3CCLP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535c. density for anisomycin is visible but not included in model.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cclP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cclP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cclP02
1Q81Q 1VQ7P 3I56P 3CC4P 1Q82Q 2OTLP 3CCEP 3CCUP 1VQ8P 1VQMP 1N8RQ 1JJ2O 3CCJP 1VQPP 3CCLP 1YJNP 3OW2O 1S72P 3CCMP 3CPWO 1VQ4P 3CC7P 1KC8Q 1VQLP 1QVFO 1Q7YQ 3G71P 3I55P 1YIJP 1Q86Q 1VQ9P 1YHQP 3CCQP 1YJ9P 1NJIQ 3CD6P 1VQ5P 1K73Q 1KQSO 1VQOP 1YI2P 2QEXP 1M1KQ 1VQKP 2QA4P 3CC2P 1YJWP 1VQ6P 1VQNP 1W2BO 1M90Q 1KD1Q 1QVGO 3CCVP 1YITP 1K8AQ 3G4SP 2OTJP 3G6EP 1K9MQ 3CMEP 3CXCO 3CMAP 3CCRP 3CCSP
chains in the Genus database with same CATH superfamily
1VF5D 3H1KD 2QJKC 5APUA 2E43A 2CGQA 1OVUA 4BPFA 3A0HE 2MD9A 4XFJA 1AVYA 2ZYAA 2IX7C 1L0LG 5AW8B 2N98A 1Q81Q 3H1IE 1KQGB 2E1MA 2MJZA 2PNGA 2WSEH 4U3FD 2L91A 1VQ9P 2CK3H 3M1MA 4H2XC 2J59M 3A5TA 4NEOA 5BS2A 2KOSA 1NGMB 2P1JA 2E75D 2KSEA 3TDKA 2HPCA 2K94A 1A02F 2PY8A 1S5LE 1FOSE 2W8ZA 2KOOA 2ZXXA 3H32A 2M8PA 1EZVG 2BCCD 1GXGA 1GDTA 1L0NK 4KHXA 2MVUA 2JYGA 2JU1A 2QJKB 2Z45A 2A45H 1H8AA 3SWKA 2J58A 2IFMA 1NTKE 1KB9D 1SFCD 2LIUA 2W83C 3GHGA 3KQGA 3CLQA 3SFDC 4MRTC 2PEIA 1EDLA 4UB8H 4JYCA 1NO4A 1YQ4C 2FY8A 2GYKA 1J2JB 2KG8A 2QG4A 1OW8A 1M56D 3GW6A 2FACA 2M0BA 2JDIH 2P67A 1HQBA 2IBZD 3H1IG 3CCVP 2YXQB 3BRVB 3NMDA 2JR8A 3HD7A 2IDBA 2ZJSE 2EHSA 1YBKA 2LKMA 1RF1C 1VQMP 1FBMA 2OYIC 2K5XA 3H32B 4QMAA 1LTSC 1E0HA 3L75D 3RL0C 5BU8B 2N1TC 1SQVD 4H13D 1GD2E 2CNRA 3CXHH 4WY4C 2NPSD 2C9LY 4I1LA 5KJ7C 1RQUA 2SPZA 2E5TA 1KQFB 2Y0EA 3GHGB 1SQQK 3HE5A 4EI2A 1VQLP 2ZAEB 5KJ7A 4DCKA 3JCUE 2JYLA 2H43A 3M9BA 2LXCB 1AQ5A 1MFZA 3A2AA 1AFOA 3U43A 1ZW0A 1CI6A 2A06D 3SWFA 1VQ7P 3HD7B 2YKOA 5CBOA 1EDIA 2HODA 3PLNA 1ZP0C 1EZVD 1L2PA 2Z46A 1PEMA 5APYA 2XXMA 4PV1D 1T2KD 2PP6A 1FC2C 2OTJP 1VHNA 4L75A 3RK2B 2QJYC 3II6A 3RL0B 2H8PD 2PEQA 3L70D 2KGAA 2BEZF 2GM4A 3HE5B 4EOTA 2Z4EA 4WY4B 3V2NA 2KLUA 5APXA 1NQ4A 3Q20A 1SQXG 3H1JD 2FKWB 2AFEA 3CD6P 1NTMD 3E1RA 2K9JA 2ZT9B 3P05A 2VLOA 2QIWA 1CI6B 2QVAA 4NPEA 1FR2A 4RJTA 1QLED 1KILE 2WMMA 2HODB 2Q7CA 3V4WA 1S5LX 1T3JA 3E7KA 3KZIE 1IFMA 5CCHC 1YJWP 1RE4C 2ZYGA 5GTIH 2KOGA 4JYBA 2LPKA 1M1JA 4D6TG 1NH4A 2RH0A 3V5BA 2XV5A 5CCHA 2CPBA 1RE4A 2L6EA 1SFCC 1OXZA 3G26A 1SQVK 2YMYA 5CCGA 1CSBA 1NTKD 1N7LA 3KDPB 2K9JB 3A0HH 1GK4A 4NPFX 2K37A 2QM8A 3O8ZA 2P9XA 5AVUB 2PENA 3B4QA 1KMIZ 1LTJC 4Y99C 3BVHA 3G71P 2WSEJ 5F2KA 4U0CA 3NTNA 2M8NA 1BGYD 1X9VA 2V4HA 3H1LJ 1RF0C 2MF4A 1FZCA 3LW5H 2YMKA 1IK9A 2XT1A 5AVVB 1T8ZA 4M3LA 1JB0J 1NU1D 1SQBK 3H1KJ 2FVAA 3AE1C 1A8OA 3D6ZA 1L0NE 3PP5A 1LNQA 3VN0A 1JMMA 1GU4A 2BUOA 1AYIA 1Q7YQ 3CX5I 1NTMK 2IZ1A 4ZKPA 2VRSA 3B4SA 2LXBA 4U3FJ 2BHVA 2AEMA 2VLNA 1FZCB 2K93A 1J1EC 1T2KC 5M1BA 1RHZB 2B89A 3VTPC 3C8VA 3EQ2A 1JMBA 4ZMDA 2YXRB 1GK6A 3RBXA 4XROA 3GG2A 1IJDB 3PJSK 2BCCJ 2D2CB 1ZNVA 1ZN5A 1KFNA 3H1KE 1X8YA 3W67A 3MIWA 1FS0E 3EFGA 1QX8A 1SQQE 2KGEA 1KQLA 3V2PA 3P32A 1IFJA 1KILD 1F80D 2FXPA 3TGUJ 4UB8E 1FDIA 1DH3A 2E74D 1HUCA 4H0LC 3MTUE 1EDKA 4PWVB 2FYZA 5BVZA 2QJPC 4DT0A 1GMJA 3RK3B 4U3FE 4IL6E 3B5NA 2C0WA 1J1EB 1N7SC 2ITAA 1N2DC 2YO3A 1PP9E 4OVNF 3CXCO 4N6JA 3L75J 2WSFJ 3PHLA 1SQVJ 2AXCA 3MGEA 4GOEA 1LWUA 1TU3F 1N7SA 1L4AD 1NTZD 1KC8Q 1NKZB 3H1LG 1Z56A 1NU1K 3VRLC 2WPVB 2M8LA 2P10A 1PIXA 2BCCE 4IFFA 1E79H 2KK7A 4UB6E 5AW6B 4A7PA 4R0MA 3H1KG 2KNCA 4KJMA 4IOIH 1KB9E 5AVTB 3NTEA 1S72P 3Q5PA 2A45G 1YIJP 2FYNC 2LF4A 2KUBA 2W90A 3B5NB 2JU2A 3TGUE 2JP3A 3MUDC 2QJPB 2IBZE 3DS4A 1LWUB 1N7SB 5AVSB 4U3FG 1U7JA 1N73A 1L0ND 2KOQA 2XZ1C 3L70J 2XKMA 3L75E 1SQVE 4IPYA 2H88C 3HD7D 3H1JJ 2GZIA 3UIAA 3VMXA 1RH5B 2Z5IA 4BPHA 1NTMJ 5C39A 2I8DA 1JY3O 3B5IA 2KODA 1RQVA 2EFJA 3BASA 2VSQA 2BCCG 4U0DA 3SSUA 2ZVNB 2HLOA 3G9RA 3EJEA 4CA3A 1IUQA 3TSIA 1HJBA 1YQ3C 2FYNB 2Y9ZA 4DZOA 1JJ2O 1KYOI 4I7ZC 3LMOA 2A06E 3AE6C 3LW5J 3L72D 3M0DC 2FFDC 1HY8A 3CPWO 1IFPA 2PGDA 3G1IA 1OVRA 3TGUG 1K05A 4MN4C 3CCQP 3FGAD 1FZBA 4W7YA 2QEXP 1RE3C 2IBZG 4XFZA 1BDCA 2FFDA 1K9MQ 2LIWA 1OX3A 3I56P 2IYPA 4N78E 3MD0A 1NTKJ 2WSSH 1SQQD 1NTZK 5AW1B 2KLVA 1QVFO 4BWNA 3L70E 1KILC 1LP1A 1ZOYC 3L75G 3CX5D 2KI7B 1SQVG 2E74C 1JTHB 1SS1A 2R5DA 1EXIA 3H1JE 1JCDA 4C46A 1NTME 3DS0A 5CJ0A 2MR7A 4I2LC 4IL6X 2N9BA 2KG9A 2CG5B 2CPSA 3BRTB 1EXJA 1VPCA 2E76D 1URQC 1PGQA 3EJDA 1PPJD 1FAVA 1BGYJ 1EC5A 1S2EA 1PP9D 3L71D 1H0TA 4I7ZB 1JM0A 2L5GB 3KHUA 2FFDB 3LIEA 2A06G 1JY3N 3CC4P 1NU1J 4XFXA 4M0IA 4GT1A 2JO1A 1GW3A 3H0DA 4EYYQ 1LP1B 4JQ0D 4H44D 2LOLA 3PRJA 3LIDA 1S9KE 3AE5C 3CX5H 2Q9IA 2FHSC 1IFDA 2JQ4A 1EDJA 1OIPA 4C7RA 1M57D 3L70G 2B9BA 2DW3A 2ERHA 2FBWC 3H1JG 3TGUD 4OGQC 3HUSC 1NTMG 4IL6H 1H0TB 1VQKP 4COCA 2MR8A 1QVGO 4UHPB 3WUTA 1RY3A 1J1DC 3DS3A 1FJKA 2LKIA 1HJ0A 2YO2A 1BGYE 3MHVA 4ZNCA 1VQPP 4IZ6A 1OWAA 5B5EE 3DS2A 1PFIA 2CWOA 3AE8C 1ZV8A 3T97A 2M5AB 2FQ1A 3DS1A 3EWKA 7CEIA 1GL2C 1RF1A 4L76A 1NU1E 2OYIA 2R44A 2Q5UA 4UB6H 2WTYA 2N1TA 1KFMA 4R4MA 3OW2O 1D7MA 2N9YB 2KWLA 4WY4A 2KZIA 1KB9H 4YXDC 2WWWA 3TNUB 2K1AA 4GIFA 3B8EB 5K5GB 2GDYA 2YNYA 2NRGA 1FZEA 1NTKG 3H1HJ 2IPPA 3CC2P 2AVAA 2QRXA 4U7JA 2LMLA 2O1KA 2AEFA 3AE7C 3KXDA 4RKUJ 2ZVOB 3CCUP 3M0AA 3HUSB 3F89A 4EDFA 3V6IA 2WPSA 3GZMA 1XTCC 3I55P 1ZLLA 1VF5C 3T97B 1SQBD 3MGNA 3LRYA 1S4XA 5AW3B 2XDJA 1RF1B 3C1LA 3F5HA 1S3JA 1NTZJ 2YKQA 2OYIB 1BGYG 4N78D 3CMAP 2WSFH 5H2FE 4PXHB 2N1TB 1GL2B 5AW7B 2EG5A 5DJTB 2PRRA 3IAOA 1SQPK 1JY2P 5AVXB 1NU1G 2LL8A 4PD4I 3PH0A 5AW5B 4HKZH 1WMKA 1KYOD 1KV4A 1DEEG 1DD4A 2E75C 4RESB 1NVOA 3H1HE 3AEBC 4PH0A 3AE4C 1LTAC 1UJZA 1M1KQ 3R4YA 1T3UA 4U0AA 3CE7A 2XNDH 1VF5B 1L0NJ 4IFMA 1LTIC 4U0EA 3CCJP 1W5CE 3O6QA 2N6YA 1YJNP 5E79E 4F37A 1USDA 2K88A 3HRNA 1P84I 1MV8A 3B5ND 3AEEC 1NTZE 2QJYB 1S9KD 1IC2A 2UWJE 2X2BA 3RG2A 3AE3C 2KG6A 2WT7A 1U57A 1SFCA 5AVZB 1Q82Q 1JNMA 1RO0A 1JEKA 3IR9A 2V7QH 1Z6MA 2L0QA 2JKVA 2O3JA 1L0LK 1LTJA 3L72J 2E75B 2IZ0A 3HYBA 5BS1A 1M7LA 4XFYA 4H13C 2R3SA 2AFDA 5F2OA 3GLMA 3O6QB 2NPSC 1X0TA 2W27A 3AE2C 1RF0A 1FDMA 5L8RJ 2PEMA 1VQ6P 1SQQJ 2NPSA 2Z5HA 2WT7B 3VP8A 1SFCB 2L4BA 2GZGA 2QSIA 1NTZG 1K30A 5KLVD 3L35A 2HYNA 1EIAA 1DEBA 2KS1A 3G3ZA 5KAIH 2Q1KA 1W2BO 2ROQA 1LTJB 3TF5A 3H25A 1EOQA 2PEJA 4U0BA 4Y99B 1D1DA 3CCEP 1QEXA 1PP9J 4PV1C 1JY2O 1QGKB 3I5CA 3L71J 4GDOA 1NAYA 1Q2NA 3P8MC 3QH9A 1FJPA 5B5EH 3CWBD 3H6PA 4L73A 3L72E 3VMAA 1ZRTD 4HH2A 4H13B 1G1JA 3MZWB 4K3AA 3G28A 2NPSB 5EFWB 2FYUD 3VYIA 2FAEA 3B71A 4B86A 2HFED 1PV3A 5HGOA 5KAFE 1KN7A 2KS1B 1L0NG 5EW5E 1KQSO 2G3AA 3CX5E 2OYOA 1EMVA 1S1CX 1GW4A 1NAFA 2M5RA 3A3YB 2P7JA 3L4FA 1JCCA 2QM7A 2KSJA 3H1HD 2Q6QA 2PFXA 3A7OA 1IMQA 1MUUA 2GZFA 3CXHI 1BE3D 2EHTA 4HKGA 2RMZA 4YTPC 1PPJE 3ABVC 2L22A 3L71E 5AW4B 2KZJA 2Y9YA 2KIKA 5H2FH 3WUVA 3G21A 3L72G 3K5BA 1LTGC 1AVOA 3U59A 4PD4D 1AJYA 3BCCD 2JAZA 4LC1A 2XZ0D 2PEKA 2Q3EA 1IFNA 2O01H 1BCCD 1SQQG 3AEFC 3Q2YA 2KR5A 1SQXK 5KLVK 2N6ZA 1VDFA 2Q3IA 3WBHA 1GZLA 1Y9BA 1GTWA 4LLHA 2XZRA 2C0XA 1BXIA 5AW2B 1LTTC 4H0LB 2MKVA 4YPCA 4AUWA 3VP9A 2LR2A 3CMEP 4I6MC 1SQBJ 3R2PA 2AEJA 2JJLA 4ASVA 1PPJG 2OYHC 4W7ZA 1OZHA 1P84D 3MUDA 1NKNA 5E79H 2GZEA 1Q90D 1PP9G 2KORA 2K0DX 5HGNA 3L71G 1FZFA 2FYUK 3AE9C 2BEQD 1WT6A 1R5LA 2FXMA 1GU5A 3VOPA 2V7QJ 1EZVI 3JSVC 4HYTB 2ZFCA 2VLPA 1LT1A 1JTHA 1YITP 3RK2D 3RG6C 2C9NY 3L37A 3RBZA 3RL0D 5DJUB 3PTZA 4COPA 1IMPA 4WY4D 5KJ7D 4WYMA 1OFCX 5AVWB 3G0VA 2OGUA 3AECC 3ITKA 3WUUA 2ZT9D 4DG9A 1K04A 1SQBE 3M0DA 1BSHA 3CCSP 4CPGA 1PEOA 5KP7B 2GA1A 1H88A 1SVFA 2QNWA 1MZ9A 1RE3A 3KPEA 3RK3E 2W6JH 4W80A 3P7KA 3RGUA 1KILA 3L74D 2WSCH 2AXTH 3S1KA 1CW5A 3FXEA 2I1JA 2BASA 3NXSA 1KYOE 2N50A 1PZQA 5KLIC 1E6JP 2WVRA 2KYVA 1NJIQ 3C9IA 1L4AC 1GPJA 1URQA 1K8AQ 3W68A 5AVYB 1X22A 2NZ2A 1PGPA 5KP6B 3WMM0 1FE6A 1N8RQ 1L4AA 2ONTA 2PEOA 1OVVA 1SQPD 4BXLA 2M5AA 5AW0B 1SQBG 5KAFH 1VKUA 1X3OA 4KT0J 5TJHA 1KD1Q 4HB1A 1SQXJ 5KLVJ 3CCRP 4H2YC 2GZJA 1KILB 1YTZT 5CCHD 2E74B 4OWFA 1ZR4A 3CXHD 3M9HA 1HH0A 1HVVA 1CEIA 3TNUA 3GHGC 1Q86Q 5KAIE 5HV8A 1H89A 5CCGD 2XV6A 3JC22 2QE7H 2EIAA 1VQOP 2JBGA 2QA4P 4WB4A 2NO8A 3L73D 1URQB 1YYCA 4PJ0E 1WRGA 3H4EA 3VMZA 2WPRA 5KLIB 2MVVA 2WPQA 5APQA 3CWBJ 4C7NA 4DJGA 3U1CA 3CL3D 3HUSA 2JEEA 2K92A 1N86A 1L4AB 1MKMA 1NHLA 3HD7C 1ZMEC 1Y8AA 2L9FA 2FYUJ 4D6TJ 1ACPA 5APSA 3Q5RA 4L74A 5AW9B 1MFTA 4DOJA 1IFIA 2JWDA 1XTGB 2OARA 2K9YA 2K0XA 3HTKA 2FQ0A 2R3CA 1M6EX 3OJAB 2HPCB 1GL2A 3AEGC 1AQTA 5HVCA 2JB0A 1QRJA 3RK2C 2O01J 3NY7B 1YHQP 4XRQA 3MP7B 1SQXE 2WPTA 3H47A 3P8CE 5KLVE 3HZQA 3USSA 3NFQA 1L0LD 3EJBA 2D2CD 1IZNB 1R5SA 1BE3J 4C7NB 4JBZA 4BPGA 1M6NA 2KP8A 1T6AA 2ZT9C 4OGQB 3AEDC 3Q1MA 2XU6A 1BAJA 5AVRB 3EFFK 1J1DB 4PH1A 2FVFA 3CWBE 1ZRTE 4IFDK 1G1IA 3HTKB 3L36A 1L0IA 4JPZB 3G1GA 5BU5A 1KORA 1FDOA 1VL2A 2KB7P 2KXPB 3BCCJ 5B66E 2FYUE 4D6TE 3IF4A 2B88A 3RK3D 1IK7A 5APWA 1YTZI 2M3EA 3D71A 2E76C 2P58A 4TLFA 1E5WA 4AQRD 3KYQA 1BCCJ 2DNWA 2H7HA 1EQ7A 3V4QA 3S9OA 3TYYA 1OR5A 5I4TG 5APVA 1VQ4P 1JO5A 3FWNA 5KLVG 3DTJA 1K73Q 3A0BH 2JWAA 3H1ID 1BE3E 1USEA 4GR2A 1M90Q 1OW6A 3GKLC 3TK1A 4U0FA 2N5HA 1SP4A 5GTHE 4TT3H 1LJ2A 3S4RA 4H44C 2WZ7A 1T8KA 1QL2A 1M1JC 3CWBG 4R4LA 3GJNA 1YI2P 4H0LD 1NWQA 2B87A 3D70A 4PD4E 3WU2E 3BCCE 1QL1A 1ZXGA 2FYUG 1A43A 5CCGC 1ZMBA 4ASWA 1N7SD 2K2QA 1Y47A 2WSCJ 2E76B 2R5BA 2XNXA 2KGDA 3RL0g 1BCCE 1KYOH 2LTEA 5TISE 1DIPA 1UIXA 2O1JA 4GKGA 4K35A 2E42A 5KKZC 1LGHB 5AVQB 1HGVA 2J5UA 3V2QA 1PEQA 4H2WC 3H1HG 5KTBA 1R8EA 1KZUB 1DNYA 2W6AA 3HE4A 2KOPA 1FZCC 1BE3G 1KLPA 1P84E 2IYOA 4WVZA 4H44B 1NOHA 2B87B 2IFNA 1JOCA 3G4SP 1M8OB 1M1JB 2BQ1E 3GF3A 2FXOA 4Y28J 4BRYA 2GDWA 1PL5A 3M9QA 1A02J 1S5LH 2D2CC 1SQXD 3P8CD 1FOSF 2HR3A 4WWIA 1AUMA 2R32A 3L74J 3FWLA 1FU1A 3OA7A 5CJ4A 3BCCG 3SFEC 5CMZA 1UNKA 2HG5D 1DX7A 1FZAA 2K3RA 4PJ0H 1M74A 1LT9C 2AXTE 2ZYDA 3AEAC 1PGJA 1LTBC 3CCLP 1PGOA 1BCCG 4RO0A 3CI9A 5CZDB 2OQQA 2A45I 5KKZB 3HE4B 1LT9A 3SWYA 3N4XA 3FX0A 3OAKA 2P2UA 3RK3C 1DV5A 1SQPJ 4D6TD 4AYCA 3IFMA 2FADA 3DPHA 4O9BA 1OW7A 4BRYB 2H89C 5CBNA 1JY3P 2POHA 3H1LE 4EIJA 1JUNA 2FQ2A 3V2RA 1G2CA 3GMAA 1AA0A 2DGYA 3QWOC 3ZDMA 4XA4A 3L74E 2OTKE 3L73J 3D6YA 2YIUC 4YXWH 1RO2A 1HBWA 1UIIA 1L0HA 1LT9B 3JCUH 2WQYC 3M06A 1NTKK 2K0YA 2M8RA 4XE5B 2KGCA 1IO4A 4PV1B 5HGLA 1X79B 2PAJA 1KB9I 3B5NC 2W6BA 2ZXEB 3E2DA 1KTMA 4GR6A 3CC7P 5F2NA 4ZKUA 5B66H 4GODA 2JGPA 1LWUC 2RKLA 1SQPE 1URQD 4JF7A 1BDDA 2IBZI 4QKOA 1G2CB 2E5YA 1PEUA 2OTLP 1JY2N 2Z44A 5APTA 2Y0CA 4Z1MH 3GF7A 4LGDE 3Q5SA 1AF8A 1L0LJ 2KW2A 1RNIA 2M3BA 3CXHE 3IN6A 1YJ9P 1CZQA 2N5IA 1NYHA 2Y0DA 3BATA 3G6EP 2MY5A 2YIUB 3L74G 3L73E 5GTHH 2GDXA 3E1IA 4HJGH 3N7NA 3G29A 3KZIH 1BSNA 1N73C 2OYHA 1HGZA 4PD4H 3WU2H 4OGQD 1VQ8P 4GOFA 2RN0A 3Q3DA 4N3YB 5DCKA 4WBAA 1SQPG 1HTLC 1U7MA 1MZ8A 2YKPA 1HF9A 3DS5A 2FVEA 1SLQA 5TISH 2CQ8A 1AV1A 2KNCB 1FZGA 2N1TD 3GZLA 1GL2D 1L0LE 2AF8A 3H1IJ 3CCMP 1W2EA 5JPAA 1GXHA 2WITA 4OH8B 1OMIA 3A0BE 4QNBA 1DD3A 5KP8B 3U1AA 1HWTC 1P84H 3L73G 4NPDA 1ZR2A 1VQNP 2OYHB 2GUVA 2JO0A 5CHXA 3M91A 2VLQA 1N73B 3H1LD 3FXDA 1VQ5P 5HGMA 3VMYA 1EZVE 5GTIE 2G8YA 2I1KA 5EJDA 2O01N 2GUSA
chains in the Genus database with same CATH topology
4XFYA 1A43A 1ZMBA 1M6NA 3MGEA 1VQMP 1N8RQ 1JJ2O 5F2OA 2EG5A 3DPHA 3CPWO 3G1IA 1KC8Q 2ONTA 2BUOA 2PEOA 1Q7YQ 1BAJA 3VRLC 3CCQP 2M8LA 3G29A 2QEXP 2PEMA 4PH1A 1VQKP 1VQ6P 1YJWP 4XFZA 4COCA 1KD1Q 1QVGO 1YITP 2BHVA 1K9MQ 3RG6C 3CCRP 1Q81Q 3G1GA 3I56P 2DGYA 3DS3A 2E1MA 4COPA 1VQ8P 1PEQA 1VQPP 3NTEA 1S72P 3G21A 1K30A 2L6EA 1EIAA 4WYMA 5DCKA 1VQLP 3DS2A 1QVFO 1YIJP 2CWOA 3G0VA 1Q86Q 1RO2A 1VQ9P 3M1MA 2LF4A 3G26A 4PH0A 2XV6A 3DS1A 4XROA 2EIAA 2JYLA 1VQOP 5BS2A 3DS5A 1M1KQ 2QA4P 1W2BO 4U0AA 5HGLA 3G4SP 3H4EA 3DS0A 2PEJA 1EOQA 4U0BA 3CCSP 1D1DA 2PEKA 1VQ7P 3DS4A 2P9XA 3CCEP 2BQ1E 1PEOA 2PENA 4U0EA 3CCJP 5I4TG 2PY8A 3OW2O 1YJNP 3E2DA 3CCMP 5JPAA 4GR6A 1VQ4P 3CC7P 2M8PA 5F2NA 3G71P 3WBHA 1AUMA 2Z46A 3DTJA 1PEMA 5F2KA 2JYGA 1K73Q 4QNBA 2XXMA 2Z45A 4U0CA 2M8NA 3CC2P 4GR2A 1M90Q 2OARA 3G28A 5BS1A 2OTJP 4IPYA 3CMEP 1VQNP 4U0FA 1PEUA 1M6EX 1M74A 3CC4P 2OTLP 2PEIA 1Q82Q 2Z44A 2JO0A 1RO0A 2PEQA 3CCUP 4XFXA 3CCLP 4M0IA 2XT1A 1QRJA 3B5IA 2KODA 2EFJA 3Q20A 3I55P 5HGOA 1E6JP 4U0DA 1RNIA 3H0DA 1YHQP 4XRQA 1YJ9P 1NJIQ 3CD6P 3H47A 5HGMA 1VQ5P 1KQSO 1YI2P 3LRYA 3HZQA 5HGNA 1A8OA 1IUQA 3CCVP 3P05A 1K8AQ 3G6EP 3CXCO 3CMAP 3HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 Q;  1VQ7 P;  3I56 P;  3CC4 P;  1Q82 Q;  2OTL P;  3CCE P;  3CCU P;  1VQ8 P;  1VQM P;  1N8R Q;  1JJ2 O;  3CCJ P;  1VQP P;  3CCL P;  1YJN P;  3OW2 O;  1S72 P;  3CCM P;  3CPW O;  1VQ4 P;  3CC7 P;  1KC8 Q;  1VQL P;  1QVF O;  1Q7Y Q;  3G71 P;  3I55 P;  1YIJ P;  1Q86 Q;  1VQ9 P;  1YHQ P;  3CCQ P;  1YJ9 P;  1NJI Q;  3CD6 P;  1VQ5 P;  1K73 Q;  1KQS O;  1VQO P;  1YI2 P;  2QEX P;  1M1K Q;  1VQK P;  2QA4 P;  3CC2 P;  1YJW P;  1VQ6 P;  1VQN P;  1W2B O;  1M90 Q;  1KD1 Q;  1QVG O;  3CCV P;  1YIT P;  1K8A Q;  3G4S P;  2OTJ P;  3G6E P;  1K9M Q;  3CME P;  3CXC O;  3CMA P;  3CCR P;  3CCS P; 
#chains in the Genus database with same CATH topology
 1VF5 D;  3H1K D;  2QJK C;  5APU A;  2E43 A;  2CGQ A;  1OVU A;  4BPF A;  3A0H E;  2MD9 A;  4XFJ A;  1AVY A;  2ZYA A;  2IX7 C;  1L0L G;  5AW8 B;  2N98 A;  1Q81 Q;  3H1I E;  1KQG B;  2E1M A;  2MJZ A;  2PNG A;  2WSE H;  4U3F D;  2L91 A;  1VQ9 P;  2CK3 H;  3M1M A;  4H2X C;  2J59 M;  3A5T A;  4NEO A;  5BS2 A;  2KOS A;  1NGM B;  2P1J A;  2E75 D;  2KSE A;  3TDK A;  2HPC A;  2K94 A;  1A02 F;  2PY8 A;  1S5L E;  1FOS E;  2W8Z A;  2KOO A;  2ZXX A;  3H32 A;  2M8P A;  1EZV G;  2BCC D;  1GXG A;  1GDT A;  1L0N K;  4KHX A;  2MVU A;  2JYG A;  2JU1 A;  2QJK B;  2Z45 A;  2A45 H;  1H8A A;  3SWK A;  2J58 A;  2IFM A;  1NTK E;  1KB9 D;  1SFC D;  2LIU A;  2W83 C;  3GHG A;  3KQG A;  3CLQ A;  3SFD C;  4MRT C;  2PEI A;  1EDL A;  4UB8 H;  4JYC A;  1NO4 A;  1YQ4 C;  2FY8 A;  2GYK A;  1J2J B;  2KG8 A;  2QG4 A;  1OW8 A;  1M56 D;  3GW6 A;  2FAC A;  2M0B A;  2JDI H;  2P67 A;  1HQB A;  2IBZ D;  3H1I G;  3CCV P;  2YXQ B;  3BRV B;  3NMD A;  2JR8 A;  3HD7 A;  2IDB A;  2ZJS E;  2EHS A;  1YBK A;  2LKM A;  1RF1 C;  1VQM P;  1FBM A;  2OYI C;  2K5X A;  3H32 B;  4QMA A;  1LTS C;  1E0H A;  3L75 D;  3RL0 C;  5BU8 B;  2N1T C;  1SQV D;  4H13 D;  1GD2 E;  2CNR A;  3CXH H;  4WY4 C;  2NPS D;  2C9L Y;  4I1L A;  5KJ7 C;  1RQU A;  2SPZ A;  2E5T A;  1KQF B;  2Y0E A;  3GHG B;  1SQQ K;  3HE5 A;  4EI2 A;  1VQL P;  2ZAE B;  5KJ7 A;  4DCK A;  3JCU E;  2JYL A;  2H43 A;  3M9B A;  2LXC B;  1AQ5 A;  1MFZ A;  3A2A A;  1AFO A;  3U43 A;  1ZW0 A;  1CI6 A;  2A06 D;  3SWF A;  1VQ7 P;  3HD7 B;  2YKO A;  5CBO A;  1EDI A;  2HOD A;  3PLN A;  1ZP0 C;  1EZV D;  1L2P A;  2Z46 A;  1PEM A;  5APY A;  2XXM A;  4PV1 D;  1T2K D;  2PP6 A;  1FC2 C;  2OTJ P;  1VHN A;  4L75 A;  3RK2 B;  2QJY C;  3II6 A;  3RL0 B;  2H8P D;  2PEQ A;  3L70 D;  2KGA A;  2BEZ F;  2GM4 A;  3HE5 B;  4EOT A;  2Z4E A;  4WY4 B;  3V2N A;  2KLU A;  5APX A;  1NQ4 A;  3Q20 A;  1SQX G;  3H1J D;  2FKW B;  2AFE A;  3CD6 P;  1NTM D;  3E1R A;  2K9J A;  2ZT9 B;  3P05 A;  2VLO A;  2QIW A;  1CI6 B;  2QVA A;  4NPE A;  1FR2 A;  4RJT A;  1QLE D;  1KIL E;  2WMM A;  2HOD B;  2Q7C A;  3V4W A;  1S5L X;  1T3J A;  3E7K A;  3KZI E;  1IFM A;  5CCH C;  1YJW P;  1RE4 C;  2ZYG A;  5GTI H;  2KOG A;  4JYB A;  2LPK A;  1M1J A;  4D6T G;  1NH4 A;  2RH0 A;  3V5B A;  2XV5 A;  5CCH A;  2CPB A;  1RE4 A;  2L6E A;  1SFC C;  1OXZ A;  3G26 A;  1SQV K;  2YMY A;  5CCG A;  1CSB A;  1NTK D;  1N7L A;  3KDP B;  2K9J B;  3A0H H;  1GK4 A;  4NPF X;  2K37 A;  2QM8 A;  3O8Z A;  2P9X A;  5AVU B;  2PEN A;  3B4Q A;  1KMI Z;  1LTJ C;  4Y99 C;  3BVH A;  3G71 P;  2WSE J;  5F2K A;  4U0C A;  3NTN A;  2M8N A;  1BGY D;  1X9V A;  2V4H A;  3H1L J;  1RF0 C;  2MF4 A;  1FZC A;  3LW5 H;  2YMK A;  1IK9 A;  2XT1 A;  5AVV B;  1T8Z A;  4M3L A;  1JB0 J;  1NU1 D;  1SQB K;  3H1K J;  2FVA A;  3AE1 C;  1A8O A;  3D6Z A;  1L0N E;  3PP5 A;  1LNQ A;  3VN0 A;  1JMM A;  1GU4 A;  2BUO A;  1AYI A;  1Q7Y Q;  3CX5 I;  1NTM K;  2IZ1 A;  4ZKP A;  2VRS A;  3B4S A;  2LXB A;  4U3F J;  2BHV A;  2AEM A;  2VLN A;  1FZC B;  2K93 A;  1J1E C;  1T2K C;  5M1B A;  1RHZ B;  2B89 A;  3VTP C;  3C8V A;  3EQ2 A;  1JMB A;  4ZMD A;  2YXR B;  1GK6 A;  3RBX A;  4XRO A;  3GG2 A;  1IJD B;  3PJS K;  2BCC J;  2D2C B;  1ZNV A;  1ZN5 A;  1KFN A;  3H1K E;  1X8Y A;  3W67 A;  3MIW A;  1FS0 E;  3EFG A;  1QX8 A;  1SQQ E;  2KGE A;  1KQL A;  3V2P A;  3P32 A;  1IFJ A;  1KIL D;  1F80 D;  2FXP A;  3TGU J;  4UB8 E;  1FDI A;  1DH3 A;  2E74 D;  1HUC A;  4H0L C;  3MTU E;  1EDK A;  4PWV B;  2FYZ A;  5BVZ A;  2QJP C;  4DT0 A;  1GMJ A;  3RK3 B;  4U3F E;  4IL6 E;  3B5N A;  2C0W A;  1J1E B;  1N7S C;  2ITA A;  1N2D C;  2YO3 A;  1PP9 E;  4OVN F;  3CXC O;  4N6J A;  3L75 J;  2WSF J;  3PHL A;  1SQV J;  2AXC A;  3MGE A;  4GOE A;  1LWU A;  1TU3 F;  1N7S A;  1L4A D;  1NTZ D;  1KC8 Q;  1NKZ B;  3H1L G;  1Z56 A;  1NU1 K;  3VRL C;  2WPV B;  2M8L A;  2P10 A;  1PIX A;  2BCC E;  4IFF A;  1E79 H;  2KK7 A;  4UB6 E;  5AW6 B;  4A7P A;  4R0M A;  3H1K G;  2KNC A;  4KJM A;  4IOI H;  1KB9 E;  5AVT B;  3NTE A;  1S72 P;  3Q5P A;  2A45 G;  1YIJ P;  2FYN C;  2LF4 A;  2KUB A;  2W90 A;  3B5N B;  2JU2 A;  3TGU E;  2JP3 A;  3MUD C;  2QJP B;  2IBZ E;  3DS4 A;  1LWU B;  1N7S B;  5AVS B;  4U3F G;  1U7J A;  1N73 A;  1L0N D;  2KOQ A;  2XZ1 C;  3L70 J;  2XKM A;  3L75 E;  1SQV E;  4IPY A;  2H88 C;  3HD7 D;  3H1J J;  2GZI A;  3UIA A;  3VMX A;  1RH5 B;  2Z5I A;  4BPH A;  1NTM J;  5C39 A;  2I8D A;  1JY3 O;  3B5I A;  2KOD A;  1RQV A;  2EFJ A;  3BAS A;  2VSQ A;  2BCC G;  4U0D A;  3SSU A;  2ZVN B;  2HLO A;  3G9R A;  3EJE A;  4CA3 A;  1IUQ A;  3TSI A;  1HJB A;  1YQ3 C;  2FYN B;  2Y9Z A;  4DZO A;  1JJ2 O;  1KYO I;  4I7Z C;  3LMO A;  2A06 E;  3AE6 C;  3LW5 J;  3L72 D;  3M0D C;  2FFD C;  1HY8 A;  3CPW O;  1IFP A;  2PGD A;  3G1I A;  1OVR A;  3TGU G;  1K05 A;  4MN4 C;  3CCQ P;  3FGA D;  1FZB A;  4W7Y A;  2QEX P;  1RE3 C;  2IBZ G;  4XFZ A;  1BDC A;  2FFD A;  1K9M Q;  2LIW A;  1OX3 A;  3I56 P;  2IYP A;  4N78 E;  3MD0 A;  1NTK J;  2WSS H;  1SQQ D;  1NTZ K;  5AW1 B;  2KLV A;  1QVF O;  4BWN A;  3L70 E;  1KIL C;  1LP1 A;  1ZOY C;  3L75 G;  3CX5 D;  2KI7 B;  1SQV G;  2E74 C;  1JTH B;  1SS1 A;  2R5D A;  1EXI A;  3H1J E;  1JCD A;  4C46 A;  1NTM E;  3DS0 A;  5CJ0 A;  2MR7 A;  4I2L C;  4IL6 X;  2N9B A;  2KG9 A;  2CG5 B;  2CPS A;  3BRT B;  1EXJ A;  1VPC A;  2E76 D;  1URQ C;  1PGQ A;  3EJD A;  1PPJ D;  1FAV A;  1BGY J;  1EC5 A;  1S2E A;  1PP9 D;  3L71 D;  1H0T A;  4I7Z B;  1JM0 A;  2L5G B;  3KHU A;  2FFD B;  3LIE A;  2A06 G;  1JY3 N;  3CC4 P;  1NU1 J;  4XFX A;  4M0I A;  4GT1 A;  2JO1 A;  1GW3 A;  3H0D A;  4EYY Q;  1LP1 B;  4JQ0 D;  4H44 D;  2LOL A;  3PRJ A;  3LID A;  1S9K E;  3AE5 C;  3CX5 H;  2Q9I A;  2FHS C;  1IFD A;  2JQ4 A;  1EDJ A;  1OIP A;  4C7R A;  1M57 D;  3L70 G;  2B9B A;  2DW3 A;  2ERH A;  2FBW C;  3H1J G;  3TGU D;  4OGQ C;  3HUS C;  1NTM G;  4IL6 H;  1H0T B;  1VQK P;  4COC A;  2MR8 A;  1QVG O;  4UHP B;  3WUT A;  1RY3 A;  1J1D C;  3DS3 A;  1FJK A;  2LKI A;  1HJ0 A;  2YO2 A;  1BGY E;  3MHV A;  4ZNC A;  1VQP P;  4IZ6 A;  1OWA A;  5B5E E;  3DS2 A;  1PFI A;  2CWO A;  3AE8 C;  1ZV8 A;  3T97 A;  2M5A B;  2FQ1 A;  3DS1 A;  3EWK A;  7CEI A;  1GL2 C;  1RF1 A;  4L76 A;  1NU1 E;  2OYI A;  2R44 A;  2Q5U A;  4UB6 H;  2WTY A;  2N1T A;  1KFM A;  4R4M A;  3OW2 O;  1D7M A;  2N9Y B;  2KWL A;  4WY4 A;  2KZI A;  1KB9 H;  4YXD C;  2WWW A;  3TNU B;  2K1A A;  4GIF A;  3B8E B;  5K5G B;  2GDY A;  2YNY A;  2NRG A;  1FZE A;  1NTK G;  3H1H J;  2IPP A;  3CC2 P;  2AVA A;  2QRX A;  4U7J A;  2LML A;  2O1K A;  2AEF A;  3AE7 C;  3KXD A;  4RKU J;  2ZVO B;  3CCU P;  3M0A A;  3HUS B;  3F89 A;  4EDF A;  3V6I A;  2WPS A;  3GZM A;  1XTC C;  3I55 P;  1ZLL A;  1VF5 C;  3T97 B;  1SQB D;  3MGN A;  3LRY A;  1S4X A;  5AW3 B;  2XDJ A;  1RF1 B;  3C1L A;  3F5H A;  1S3J A;  1NTZ J;  2YKQ A;  2OYI B;  1BGY G;  4N78 D;  3CMA P;  2WSF H;  5H2F E;  4PXH B;  2N1T B;  1GL2 B;  5AW7 B;  2EG5 A;  5DJT B;  2PRR A;  3IAO A;  1SQP K;  1JY2 P;  5AVX B;  1NU1 G;  2LL8 A;  4PD4 I;  3PH0 A;  5AW5 B;  4HKZ H;  1WMK A;  1KYO D;  1KV4 A;  1DEE G;  1DD4 A;  2E75 C;  4RES B;  1NVO A;  3H1H E;  3AEB C;  4PH0 A;  3AE4 C;  1LTA C;  1UJZ A;  1M1K Q;  3R4Y A;  1T3U A;  4U0A A;  3CE7 A;  2XND H;  1VF5 B;  1L0N J;  4IFM A;  1LTI C;  4U0E A;  3CCJ P;  1W5C E;  3O6Q A;  2N6Y A;  1YJN P;  5E79 E;  4F37 A;  1USD A;  2K88 A;  3HRN A;  1P84 I;  1MV8 A;  3B5N D;  3AEE C;  1NTZ E;  2QJY B;  1S9K D;  1IC2 A;  2UWJ E;  2X2B A;  3RG2 A;  3AE3 C;  2KG6 A;  2WT7 A;  1U57 A;  1SFC A;  5AVZ B;  1Q82 Q;  1JNM A;  1RO0 A;  1JEK A;  3IR9 A;  2V7Q H;  1Z6M A;  2L0Q A;  2JKV A;  2O3J A;  1L0L K;  1LTJ A;  3L72 J;  2E75 B;  2IZ0 A;  3HYB A;  5BS1 A;  1M7L A;  4XFY A;  4H13 C;  2R3S A;  2AFD A;  5F2O A;  3GLM A;  3O6Q B;  2NPS C;  1X0T A;  2W27 A;  3AE2 C;  1RF0 A;  1FDM A;  5L8R J;  2PEM A;  1VQ6 P;  1SQQ J;  2NPS A;  2Z5H A;  2WT7 B;  3VP8 A;  1SFC B;  2L4B A;  2GZG A;  2QSI A;  1NTZ G;  1K30 A;  5KLV D;  3L35 A;  2HYN A;  1EIA A;  1DEB A;  2KS1 A;  3G3Z A;  5KAI H;  2Q1K A;  1W2B O;  2ROQ A;  1LTJ B;  3TF5 A;  3H25 A;  1EOQ A;  2PEJ A;  4U0B A;  4Y99 B;  1D1D A;  3CCE P;  1QEX A;  1PP9 J;  4PV1 C;  1JY2 O;  1QGK B;  3I5C A;  3L71 J;  4GDO A;  1NAY A;  1Q2N A;  3P8M C;  3QH9 A;  1FJP A;  5B5E H;  3CWB D;  3H6P A;  4L73 A;  3L72 E;  3VMA A;  1ZRT D;  4HH2 A;  4H13 B;  1G1J A;  3MZW B;  4K3A A;  3G28 A;  2NPS B;  5EFW B;  2FYU D;  3VYI A;  2FAE A;  3B71 A;  4B86 A;  2HFE D;  1PV3 A;  5HGO A;  5KAF E;  1KN7 A;  2KS1 B;  1L0N G;  5EW5 E;  1KQS O;  2G3A A;  3CX5 E;  2OYO A;  1EMV A;  1S1C X;  1GW4 A;  1NAF A;  2M5R A;  3A3Y B;  2P7J A;  3L4F A;  1JCC A;  2QM7 A;  2KSJ A;  3H1H D;  2Q6Q A;  2PFX A;  3A7O A;  1IMQ A;  1MUU A;  2GZF A;  3CXH I;  1BE3 D;  2EHT A;  4HKG A;  2RMZ A;  4YTP C;  1PPJ E;  3ABV C;  2L22 A;  3L71 E;  5AW4 B;  2KZJ A;  2Y9Y A;  2KIK A;  5H2F H;  3WUV A;  3G21 A;  3L72 G;  3K5B A;  1LTG C;  1AVO A;  3U59 A;  4PD4 D;  1AJY A;  3BCC D;  2JAZ A;  4LC1 A;  2XZ0 D;  2PEK A;  2Q3E A;  1IFN A;  2O01 H;  1BCC D;  1SQQ G;  3AEF C;  3Q2Y A;  2KR5 A;  1SQX K;  5KLV K;  2N6Z A;  1VDF A;  2Q3I A;  3WBH A;  1GZL A;  1Y9B A;  1GTW A;  4LLH A;  2XZR A;  2C0X A;  1BXI A;  5AW2 B;  1LTT C;  4H0L B;  2MKV A;  4YPC A;  4AUW A;  3VP9 A;  2LR2 A;  3CME P;  4I6M C;  1SQB J;  3R2P A;  2AEJ A;  2JJL A;  4ASV A;  1PPJ G;  2OYH C;  4W7Z A;  1OZH A;  1P84 D;  3MUD A;  1NKN A;  5E79 H;  2GZE A;  1Q90 D;  1PP9 G;  2KOR A;  2K0D X;  5HGN A;  3L71 G;  1FZF A;  2FYU K;  3AE9 C;  2BEQ D;  1WT6 A;  1R5L A;  2FXM A;  1GU5 A;  3VOP A;  2V7Q J;  1EZV I;  3JSV C;  4HYT B;  2ZFC A;  2VLP A;  1LT1 A;  1JTH A;  1YIT P;  3RK2 D;  3RG6 C;  2C9N Y;  3L37 A;  3RBZ A;  3RL0 D;  5DJU B;  3PTZ A;  4COP A;  1IMP A;  4WY4 D;  5KJ7 D;  4WYM A;  1OFC X;  5AVW B;  3G0V A;  2OGU A;  3AEC C;  3ITK A;  3WUU A;  2ZT9 D;  4DG9 A;  1K04 A;  1SQB E;  3M0D A;  1BSH A;  3CCS P;  4CPG A;  1PEO A;  5KP7 B;  2GA1 A;  1H88 A;  1SVF A;  2QNW A;  1MZ9 A;  1RE3 A;  3KPE A;  3RK3 E;  2W6J H;  4W80 A;  3P7K A;  3RGU A;  1KIL A;  3L74 D;  2WSC H;  2AXT H;  3S1K A;  1CW5 A;  3FXE A;  2I1J A;  2BAS A;  3NXS A;  1KYO E;  2N50 A;  1PZQ A;  5KLI C;  1E6J P;  2WVR A;  2KYV A;  1NJI Q;  3C9I A;  1L4A C;  1GPJ A;  1URQ A;  1K8A Q;  3W68 A;  5AVY B;  1X22 A;  2NZ2 A;  1PGP A;  5KP6 B;  3WMM 0;  1FE6 A;  1N8R Q;  1L4A A;  2ONT A;  2PEO A;  1OVV A;  1SQP D;  4BXL A;  2M5A A;  5AW0 B;  1SQB G;  5KAF H;  1VKU A;  1X3O A;  4KT0 J;  5TJH A;  1KD1 Q;  4HB1 A;  1SQX J;  5KLV J;  3CCR P;  4H2Y C;  2GZJ A;  1KIL B;  1YTZ T;  5CCH D;  2E74 B;  4OWF A;  1ZR4 A;  3CXH D;  3M9H A;  1HH0 A;  1HVV A;  1CEI A;  3TNU A;  3GHG C;  1Q86 Q;  5KAI E;  5HV8 A;  1H89 A;  5CCG D;  2XV6 A;  3JC2 2;  2QE7 H;  2EIA A;  1VQO P;  2JBG A;  2QA4 P;  4WB4 A;  2NO8 A;  3L73 D;  1URQ B;  1YYC A;  4PJ0 E;  1WRG A;  3H4E A;  3VMZ A;  2WPR A;  5KLI B;  2MVV A;  2WPQ A;  5APQ A;  3CWB J;  4C7N A;  4DJG A;  3U1C A;  3CL3 D;  3HUS A;  2JEE A;  2K92 A;  1N86 A;  1L4A B;  1MKM A;  1NHL A;  3HD7 C;  1ZME C;  1Y8A A;  2L9F A;  2FYU J;  4D6T J;  1ACP A;  5APS A;  3Q5R A;  4L74 A;  5AW9 B;  1MFT A;  4DOJ A;  1IFI A;  2JWD A;  1XTG B;  2OAR A;  2K9Y A;  2K0X A;  3HTK A;  2FQ0 A;  2R3C A;  1M6E X;  3OJA B;  2HPC B;  1GL2 A;  3AEG C;  1AQT A;  5HVC A;  2JB0 A;  1QRJ A;  3RK2 C;  2O01 J;  3NY7 B;  1YHQ P;  4XRQ A;  3MP7 B;  1SQX E;  2WPT A;  3H47 A;  3P8C E;  5KLV E;  3HZQ A;  3USS A;  3NFQ A;  1L0L D;  3EJB A;  2D2C D;  1IZN B;  1R5S A;  1BE3 J;  4C7N B;  4JBZ A;  4BPG A;  1M6N A;  2KP8 A;  1T6A A;  2ZT9 C;  4OGQ B;  3AED C;  3Q1M A;  2XU6 A;  1BAJ A;  5AVR B;  3EFF K;  1J1D B;  4PH1 A;  2FVF A;  3CWB E;  1ZRT E;  4IFD K;  1G1I A;  3HTK B;  3L36 A;  1L0I A;  4JPZ B;  3G1G A;  5BU5 A;  1KOR A;  1FDO A;  1VL2 A;  2KB7 P;  2KXP B;  3BCC J;  5B66 E;  2FYU E;  4D6T E;  3IF4 A;  2B88 A;  3RK3 D;  1IK7 A;  5APW A;  1YTZ I;  2M3E A;  3D71 A;  2E76 C;  2P58 A;  4TLF A;  1E5W A;  4AQR D;  3KYQ A;  1BCC J;  2DNW A;  2H7H A;  1EQ7 A;  3V4Q A;  3S9O A;  3TYY A;  1OR5 A;  5I4T G;  5APV A;  1VQ4 P;  1JO5 A;  3FWN A;  5KLV G;  3DTJ A;  1K73 Q;  3A0B H;  2JWA A;  3H1I D;  1BE3 E;  1USE A;  4GR2 A;  1M90 Q;  1OW6 A;  3GKL C;  3TK1 A;  4U0F A;  2N5H A;  1SP4 A;  5GTH E;  4TT3 H;  1LJ2 A;  3S4R A;  4H44 C;  2WZ7 A;  1T8K A;  1QL2 A;  1M1J C;  3CWB G;  4R4L A;  3GJN A;  1YI2 P;  4H0L D;  1NWQ A;  2B87 A;  3D70 A;  4PD4 E;  3WU2 E;  3BCC E;  1QL1 A;  1ZXG A;  2FYU G;  1A43 A;  5CCG C;  1ZMB A;  4ASW A;  1N7S D;  2K2Q A;  1Y47 A;  2WSC J;  2E76 B;  2R5B A;  2XNX A;  2KGD A;  3RL0 g;  1BCC E;  1KYO H;  2LTE A;  5TIS E;  1DIP A;  1UIX A;  2O1J A;  4GKG A;  4K35 A;  2E42 A;  5KKZ C;  1LGH B;  5AVQ B;  1HGV A;  2J5U A;  3V2Q A;  1PEQ A;  4H2W C;  3H1H G;  5KTB A;  1R8E A;  1KZU B;  1DNY A;  2W6A A;  3HE4 A;  2KOP A;  1FZC C;  1BE3 G;  1KLP A;  1P84 E;  2IYO A;  4WVZ A;  4H44 B;  1NOH A;  2B87 B;  2IFN A;  1JOC A;  3G4S P;  1M8O B;  1M1J B;  2BQ1 E;  3GF3 A;  2FXO A;  4Y28 J;  4BRY A;  2GDW A;  1PL5 A;  3M9Q A;  1A02 J;  1S5L H;  2D2C C;  1SQX D;  3P8C D;  1FOS F;  2HR3 A;  4WWI A;  1AUM A;  2R32 A;  3L74 J;  3FWL A;  1FU1 A;  3OA7 A;  5CJ4 A;  3BCC G;  3SFE C;  5CMZ A;  1UNK A;  2HG5 D;  1DX7 A;  1FZA A;  2K3R A;  4PJ0 H;  1M74 A;  1LT9 C;  2AXT E;  2ZYD A;  3AEA C;  1PGJ A;  1LTB C;  3CCL P;  1PGO A;  1BCC G;  4RO0 A;  3CI9 A;  5CZD B;  2OQQ A;  2A45 I;  5KKZ B;  3HE4 B;  1LT9 A;  3SWY A;  3N4X A;  3FX0 A;  3OAK A;  2P2U A;  3RK3 C;  1DV5 A;  1SQP J;  4D6T D;  4AYC A;  3IFM A;  2FAD A;  3DPH A;  4O9B A;  1OW7 A;  4BRY B;  2H89 C;  5CBN A;  1JY3 P;  2POH A;  3H1L E;  4EIJ A;  1JUN A;  2FQ2 A;  3V2R A;  1G2C A;  3GMA A;  1AA0 A;  2DGY A;  3QWO C;  3ZDM A;  4XA4 A;  3L74 E;  2OTK E;  3L73 J;  3D6Y A;  2YIU C;  4YXW H;  1RO2 A;  1HBW A;  1UII A;  1L0H A;  1LT9 B;  3JCU H;  2WQY C;  3M06 A;  1NTK K;  2K0Y A;  2M8R A;  4XE5 B;  2KGC A;  1IO4 A;  4PV1 B;  5HGL A;  1X79 B;  2PAJ A;  1KB9 I;  3B5N C;  2W6B A;  2ZXE B;  3E2D A;  1KTM A;  4GR6 A;  3CC7 P;  5F2N A;  4ZKU A;  5B66 H;  4GOD A;  2JGP A;  1LWU C;  2RKL A;  1SQP E;  1URQ D;  4JF7 A;  1BDD A;  2IBZ I;  4QKO A;  1G2C B;  2E5Y A;  1PEU A;  2OTL P;  1JY2 N;  2Z44 A;  5APT A;  2Y0C A;  4Z1M H;  3GF7 A;  4LGD E;  3Q5S A;  1AF8 A;  1L0L J;  2KW2 A;  1RNI A;  2M3B A;  3CXH E;  3IN6 A;  1YJ9 P;  1CZQ A;  2N5I A;  1NYH A;  2Y0D A;  3BAT A;  3G6E P;  2MY5 A;  2YIU B;  3L74 G;  3L73 E;  5GTH H;  2GDX A;  3E1I A;  4HJG H;  3N7N A;  3G29 A;  3KZI H;  1BSN A;  1N73 C;  2OYH A;  1HGZ A;  4PD4 H;  3WU2 H;  4OGQ D;  1VQ8 P;  4GOF A;  2RN0 A;  3Q3D A;  4N3Y B;  5DCK A;  4WBA A;  1SQP G;  1HTL C;  1U7M A;  1MZ8 A;  2YKP A;  1HF9 A;  3DS5 A;  2FVE A;  1SLQ A;  5TIS H;  2CQ8 A;  1AV1 A;  2KNC B;  1FZG A;  2N1T D;  3GZL A;  1GL2 D;  1L0L E;  2AF8 A;  3H1I J;  3CCM P;  1W2E A;  5JPA A;  1GXH A;  2WIT A;  4OH8 B;  1OMI A;  3A0B E;  4QNB A;  1DD3 A;  5KP8 B;  3U1A A;  1HWT C;  1P84 H;  3L73 G;  4NPD A;  1ZR2 A;  1VQN P;  2OYH B;  2GUV A;  2JO0 A;  5CHX A;  3M91 A;  2VLQ A;  1N73 B;  3H1L D;  3FXD A;  1VQ5 P;  5HGM A;  3VMY A;  1EZV E;  5GTI E;  2G8Y A;  2I1K A;  5EJD A;  2O01 N;  2GUS A; 
#chains in the Genus database with same CATH homology
 4XFY A;  1A43 A;  1ZMB A;  1M6N A;  3MGE A;  1VQM P;  1N8R Q;  1JJ2 O;  5F2O A;  2EG5 A;  3DPH A;  3CPW O;  3G1I A;  1KC8 Q;  2ONT A;  2BUO A;  2PEO A;  1Q7Y Q;  1BAJ A;  3VRL C;  3CCQ P;  2M8L A;  3G29 A;  2QEX P;  2PEM A;  4PH1 A;  1VQK P;  1VQ6 P;  1YJW P;  4XFZ A;  4COC A;  1KD1 Q;  1QVG O;  1YIT P;  2BHV A;  1K9M Q;  3RG6 C;  3CCR P;  1Q81 Q;  3G1G A;  3I56 P;  2DGY A;  3DS3 A;  2E1M A;  4COP A;  1VQ8 P;  1PEQ A;  1VQP P;  3NTE A;  1S72 P;  3G21 A;  1K30 A;  2L6E A;  1EIA A;  4WYM A;  5DCK A;  1VQL P;  3DS2 A;  1QVF O;  1YIJ P;  2CWO A;  3G0V A;  1Q86 Q;  1RO2 A;  1VQ9 P;  3M1M A;  2LF4 A;  3G26 A;  4PH0 A;  2XV6 A;  3DS1 A;  4XRO A;  2EIA A;  2JYL A;  1VQO P;  5BS2 A;  3DS5 A;  1M1K Q;  2QA4 P;  1W2B O;  4U0A A;  5HGL A;  3G4S P;  3H4E A;  3DS0 A;  2PEJ A;  1EOQ A;  4U0B A;  3CCS P;  1D1D A;  2PEK A;  1VQ7 P;  3DS4 A;  2P9X A;  3CCE P;  2BQ1 E;  1PEO A;  2PEN A;  4U0E A;  3CCJ P;  5I4T G;  2PY8 A;  3OW2 O;  1YJN P;  3E2D A;  3CCM P;  5JPA A;  4GR6 A;  1VQ4 P;  3CC7 P;  2M8P A;  5F2N A;  3G71 P;  3WBH A;  1AUM A;  2Z46 A;  3DTJ A;  1PEM A;  5F2K A;  2JYG A;  1K73 Q;  4QNB A;  2XXM A;  2Z45 A;  4U0C A;  2M8N A;  3CC2 P;  4GR2 A;  1M90 Q;  2OAR A;  3G28 A;  5BS1 A;  2OTJ P;  4IPY A;  3CME P;  1VQN P;  4U0F A;  1PEU A;  1M6E X;  1M74 A;  3CC4 P;  2OTL P;  2PEI A;  1Q82 Q;  2Z44 A;  2JO0 A;  1RO0 A;  2PEQ A;  3CCU P;  4XFX A;  3CCL P;  4M0I A;  2XT1 A;  1QRJ A;  3B5I A;  2KOD A;  2EFJ A;  3Q20 A;  3I55 P;  5HGO A;  1E6J P;  4U0D A;  1RNI A;  3H0D A;  1YHQ P;  4XRQ A;  1YJ9 P;  1NJI Q;  3CD6 P;  3H47 A;  5HGM A;  1VQ5 P;  1KQS O;  1YI2 P;  3LRY A;  3HZQ A;  5HGN A;  1A8O A;  1IUQ A;  3CCV P;  3P05 A;  1K8A Q;  3G6E P;  3CXC O;  3CMA P;  3HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...