 2O01N 4LC1A 5GTHH 4OH8B 4N3YB 3KZIE 4C7NB 1FBMA 1S5LH 3CC7P 4UB6H 2WPRA 1OFCX 1JNMA 1RQVA 2D2CD 2B87A 2C0XA 2K93A 2XZ1C 4WY4A 4ZKPA 1DEEG 2I1JA 1X22A 3Q20A 3H1KE 2QJKB 1SLQA 1AVYA 3CPWO 2KOQA 1A02J 3RK3E 1H89A 2FQ0A 3CC4P 5CZDB 1E0HA 1GL2B 1FZCB 3CI9A 3RBXA 2WSEH 3RL0B 3B5ND 3VP9A 2JR8A 1D1DA 2KSJA 3TGUJ 1NTKG 2IBZI 2OYIB 1OMIA 2DGYA 2HR3A 1CZQA 1NO4A 4WY4D 3IN6A 1L0NG 1YYCA 1EIAA 1HBWA 4GR6A 3P8MC 2PEIA 3RK3C 2GZEA 1Y8AA 4U0BA 1SQVK 3L74G 1KB9D 1EMVA 2FYUG 3CMEP 4JYCA 4L76A 2IPPA 5K5GB 2QJPB 3TSIA 1RF0C 1YQ3C 3H47A 3Q5PA 2FXMA 2HG5D 5AW5B 2NRGA 3WBHA 4WBAA 1AFOA 2JDIH 1NTMK 2V4HA 1FDOA 5KLIC 2JJLA 3O8ZA 2GZIA 1BSNA 2IZ0A 1BE3J 2Y0EA 1JY3N 1OVRA 3L37A 4XROA 1SFCB 1JUNA 3H1JG 3L36A 1N73C 1VDFA 2ZYAA 3HTKB 2AF8A 2N1TB 1PZQA 1T8ZA 4TLFA 1KLPA 1HY8A 1KQGB 3VRLC 2LKIA 1Z6MA 4PXHB 4Y28J 1EZVE 2OYHC 2ZJSE 3GG2A 3CX5D 2KODA 2FAEA 1USDA 2K9JB 3MD0A 4QKOA 4XRQA 1URQA 1PPJE 4UHPB 2B89A 3V2RA 2E74D 2NO8A 1VKUA 1P84H 2R5BA 2KOOA 4PV1B 1M74A 1LWUB 5KLVD 1NHLA 3EJBA 2XKMA 1A43A 1S9KE 1URQD 1OZHA 3L72G 3V4WA 1E79H 3A2AA 1X9VA 1NH4A 1WT6A 1IMQA 2YKPA 3M0DC 2KGDA 1PGQA 1HGZA 3MUDC 1EQ7A 1T2KD 3GHGC 3BRTB 1QVGO 2E75B 1JJ2O 2C0WA 1S1CX 1NJIQ 1NKNA 3HE5B 5AVRB 4GDOA 1S3JA 1BGYE 3L71E 1VQKP 1GL2D 1M57D 2EIAA 1YJ9P 3FWLA 3RL0D 3IAOA 4U0AA 5DCKA 1PEQA 2LXCB 5H2FE 3BATA 1Y47A 1YQ4C 2AVAA 3NTNA 2XNDH 1UNKA 1KFMA 1L0ND 1LTBC 2FBWC 4D6TJ 2M5AB 5KAFE 4WYMA 2IBZG 2N6YA 2WT7A 1S5LX 2Q3EA 3L74D 2XXMA 5AW4B 1GXGA 1AJYA 3H0DA 1KYOI 2N5IA 1IZNB 5KKZC 2CQ8A 1JTHB 1NTKJ 2N5HA 1T3UA 2JU2A 3P8CE 1MZ9A 1FAVA 1L0NJ 2JU1A 4H2YC 1FC2C 1NTZG 3B4QA 3BCCD 4U0FA 1NAFA 4AQRD 4UB8E 2M3EA 3KPEA 3LW5H 3HUSB 1F80D 2VLPA 1M1KQ 5APTA 1SQQG 2OQQA 1LTJC 1SFCD 3I56P 1QEXA 5KJ7A 4XA4A 1ACPA 2W6AA 2PEOA 3L74J 1GK6A 2FYUJ 3H1JD 3H4EA 2WPVB 5AVTB 1SS1A 2XT1A 2K9JA 2Y9ZA 1BDCA 1ZR4A 2FVFA 1FZEA 2GA1A 3ZDMA 4A7PA 1Q2NA 5KJ7D 2HYNA 1Q82Q 3NTEA 4H13C 1OVVA 4NEOA 3E1RA 1UIXA 1SQVE 1J1DC 2QSIA 2IYOA 2MD9A 2M0BA 2N6ZA 1T3JA 3CXHI 3H1HG 1SQXD 5C39A 1BDDA 3IR9A 1LJ2A 3C8VA 4PV1D 2AFDA 4JF7A 3Q2YA 5GTHE 2CG5B 1VL2A 3H25A 1KV4A 1M1JB 1S5LE 3GMAA 1NTME 3HE5A 4UB6E 2Y9YA 2GZFA 2YO3A 2EG5A 4U3FG 3L72D 3CWBE 4BPHA 3E1IA 1X8YA 1ZW0A 5CCHC 1LP1B 2ZAEB 1N7LA 2OGUA 2K2QA 4OGQC 1X3OA 2XV6A 3L73E 2Z5HA 1N7SB 5AW6B 5CCGC 4GKGA 3RK2C 2KK7A 3P7KA 4IZ6A 2L91A 1IK7A 2RN0A 2Q5UA 2KW2A 1RNIA 2PFXA 2XU6A 1AQTA 1LT9A 1K30A 1RF1A 1OXZA 2WITA 3L70J 3C1LA 2ONTA 1CSBA 1NTKK 1U7JA 3H1LD 1LTAC 3M9BA 3EFGA 1OW6A 2W27A 3MHVA 2FQ1A 1JTHA 1NOHA 4YTPC 3VMZA 2KI7B 2QM7A 1NYHA 3HRNA 1PGOA 1YHQP 2IBZD 5EW5E 2V7QJ 3HUSA 4M0IA 2SPZA 4I6MC 4DOJA 2FYUK 2D2CB 3PJSK 4WVZA 3CCLP 1G2CA 4KHXA 1A8OA 3TDKA 1VQ6P 1WRGA 4ASVA 1EOQA 2R3SA 2E1MA 3EWKA 3TGUE 1OWAA 1JMMA 3VN0A 1MUUA 3G21A 3G26A 3CCQP 4N78D 3GZMA 2MKVA 3PTZA 2E76B 1X79B 1RQUA 2B87B 2QJYB 4WY4B 1NU1G 1FE6A 3CCUP 2YMKA 1Y9BA 4QNBA 3FX0A 2V7QH 5KAIH 2GDXA 5JPAA 1SQBG 2MVUA 3DS0A 1L0IA 3VMXA 1NTZJ 4Z1MH 3SFDC 1RHZB 1NVOA 1BCCG 1BE3E 1SQQJ 3CCVP 1GXHA 2JB0A 1P84E 1YTZT 2IX7C 2Z45A 2P1JA 1NKZB 1FZFA 3B5NC 3II6A 2PP6A 1AA0A 3H1HD 4UB8H 3Q1MA 4XFJA 1EZVI 3EQ2A 1RE4A 1QL1A 2PGDA 1U7MA 4JQ0D 1JCCA 1ZNVA 1N7SA 3AEAC 2H8PD 3CCEP 2WTYA 1FOSE 3G9RA 2P10A 2IDBA 1H88A 2O1KA 3HD7A 2FFDB 1VF5D 1USEA 4ASWA 3M9QA 3D6ZA 1N7SD 2JKVA 2DW3A 5HV8A 2QA4P 1W2BO 2VLNA 1SQPJ 1M90Q 2KLVA 3G29A 2KSEA 3H32A 2GYKA 3HZQA 1YITP 2B9BA 2J5UA 5KLVG 2ZYGA 3CX5E 4U3FJ 2FVEA 4H2WC 3O6QB 3HD7D 3FXDA 2NPSA 4BPFA 2CPSA 1HJBA 3M91A 1VQ4P 4DJGA 1J1EB 1URQB 1ZLLA 1T6AA 4PH1A 1L4AC 3T97B 3B71A 1KFNA 1AVOA 4H44B 3NY7B 4Y99C 5AVSB 1UJZA 3AE6C 2NPSD 3L75D 4W7YA 3VP8A 1S72P 2LIWA 2XDJA 5AW9B 3H1KG 2QM8A 1PV3A 4PD4H 3RBZA 2BUOA 1YJNP 3D71A 5AW7B 3Q5SA 5APUA 2E74C 1HTLC 1E6JP 4MRTC 2E76D 4D6TE 2YO2A 2ZFCA 3V2QA 3DPHA 2QRXA 1KYOD 1Q81Q 1SQQK 3RG2A 1R5SA 1NU1D 1W5CE 2YIUB 2YKQA 1VQOP 2YMYA 5KLIB 1HJ0A 3HYBA 2KYVA 3MGEA 1NTKE 1M7LA 1T2KC 1RE3A 1IFJA 4AYCA 1SQBD 4PJ0E 2ITAA 4HH2A 1L0NE 1KILE 4EI2A 5TISH 2JQ4A 1HH0A 3RGUA 1BXIA 2WPTA 1OX3A 2PRRA 1BCCD 1VPCA 2Q9IA 3BCCG 1GL2C 1FZCC 3NFQA 2FVAA 1EDKA 3WMM0 5L8RJ 2P9XA 2KIKA 3AE8C 4C46A 2WT7B 2FYUE 2OYIC 3CL3D 3OAKA 2K0YA 3OW2O 2JWDA 2P7JA 4JBZA 1HUCA 2K88A 4LGDE 3VYIA 1KILC 2WPSA 2FFDA 3G1GA 1GW3A 1SQPK 2ZVOB 4H2XC 3CXHD 2K3RA 1ZN5A 2P67A 4GT1A 2BQ1E 2UWJE 1BCCJ 1VQ7P 2KS1B 1ZRTD 3QWOC 1L0LG 1QGKB 3B4SA 1EZVG 2QJPC 2M8PA 2I8DA 1GU5A 5AW8B 4K3AA 3CMAP 3O6QA 5AW0B 3H1IE 1KORA 2WZ7A 2FADA 1BSHA 4RJTA 1LNQA 1UIIA 1VQ9P 1KZUB 1PFIA 1SQXG 1L0HA 1MFZA 5APWA 2OTJP 2QEXP 3T97A 4YXDC 1KC8Q 3GKLC 1RO0A 2PEKA 1KB9H 5APXA 1SFCC 4TT3H 3ITKA 1YJWP 3U1AA 2FHSC 3I55P 3B8EB 3JCUH 1G1JA 2JGPA 7CEIA 2E5YA 2N1TC 3IFMA 2PAJA 4YXWH 1H0TB 2EHSA 1N8RQ 3PLNA 5APYA 4KT0J 4H44D 3Q5RA 3D6YA 1Z56A 3AE7C 4U0EA 3DS5A 2GUSA 3G4SP 2KB7P 2K9YA 1RF0A 2Y0CA 1JEKA 3BRVB 5KLVJ 4DCKA 4NPFX 2R44A 3H1KD 3L70E 2GUVA 1BGYG 2WWWA 2KUBA 4NPDA 1RH5B 2YKOA 2GDWA 3C9IA 2MVVA 1LWUC 5DJTB 3H1LG 3RG6C 2IZ1A 5CMZA 5APSA 3CX5H 2AEJA 1N73A 2POHA 5BS1A 4XE5B 3CCRP 4EIJA 5KAIE 2KXPB 3E7KA 1JY2N 1ZV8A 2HLOA 1EDLA 2CNRA 1SVFA 3R4YA 3MTUE 1LT9B 1RF1B 2XZRA 3U59A 3CLQA 1MKMA 5APQA 2E75C 1JY3P 2OYHA 2HFED 2XV5A 1N86A 2A45I 1GTWA 1IFIA 1DEBA 2LL8A 3BASA 5KTBA 1IUQA 2KORA 1TU3F 2KS1A 4W80A 3WUVA 1FDIA 1LTSC 3PH0A 1L2PA 5F2NA 1G2CB 4I1LA 2PEQA 1NQ4A 5KP7B 3P32A 2WSFJ 5F2OA 1VQMP 2CGQA 3DS2A 4K35A 4XFYA 1NTZE 2W6BA 1YBKA 3M0DA 2K94A 3G3ZA 1SQQE 2O01J 3MUDA 3BCCJ 3GHGA 1L0LD 3E2DA 1DD4A 1EZVD 2AEFA 3JSVC 1EXJA 2QNWA 1PL5A 2ZT9C 3A3YB 5I4TG 4PJ0H 5AVUB 2G8YA 2DNWA 3KQGA 2C9NY 1SQVG 1IO4A 3H1JJ 1HVVA 1PPJD 5AVZB 1H0TA 4GOFA 3I5CA 1NGMB 2ZYDA 3M1MA 1IFMA 5BU8B 4HB1A 1K9MQ 3DS1A 5KLVK 2FQ2A 4HKGA 2LXBA 4IPYA 1L0LJ 1NTMG 1WMKA 1S9KD 2L0QA 1K04A 2W83C 3RK2B 3LIEA 3CWBG 2O01H 3M06A 2PY8A 3B5IA 5KP8B 4GIFA 2Z5IA 4XFXA 4PD4E 1SQXJ 1SQPE 1IFDA 4DT0A 2GM4A 3HE4A 3L73G 1BAJA 1K05A 5CHXA 1VF5B 4L75A 2WQYC 2KG9A 3G71P 1PP9G 3KDPB 1NAYA 1YIJP 4U3FE 3S1KA 1BGYD 3L71D 2Q1KA 2WMMA 5AVVB 3H6PA 3AEGC 4ZNCA 3L72J 2ROQA 1LTJA 1FZBA 3HD7B 4RKUJ 2LR2A 5AW3B 1M1JC 1L0NK 2KNCA 3MZWB 1GPJA 3H32B 2JAZA 3FWNA 3L75G 2JWAA 5TISE 2NPSB 2VLOA 1RE4C 3PHLA 2VRSA 4M3LA 3H1LJ 1M6EX 1E5WA 1FOSF 3CC2P 1PIXA 1IFNA 3P8CD 3SSUA 3EJEA 1M6NA 2Q3IA 3R2PA 3DS3A 2A45G 4H13D 4IOIH 4WB4A 2BASA 4R4MA 3VMYA 1X0TA 5E79H 3GF7A 2VLQA 2I1KA 2H7HA 2M3BA 2D2CC 5CCHA 2YNYA 4OVNF 2O3JA 4NPEA 1GDTA 1QLED 1FDMA 5CCGA 2L22A 2FYZA 4I7ZB 1SQVD 1KB9E 2WPQA 2C9LY 2JEEA 1SQXK 2A06G 2E76C 2HODA 2QJYC 3JCUE 2WVRA 5CCHD 5DJUB 4WY4C 1LGHB 2BCCG 2L6EA 3KXDA 2FYNB 3KHUA 4H0LB 3TK1A 1J2JB 2L5GB 1N2DC 3W67A 3RK2D 1NTMD 2RH0A 4C7RA 3AEBC 3V2NA 5BVZA 3CWBD 2QG4A 4R0MA 5AW1B 2MR7A 1RO2A 2AXCA 2M8RA 3H1HJ 3NXSA 1QVFO 3L73D 3V6IA 4ZKUA 2IFMA 2KOPA 3KYQA 1PP9D 2G3AA 2K1AA 4Y99B 3A0HH 2GZGA 1LTGC 2WSSH 4U7JA 2E5TA 5B66H 3TNUA 4QMAA 3K5BA 3M0AA 1VHNA 4W7ZA 4OWFA 5KLVE 1PP9J 4IL6H 2FFDC 1PEMA 3RL0g 1HWTC 3TGUD 1HQBA 2LF4A 2PENA 3RK3B 2R5DA 4MN4C 3B5NA 1VQLP 4D6TG 1NTZK 1CW5A 1ZOYC 1S4XA 3CD6P 4JYBA 3PP5A 2EHTA 1J1EC 2AXTE 3L75J 4BRYA 1URQC 2JP3A 3AE3C 1VQNP 4HKZH 3MIWA 1YI2P 2RMZA 4BXLA 3V2PA 2PNGA 3TF5A 3VOPA 4H44C 4COCA 1OW8A 1LTIC 4EOTA 1LTTC 1FS0E 1H8AA 3BVHA 2KR5A 1N73B 2M8NA 2H43A 1KILB 2QJKC 3AECC 3GLMA 1BE3D 1JY3O 1M8OB 3EJDA 1NU1J 3AE5C 1P84D 2LPKA 2OTKE 3RL0C 2CPBA 3L74E 1DIPA 1S2EA 2P58A 2A06D 2OYHB 2N9BA 2CWOA 4B86A 3L4FA 2YIUC 2P2UA 4H0LD 3CCJP 1SQBJ 2BCCD 2OYOA 2HPCA 2VSQA 3BCCE 4ZMDA 4LLHA 1L4AA 5F2KA 3JC22 2Q7CA 2N98A 3A7OA 2KG6A 2L4BA 1KN7A 3QH9A 3H1JE 3W68A 2KWLA 1KYOH 3H1IG 4HYTB 4COPA 2A45H 4DG9A 2FKWB 4I2LC 5AW2B 2Z46A 2N9YB
chains in the Genus database with same CATH topology
1KD1Q 3MGEA 3CCLP 3P05A 1VQLP 1A8OA 5F2OA 1VQMP 5HGOA 1N8RQ 1VQKP 1VQ6P 3DS2A 3DTJA 1K73Q 1EOQA 2L6EA 2EIAA 4XFYA 1YJ9P 2E1MA 3CD6P 2OTLP 2JYLA 4U0AA 5DCKA 2M8LA 4XROA 1PEQA 1PEUA 4U0EA 3DS4A 3DS5A 3G21A 3G26A 3G4SP 4U0CA 1VQ5P 3G28A 1VQNP 4U0DA 3CCQP 2QA4P 1KQSO 1YI2P 1W2BO 3CC7P 3E2DA 1M90Q 3G29A 3HZQA 1YITP 2Z44A 5I4TG 2P9XA 2OARA 4WYMA 1PEOA 3VRLC 1RO2A 4COCA 3CCUP 2PEJA 5HGNA 1QRJA 4QNBA 1M6EX 2EG5A 3OW2O 3CC2P 1QVFO 3Q20A 1K8AQ 1VQ4P 2M8NA 2KODA 3RG6C 3CPWO 2XXMA 3M1MA 1M6NA 4PH1A 2JO0A 5JPAA 3H0DA 3G1GA 3G6EP 5HGLA 1VQ8P 3CC4P 1K9MQ 3DS1A 4XRQA 5BS1A 3CCRP 3DS3A 3DS0A 3CCMP 1D1DA 5BS2A 4IPYA 2XV6A 1Q86Q 2BQ1E 3CCSP 2DGYA 1VQ7P 4U0FA 1S72P 1M74A 2M8PA 1EIAA 3CCVP 2CWOA 1M1KQ 2BUOA 2PY8A 4GR6A 2PEMA 3CMAP 1RNIA 1YJNP 2Z45A 3CCJP 3B5IA 1K30A 1A43A 2BHVA 3I56P 4XFXA 2ONTA 2PEIA 2PEOA 1VQ9P 1AUMA 3H4EA 4PH0A 1ZMBA 2XT1A 5F2KA 3G1IA 1BAJA 1E6JP 2EFJA 4U0BA 3CMEP 1VQPP 2OTJP 2JYGA 3DPHA 3G71P 2QEXP 1KC8Q 3G0VA 1RO0A 2PEKA 1Q81Q 1IUQA 1YIJP 4GR2A 3LRYA 5HGMA 1PEMA 1YJWP 1Q7YQ 1QVGO 3I55P 1YHQP 3H47A 1JJ2O 4COPA 3CCEP 2LF4A 5F2NA 1VQOP 2Z46A 1NJIQ 3WBHA 1Q82Q 3NTEA 2PENA 2PEQA 4M0IA 4XFZA 3CXCO 3HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 Q;  3CCL P;  1VQL P;  1Q86 Q;  1VQM P;  3CME P;  3CCS P;  1N8R Q;  1VQK P;  1VQ6 P;  1VQP P;  1VQ7 P;  1K73 Q;  2OTJ P;  2QEX P;  3CCU P;  3G71 P;  1YJ9 P;  2OTL P;  1KC8 Q;  3CD6 P;  1S72 P;  3OW2 O;  1YIJ P;  1Q81 Q;  3CCV P;  3CC2 P;  1YJW P;  1K8A Q;  1Q7Y Q;  1VQ4 P;  1QVF O;  1QVG O;  1M1K Q;  3I55 P;  3CMA P;  1YHQ P;  1YJN P;  3CPW O;  3G4S P;  1VQ5 P;  3CCJ P;  1JJ2 O;  1VQN P;  3CCE P;  3CCQ P;  2QA4 P;  1KQS O;  1VQO P;  3G6E P;  3I56 P;  1VQ8 P;  1YI2 P;  1W2B O;  1NJI Q;  3CC4 P;  1M90 Q;  1K9M Q;  3CC7 P;  1Q82 Q;  1YIT P;  3CCR P;  3CXC O;  1VQ9 P;  3CCM P; 
#chains in the Genus database with same CATH topology
 2BCC J;  3N7N A;  1L4A D;  1PPJ G;  1KD1 Q;  2KOS A;  4L74 A;  1OR5 A;  1K73 Q;  2KP8 A;  2QVA A;  2XNX A;  2OTL P;  1FZA A;  3AE1 C;  1L0L E;  2Z4E A;  1EC5 A;  2MF4 A;  1PGJ A;  1ZXG A;  5AVW B;  2KLU A;  3GHG B;  3SFE C;  1ZR2 A;  1IC2 A;  4U0C A;  4PD4 I;  3G28 A;  1R8E A;  2FY8 A;  2ERH A;  4R4L A;  3OA7 A;  2W6J H;  4C7N A;  1GU4 A;  1SQX E;  2YXQ B;  3IF4 A;  3PRJ A;  3A0B H;  2K37 A;  2LOL A;  1KQF B;  3AE2 C;  1RY3 A;  1W2E A;  5KJ7 C;  4F37 A;  3AEE C;  3G6E P;  1VQ8 P;  3D70 A;  3L70 G;  4CA3 A;  3L72 E;  3S9O A;  2IFN A;  3L71 G;  1FR2 A;  3AE9 C;  4YPC A;  1GL2 A;  1FZC A;  3RK3 D;  1SP4 A;  3F5H A;  3CXH H;  4N6J A;  2XZ0 D;  4PV1 C;  2OYI A;  1MFT A;  1JY2 O;  2B88 A;  4D6T D;  1KMI Z;  1JOC A;  1JMB A;  5E79 E;  3WUT A;  2BHV A;  2W8Z A;  5KKZ B;  3HE4 B;  1GD2 E;  5B5E H;  1XTC C;  4EYY Q;  5HVC A;  2J59 M;  1KIL A;  5AVQ B;  1AUM A;  1NU1 K;  3V4Q A;  4PH0 A;  3G1I A;  1FJK A;  1OW7 A;  2GDY A;  3WU2 H;  3GF3 A;  3AEF C;  3U1C A;  3H1K J;  2KG8 A;  2FAC A;  5GTI E;  5HGM A;  3LW5 J;  1NTK D;  3H1L E;  1LTJ B;  2E42 A;  3VMA A;  1SQB K;  4RES B;  2JBG A;  1FZG A;  1DX7 A;  1KIL D;  4IL6 X;  2KZI A;  2K0D X;  1QX8 A;  2KNC B;  1IMP A;  1CI6 B;  2IBZ E;  3LID A;  2JYL A;  3KZI H;  5BU5 A;  2M8L A;  2MJZ A;  2FYU D;  2JO1 A;  1VQ5 P;  1SFC A;  4U0D A;  1KQS O;  2K92 A;  2ZT9 B;  4H13 B;  3V5B A;  1IK9 A;  1AQ5 A;  4HJG H;  2N50 A;  2OAR A;  3HTK A;  2LTE A;  2N1T A;  3GJN A;  1DD3 A;  1J1D B;  2PEJ A;  5APV A;  2AXT H;  3F89 A;  4N78 E;  1QRJ A;  4GOD A;  1LT9 C;  1P84 I;  1RF1 C;  1KB9 I;  3CE7 A;  4IFM A;  4KJM A;  2W90 A;  1JCD A;  1GMJ A;  5EFW B;  2X2B A;  2KZJ A;  3H1I D;  2N1T D;  5M1B A;  2KGE A;  1GW4 A;  3LMO A;  1A02 F;  2K0X A;  2H88 C;  2LIU A;  3A0H E;  3HUS C;  1Q90 D;  5EJD A;  2KOG A;  1LWU A;  3OJA B;  2MR8 A;  5B66 E;  1DV5 A;  2KGA A;  4OGQ B;  2WSF H;  1D7M A;  2EFJ A;  2JYG A;  2YXR B;  4L73 A;  3FGA D;  3H1I J;  1Q7Y Q;  1KQL A;  3H1H E;  4IL6 E;  2HOD B;  2Y0D A;  2BEQ D;  1R5L A;  1HF9 A;  1AF8 A;  3CX5 I;  1SQP G;  1AV1 A;  2GZJ A;  3P05 A;  3SWK A;  1OIP A;  3ABV C;  1NWQ A;  2L9F A;  3L70 D;  1JY2 P;  1KTM A;  3DS4 A;  3M9H A;  5CJ4 A;  3S4R A;  2E75 D;  3SWY A;  1M56 D;  2M5R A;  4WWI A;  1EDI A;  1PEO A;  4BWN A;  1PP9 E;  5CBO A;  5HGN A;  2M5A A;  5AVY B;  2AEM A;  3NMD A;  1JB0 J;  1FJP A;  3MP7 B;  1CI6 A;  2NZ2 A;  2JO0 A;  1DNY A;  1GZL A;  1JO5 A;  1BGY J;  3L71 J;  3USS A;  2QIW A;  4CPG A;  3CCM P;  4RO0 A;  4JPZ B;  3CCS P;  1QL2 A;  1VF5 C;  3TNU B;  3TGU G;  4IFD K;  1N7S C;  3AE4 C;  1GK4 A;  2E43 A;  5CBN A;  2KGC A;  2K5X A;  1CEI A;  3L75 E;  3N4X A;  2RKL A;  3UIA A;  2H89 C;  3HD7 C;  1HGV A;  2ZT9 D;  2J58 A;  1AYI A;  1VQP P;  1OVU A;  4PWV B;  3G0V A;  1YTZ I;  3Q3D A;  3LRY A;  1MV8 A;  5CJ0 A;  1EXI A;  4BPG A;  1NTZ D;  3B5N B;  3FXE A;  2WSC J;  3MGN A;  1KYO E;  3CXC O;  2AFE A;  1G1I A;  2NPS C;  1SQQ D;  3TYY A;  2ZXE B;  5GTI H;  5H2F H;  5HGO A;  1NU1 E;  3DTJ A;  1L0L K;  4BRY B;  1BE3 G;  2IYP A;  1IFP A;  1PEU A;  4AUW A;  1ZP0 C;  3A5T A;  4EDF A;  2R3C A;  1XTG B;  3GZL A;  4IFF A;  5KAF H;  2QE7 H;  1SQB E;  2Z44 A;  1EDJ A;  3L35 A;  5TJH A;  4OGQ D;  1U57 A;  2ZVN B;  2LKM A;  1M1J A;  1BCC E;  2ZXX A;  1K8A Q;  2FXP A;  5KP6 B;  5CCG D;  3A0B E;  1PGP A;  1MZ8 A;  2WSC H;  5HGL A;  1JM0 A;  2CK3 H;  4GOE A;  2MY5 A;  2A06 E;  1SQV J;  2BEZ F;  5BS2 A;  4O9B A;  1Q86 Q;  1LP1 A;  2BCC E;  2Q6Q A;  4PD4 D;  1SQP D;  3GW6 A;  3VTP C;  1DH3 A;  2HPC B;  3WUU A;  1T8K A;  2PEM A;  3CXH E;  1LT1 A;  1ZME C;  4I7Z C;  1L4A B;  4U3F D;  1ZRT E;  1RE3 C;  1NTM J;  1IJD B;  1ZMB A;  5B5E E;  3U43 A;  3CWB J;  1FU1 A;  2FYN C;  4H0L C;  5AVX B;  4DZO A;  4GR2 A;  3EFF K;  3WU2 E;  3SWF A;  2O1J A;  2LML A;  2E74 B;  4XFZ A;  2FXO A;  3L73 J;  3AED C;  2WSE J;  2R32 A;  2O01 N;  4LC1 A;  5GTH H;  4OH8 B;  4N3Y B;  3KZI E;  4C7N B;  1FBM A;  1S5L H;  3CC7 P;  4UB6 H;  2WPR A;  1OFC X;  1JNM A;  1RQV A;  2D2C D;  2B87 A;  2C0X A;  2K93 A;  2XZ1 C;  4WY4 A;  4ZKP A;  1DEE G;  2I1J A;  1X22 A;  3Q20 A;  3H1K E;  2QJK B;  1SLQ A;  1AVY A;  3CPW O;  2KOQ A;  1A02 J;  3RK3 E;  1H89 A;  2FQ0 A;  3CC4 P;  5CZD B;  1E0H A;  1GL2 B;  1FZC B;  3CI9 A;  3RBX A;  2WSE H;  3RL0 B;  3B5N D;  3VP9 A;  2JR8 A;  1D1D A;  2KSJ A;  3TGU J;  1NTK G;  2IBZ I;  2OYI B;  1OMI A;  2DGY A;  2HR3 A;  1CZQ A;  1NO4 A;  4WY4 D;  3IN6 A;  1L0N G;  1YYC A;  1EIA A;  1HBW A;  4GR6 A;  3P8M C;  2PEI A;  3RK3 C;  2GZE A;  1Y8A A;  4U0B A;  1SQV K;  3L74 G;  1KB9 D;  1EMV A;  2FYU G;  3CME P;  4JYC A;  4L76 A;  2IPP A;  5K5G B;  2QJP B;  3TSI A;  1RF0 C;  1YQ3 C;  3H47 A;  3Q5P A;  2FXM A;  2HG5 D;  5AW5 B;  2NRG A;  3WBH A;  4WBA A;  1AFO A;  2JDI H;  1NTM K;  2V4H A;  1FDO A;  5KLI C;  2JJL A;  3O8Z A;  2GZI A;  1BSN A;  2IZ0 A;  1BE3 J;  2Y0E A;  1JY3 N;  1OVR A;  3L37 A;  4XRO A;  1SFC B;  1JUN A;  3H1J G;  3L36 A;  1N73 C;  1VDF A;  2ZYA A;  3HTK B;  2AF8 A;  2N1T B;  1PZQ A;  1T8Z A;  4TLF A;  1KLP A;  1HY8 A;  1KQG B;  3VRL C;  2LKI A;  1Z6M A;  4PXH B;  4Y28 J;  1EZV E;  2OYH C;  2ZJS E;  3GG2 A;  3CX5 D;  2KOD A;  2FAE A;  1USD A;  2K9J B;  3MD0 A;  4QKO A;  4XRQ A;  1URQ A;  1PPJ E;  4UHP B;  2B89 A;  3V2R A;  2E74 D;  2NO8 A;  1VKU A;  1P84 H;  2R5B A;  2KOO A;  4PV1 B;  1M74 A;  1LWU B;  5KLV D;  1NHL A;  3EJB A;  2XKM A;  1A43 A;  1S9K E;  1URQ D;  1OZH A;  3L72 G;  3V4W A;  1E79 H;  3A2A A;  1X9V A;  1NH4 A;  1WT6 A;  1IMQ A;  2YKP A;  3M0D C;  2KGD A;  1PGQ A;  1HGZ A;  3MUD C;  1EQ7 A;  1T2K D;  3GHG C;  3BRT B;  1QVG O;  2E75 B;  1JJ2 O;  2C0W A;  1S1C X;  1NJI Q;  1NKN A;  3HE5 B;  5AVR B;  4GDO A;  1S3J A;  1BGY E;  3L71 E;  1VQK P;  1GL2 D;  1M57 D;  2EIA A;  1YJ9 P;  3FWL A;  3RL0 D;  3IAO A;  4U0A A;  5DCK A;  1PEQ A;  2LXC B;  5H2F E;  3BAT A;  1Y47 A;  1YQ4 C;  2AVA A;  3NTN A;  2XND H;  1UNK A;  1KFM A;  1L0N D;  1LTB C;  2FBW C;  4D6T J;  2M5A B;  5KAF E;  4WYM A;  2IBZ G;  2N6Y A;  2WT7 A;  1S5L X;  2Q3E A;  3L74 D;  2XXM A;  5AW4 B;  1GXG A;  1AJY A;  3H0D A;  1KYO I;  2N5I A;  1IZN B;  5KKZ C;  2CQ8 A;  1JTH B;  1NTK J;  2N5H A;  1T3U A;  2JU2 A;  3P8C E;  1MZ9 A;  1FAV A;  1L0N J;  2JU1 A;  4H2Y C;  1FC2 C;  1NTZ G;  3B4Q A;  3BCC D;  4U0F A;  1NAF A;  4AQR D;  4UB8 E;  2M3E A;  3KPE A;  3LW5 H;  3HUS B;  1F80 D;  2VLP A;  1M1K Q;  5APT A;  1SQQ G;  2OQQ A;  1LTJ C;  1SFC D;  3I56 P;  1QEX A;  5KJ7 A;  4XA4 A;  1ACP A;  2W6A A;  2PEO A;  3L74 J;  1GK6 A;  2FYU J;  3H1J D;  3H4E A;  2WPV B;  5AVT B;  1SS1 A;  2XT1 A;  2K9J A;  2Y9Z A;  1BDC A;  1ZR4 A;  2FVF A;  1FZE A;  2GA1 A;  3ZDM A;  4A7P A;  1Q2N A;  5KJ7 D;  2HYN A;  1Q82 Q;  3NTE A;  4H13 C;  1OVV A;  4NEO A;  3E1R A;  1UIX A;  1SQV E;  1J1D C;  2QSI A;  2IYO A;  2MD9 A;  2M0B A;  2N6Z A;  1T3J A;  3CXH I;  3H1H G;  1SQX D;  5C39 A;  1BDD A;  3IR9 A;  1LJ2 A;  3C8V A;  4PV1 D;  2AFD A;  4JF7 A;  3Q2Y A;  5GTH E;  2CG5 B;  1VL2 A;  3H25 A;  1KV4 A;  1M1J B;  1S5L E;  3GMA A;  1NTM E;  3HE5 A;  4UB6 E;  2Y9Y A;  2GZF A;  2YO3 A;  2EG5 A;  4U3F G;  3L72 D;  3CWB E;  4BPH A;  3E1I A;  1X8Y A;  1ZW0 A;  5CCH C;  1LP1 B;  2ZAE B;  1N7L A;  2OGU A;  2K2Q A;  4OGQ C;  1X3O A;  2XV6 A;  3L73 E;  2Z5H A;  1N7S B;  5AW6 B;  5CCG C;  4GKG A;  3RK2 C;  2KK7 A;  3P7K A;  4IZ6 A;  2L91 A;  1IK7 A;  2RN0 A;  2Q5U A;  2KW2 A;  1RNI A;  2PFX A;  2XU6 A;  1AQT A;  1LT9 A;  1K30 A;  1RF1 A;  1OXZ A;  2WIT A;  3L70 J;  3C1L A;  2ONT A;  1CSB A;  1NTK K;  1U7J A;  3H1L D;  1LTA C;  3M9B A;  3EFG A;  1OW6 A;  2W27 A;  3MHV A;  2FQ1 A;  1JTH A;  1NOH A;  4YTP C;  3VMZ A;  2KI7 B;  2QM7 A;  1NYH A;  3HRN A;  1PGO A;  1YHQ P;  2IBZ D;  5EW5 E;  2V7Q J;  3HUS A;  4M0I A;  2SPZ A;  4I6M C;  4DOJ A;  2FYU K;  2D2C B;  3PJS K;  4WVZ A;  3CCL P;  1G2C A;  4KHX A;  1A8O A;  3TDK A;  1VQ6 P;  1WRG A;  4ASV A;  1EOQ A;  2R3S A;  2E1M A;  3EWK A;  3TGU E;  1OWA A;  1JMM A;  3VN0 A;  1MUU A;  3G21 A;  3G26 A;  3CCQ P;  4N78 D;  3GZM A;  2MKV A;  3PTZ A;  2E76 B;  1X79 B;  1RQU A;  2B87 B;  2QJY B;  4WY4 B;  1NU1 G;  1FE6 A;  3CCU P;  2YMK A;  1Y9B A;  4QNB A;  3FX0 A;  2V7Q H;  5KAI H;  2GDX A;  5JPA A;  1SQB G;  2MVU A;  3DS0 A;  1L0I A;  3VMX A;  1NTZ J;  4Z1M H;  3SFD C;  1RHZ B;  1NVO A;  1BCC G;  1BE3 E;  1SQQ J;  3CCV P;  1GXH A;  2JB0 A;  1P84 E;  1YTZ T;  2IX7 C;  2Z45 A;  2P1J A;  1NKZ B;  1FZF A;  3B5N C;  3II6 A;  2PP6 A;  1AA0 A;  3H1H D;  4UB8 H;  3Q1M A;  4XFJ A;  1EZV I;  3EQ2 A;  1RE4 A;  1QL1 A;  2PGD A;  1U7M A;  4JQ0 D;  1JCC A;  1ZNV A;  1N7S A;  3AEA C;  2H8P D;  3CCE P;  2WTY A;  1FOS E;  3G9R A;  2P10 A;  2IDB A;  1H88 A;  2O1K A;  3HD7 A;  2FFD B;  1VF5 D;  1USE A;  4ASW A;  3M9Q A;  3D6Z A;  1N7S D;  2JKV A;  2DW3 A;  5HV8 A;  2QA4 P;  1W2B O;  2VLN A;  1SQP J;  1M90 Q;  2KLV A;  3G29 A;  2KSE A;  3H32 A;  2GYK A;  3HZQ A;  1YIT P;  2B9B A;  2J5U A;  5KLV G;  2ZYG A;  3CX5 E;  4U3F J;  2FVE A;  4H2W C;  3O6Q B;  3HD7 D;  3FXD A;  2NPS A;  4BPF A;  2CPS A;  1HJB A;  3M91 A;  1VQ4 P;  4DJG A;  1J1E B;  1URQ B;  1ZLL A;  1T6A A;  4PH1 A;  1L4A C;  3T97 B;  3B71 A;  1KFN A;  1AVO A;  4H44 B;  3NY7 B;  4Y99 C;  5AVS B;  1UJZ A;  3AE6 C;  2NPS D;  3L75 D;  4W7Y A;  3VP8 A;  1S72 P;  2LIW A;  2XDJ A;  5AW9 B;  3H1K G;  2QM8 A;  1PV3 A;  4PD4 H;  3RBZ A;  2BUO A;  1YJN P;  3D71 A;  5AW7 B;  3Q5S A;  5APU A;  2E74 C;  1HTL C;  1E6J P;  4MRT C;  2E76 D;  4D6T E;  2YO2 A;  2ZFC A;  3V2Q A;  3DPH A;  2QRX A;  1KYO D;  1Q81 Q;  1SQQ K;  3RG2 A;  1R5S A;  1NU1 D;  1W5C E;  2YIU B;  2YKQ A;  1VQO P;  2YMY A;  5KLI B;  1HJ0 A;  3HYB A;  2KYV A;  3MGE A;  1NTK E;  1M7L A;  1T2K C;  1RE3 A;  1IFJ A;  4AYC A;  1SQB D;  4PJ0 E;  2ITA A;  4HH2 A;  1L0N E;  1KIL E;  4EI2 A;  5TIS H;  2JQ4 A;  1HH0 A;  3RGU A;  1BXI A;  2WPT A;  1OX3 A;  2PRR A;  1BCC D;  1VPC A;  2Q9I A;  3BCC G;  1GL2 C;  1FZC C;  3NFQ A;  2FVA A;  1EDK A;  3WMM 0;  5L8R J;  2P9X A;  2KIK A;  3AE8 C;  4C46 A;  2WT7 B;  2FYU E;  2OYI C;  3CL3 D;  3OAK A;  2K0Y A;  3OW2 O;  2JWD A;  2P7J A;  4JBZ A;  1HUC A;  2K88 A;  4LGD E;  3VYI A;  1KIL C;  2WPS A;  2FFD A;  3G1G A;  1GW3 A;  1SQP K;  2ZVO B;  4H2X C;  3CXH D;  2K3R A;  1ZN5 A;  2P67 A;  4GT1 A;  2BQ1 E;  2UWJ E;  1BCC J;  1VQ7 P;  2KS1 B;  1ZRT D;  3QWO C;  1L0L G;  1QGK B;  3B4S A;  1EZV G;  2QJP C;  2M8P A;  2I8D A;  1GU5 A;  5AW8 B;  4K3A A;  3CMA P;  3O6Q A;  5AW0 B;  3H1I E;  1KOR A;  2WZ7 A;  2FAD A;  1BSH A;  4RJT A;  1LNQ A;  1UII A;  1VQ9 P;  1KZU B;  1PFI A;  1SQX G;  1L0H A;  1MFZ A;  5APW A;  2OTJ P;  2QEX P;  3T97 A;  4YXD C;  1KC8 Q;  3GKL C;  1RO0 A;  2PEK A;  1KB9 H;  5APX A;  1SFC C;  4TT3 H;  3ITK A;  1YJW P;  3U1A A;  2FHS C;  3I55 P;  3B8E B;  3JCU H;  1G1J A;  2JGP A;  7CEI A;  2E5Y A;  2N1T C;  3IFM A;  2PAJ A;  4YXW H;  1H0T B;  2EHS A;  1N8R Q;  3PLN A;  5APY A;  4KT0 J;  4H44 D;  3Q5R A;  3D6Y A;  1Z56 A;  3AE7 C;  4U0E A;  3DS5 A;  2GUS A;  3G4S P;  2KB7 P;  2K9Y A;  1RF0 A;  2Y0C A;  1JEK A;  3BRV B;  5KLV J;  4DCK A;  4NPF X;  2R44 A;  3H1K D;  3L70 E;  2GUV A;  1BGY G;  2WWW A;  2KUB A;  4NPD A;  1RH5 B;  2YKO A;  2GDW A;  3C9I A;  2MVV A;  1LWU C;  5DJT B;  3H1L G;  3RG6 C;  2IZ1 A;  5CMZ A;  5APS A;  3CX5 H;  2AEJ A;  1N73 A;  2POH A;  5BS1 A;  4XE5 B;  3CCR P;  4EIJ A;  5KAI E;  2KXP B;  3E7K A;  1JY2 N;  1ZV8 A;  2HLO A;  1EDL A;  2CNR A;  1SVF A;  3R4Y A;  3MTU E;  1LT9 B;  1RF1 B;  2XZR A;  3U59 A;  3CLQ A;  1MKM A;  5APQ A;  2E75 C;  1JY3 P;  2OYH A;  2HFE D;  2XV5 A;  1N86 A;  2A45 I;  1GTW A;  1IFI A;  1DEB A;  2LL8 A;  3BAS A;  5KTB A;  1IUQ A;  2KOR A;  1TU3 F;  2KS1 A;  4W80 A;  3WUV A;  1FDI A;  1LTS C;  3PH0 A;  1L2P A;  5F2N A;  1G2C B;  4I1L A;  2PEQ A;  1NQ4 A;  5KP7 B;  3P32 A;  2WSF J;  5F2O A;  1VQM P;  2CGQ A;  3DS2 A;  4K35 A;  4XFY A;  1NTZ E;  2W6B A;  1YBK A;  3M0D A;  2K94 A;  3G3Z A;  1SQQ E;  2O01 J;  3MUD A;  3BCC J;  3GHG A;  1L0L D;  3E2D A;  1DD4 A;  1EZV D;  2AEF A;  3JSV C;  1EXJ A;  2QNW A;  1PL5 A;  2ZT9 C;  3A3Y B;  5I4T G;  4PJ0 H;  5AVU B;  2G8Y A;  2DNW A;  3KQG A;  2C9N Y;  1SQV G;  1IO4 A;  3H1J J;  1HVV A;  1PPJ D;  5AVZ B;  1H0T A;  4GOF A;  3I5C A;  1NGM B;  2ZYD A;  3M1M A;  1IFM A;  5BU8 B;  4HB1 A;  1K9M Q;  3DS1 A;  5KLV K;  2FQ2 A;  4HKG A;  2LXB A;  4IPY A;  1L0L J;  1NTM G;  1WMK A;  1S9K D;  2L0Q A;  1K04 A;  2W83 C;  3RK2 B;  3LIE A;  3CWB G;  2O01 H;  3M06 A;  2PY8 A;  3B5I A;  5KP8 B;  4GIF A;  2Z5I A;  4XFX A;  4PD4 E;  1SQX J;  1SQP E;  1IFD A;  4DT0 A;  2GM4 A;  3HE4 A;  3L73 G;  1BAJ A;  1K05 A;  5CHX A;  1VF5 B;  4L75 A;  2WQY C;  2KG9 A;  3G71 P;  1PP9 G;  3KDP B;  1NAY A;  1YIJ P;  4U3F E;  3S1K A;  1BGY D;  3L71 D;  2Q1K A;  2WMM A;  5AVV B;  3H6P A;  3AEG C;  4ZNC A;  3L72 J;  2ROQ A;  1LTJ A;  1FZB A;  3HD7 B;  4RKU J;  2LR2 A;  5AW3 B;  1M1J C;  1L0N K;  2KNC A;  3MZW B;  1GPJ A;  3H32 B;  2JAZ A;  3FWN A;  3L75 G;  2JWA A;  5TIS E;  2NPS B;  2VLO A;  1RE4 C;  3PHL A;  2VRS A;  4M3L A;  3H1L J;  1M6E X;  1E5W A;  1FOS F;  3CC2 P;  1PIX A;  1IFN A;  3P8C D;  3SSU A;  3EJE A;  1M6N A;  2Q3I A;  3R2P A;  3DS3 A;  2A45 G;  4H13 D;  4IOI H;  4WB4 A;  2BAS A;  4R4M A;  3VMY A;  1X0T A;  5E79 H;  3GF7 A;  2VLQ A;  2I1K A;  2H7H A;  2M3B A;  2D2C C;  5CCH A;  2YNY A;  4OVN F;  2O3J A;  4NPE A;  1GDT A;  1QLE D;  1FDM A;  5CCG A;  2L22 A;  2FYZ A;  4I7Z B;  1SQV D;  1KB9 E;  2WPQ A;  2C9L Y;  2JEE A;  1SQX K;  2A06 G;  2E76 C;  2HOD A;  2QJY C;  3JCU E;  2WVR A;  5CCH D;  5DJU B;  4WY4 C;  1LGH B;  2BCC G;  2L6E A;  3KXD A;  2FYN B;  3KHU A;  4H0L B;  3TK1 A;  1J2J B;  2L5G B;  1N2D C;  3W67 A;  3RK2 D;  1NTM D;  2RH0 A;  4C7R A;  3AEB C;  3V2N A;  5BVZ A;  3CWB D;  2QG4 A;  4R0M A;  5AW1 B;  2MR7 A;  1RO2 A;  2AXC A;  2M8R A;  3H1H J;  3NXS A;  1QVF O;  3L73 D;  3V6I A;  4ZKU A;  2IFM A;  2KOP A;  3KYQ A;  1PP9 D;  2G3A A;  2K1A A;  4Y99 B;  3A0H H;  2GZG A;  1LTG C;  2WSS H;  4U7J A;  2E5T A;  5B66 H;  3TNU A;  4QMA A;  3K5B A;  3M0A A;  1VHN A;  4W7Z A;  4OWF A;  5KLV E;  1PP9 J;  4IL6 H;  2FFD C;  1PEM A;  3RL0 g;  1HWT C;  3TGU D;  1HQB A;  2LF4 A;  2PEN A;  3RK3 B;  2R5D A;  4MN4 C;  3B5N A;  1VQL P;  4D6T G;  1NTZ K;  1CW5 A;  1ZOY C;  1S4X A;  3CD6 P;  4JYB A;  3PP5 A;  2EHT A;  1J1E C;  2AXT E;  3L75 J;  4BRY A;  1URQ C;  2JP3 A;  3AE3 C;  1VQN P;  4HKZ H;  3MIW A;  1YI2 P;  2RMZ A;  4BXL A;  3V2P A;  2PNG A;  3TF5 A;  3VOP A;  4H44 C;  4COC A;  1OW8 A;  1LTI C;  4EOT A;  1LTT C;  1FS0 E;  1H8A A;  3BVH A;  2KR5 A;  1N73 B;  2M8N A;  2H43 A;  1KIL B;  2QJK C;  3AEC C;  3GLM A;  1BE3 D;  1JY3 O;  1M8O B;  3EJD A;  1NU1 J;  3AE5 C;  1P84 D;  2LPK A;  2OTK E;  3RL0 C;  2CPB A;  3L74 E;  1DIP A;  1S2E A;  2P58 A;  2A06 D;  2OYH B;  2N9B A;  2CWO A;  4B86 A;  3L4F A;  2YIU C;  2P2U A;  4H0L D;  3CCJ P;  1SQB J;  2BCC D;  2OYO A;  2HPC A;  2VSQ A;  3BCC E;  4ZMD A;  4LLH A;  1L4A A;  5F2K A;  3JC2 2;  2Q7C A;  2N98 A;  3A7O A;  2KG6 A;  2L4B A;  1KN7 A;  3QH9 A;  3H1J E;  3W68 A;  2KWL A;  1KYO H;  3H1I G;  4HYT B;  4COP A;  2A45 H;  4DG9 A;  2FKW B;  4I2L C;  5AW2 B;  2Z46 A;  2N9Y B; 
#chains in the Genus database with same CATH homology
 1KD1 Q;  3MGE A;  3CCL P;  3P05 A;  1VQL P;  1A8O A;  5F2O A;  1VQM P;  5HGO A;  1N8R Q;  1VQK P;  1VQ6 P;  3DS2 A;  3DTJ A;  1K73 Q;  1EOQ A;  2L6E A;  2EIA A;  4XFY A;  1YJ9 P;  2E1M A;  3CD6 P;  2OTL P;  2JYL A;  4U0A A;  5DCK A;  2M8L A;  4XRO A;  1PEQ A;  1PEU A;  4U0E A;  3DS4 A;  3DS5 A;  3G21 A;  3G26 A;  3G4S P;  4U0C A;  1VQ5 P;  3G28 A;  1VQN P;  4U0D A;  3CCQ P;  2QA4 P;  1KQS O;  1YI2 P;  1W2B O;  3CC7 P;  3E2D A;  1M90 Q;  3G29 A;  3HZQ A;  1YIT P;  2Z44 A;  5I4T G;  2P9X A;  2OAR A;  4WYM A;  1PEO A;  3VRL C;  1RO2 A;  4COC A;  3CCU P;  2PEJ A;  5HGN A;  1QRJ A;  4QNB A;  1M6E X;  2EG5 A;  3OW2 O;  3CC2 P;  1QVF O;  3Q20 A;  1K8A Q;  1VQ4 P;  2M8N A;  2KOD A;  3RG6 C;  3CPW O;  2XXM A;  3M1M A;  1M6N A;  4PH1 A;  2JO0 A;  5JPA A;  3H0D A;  3G1G A;  3G6E P;  5HGL A;  1VQ8 P;  3CC4 P;  1K9M Q;  3DS1 A;  4XRQ A;  5BS1 A;  3CCR P;  3DS3 A;  3DS0 A;  3CCM P;  1D1D A;  5BS2 A;  4IPY A;  2XV6 A;  1Q86 Q;  2BQ1 E;  3CCS P;  2DGY A;  1VQ7 P;  4U0F A;  1S72 P;  1M74 A;  2M8P A;  1EIA A;  3CCV P;  2CWO A;  1M1K Q;  2BUO A;  2PY8 A;  4GR6 A;  2PEM A;  3CMA P;  1RNI A;  1YJN P;  2Z45 A;  3CCJ P;  3B5I A;  1K30 A;  1A43 A;  2BHV A;  3I56 P;  4XFX A;  2ONT A;  2PEI A;  2PEO A;  1VQ9 P;  1AUM A;  3H4E A;  4PH0 A;  1ZMB A;  2XT1 A;  5F2K A;  3G1I A;  1BAJ A;  1E6J P;  2EFJ A;  4U0B A;  3CME P;  1VQP P;  2OTJ P;  2JYG A;  3DPH A;  3G71 P;  2QEX P;  1KC8 Q;  3G0V A;  1RO0 A;  2PEK A;  1Q81 Q;  1IUQ A;  1YIJ P;  4GR2 A;  3LRY A;  5HGM A;  1PEM A;  1YJW P;  1Q7Y Q;  1QVG O;  3I55 P;  1YHQ P;  3H47 A;  1JJ2 O;  4COP A;  3CCE P;  2LF4 A;  5F2N A;  1VQO P;  2Z46 A;  1NJI Q;  3WBH A;  1Q82 Q;  3NTE A;  2PEN A;  2PEQ A;  4M0I A;  4XFZ A;  3CXC O;  3HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...