1Q7YQ

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 51
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q7yQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q7yQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q7yQ03
3CCRP 3CCUP 1VQPP 2QA4P 3CCJP 1KQSO 1K73Q 3CCMP 3G71P 3CCSP 1K8AQ 3CCLP 1M90Q 2QEXP 1Q82Q 1YIJP 1M1KQ 3CCQP 1QVGO 1QVFO 3CC4P 1NJIQ 1YI2P 3CMAP 1Q7YQ 3CPWO 1VQ5P 3CC2P 3G4SP 3OW2O 1Q81Q 1S72P 1YJWP 3CCEP 3I56P 1YITP 3G6EP 1VQLP 1YJ9P 1YJNP 1VQ8P 1VQKP 3CMEP 1VQOP 3CXCO 1KC8Q 1Q86Q 2OTJP 3CCVP 3CD6P 3CC7P 1YHQP 1K9MQ 3I55P 1KD1Q 1VQ4P 1JJ2O 1VQ9P 1VQNP 1W2BO 1N8RQ 2OTLP 1VQMP 1VQ7P 1VQ6P
chains in the Genus database with same CATH superfamily
1NTZE 5AW0B 2L5GB 2NPSA 2L6EA 3CWBD 3GZMA 1LT9B 2JP3A 4IFMA 1GPJA 3FWLA 3PH0A 1VQLP 2QJKB 1SQQG 3JC22 1J1DC 1PGOA 1A02F 1NO4A 3T97A 3AE6C 2JU2A 2JWDA 5KP7B 3AE1C 1SQBJ 3DS1A 2MR8A 1NTZK 3LIDA 1AYIA 1M7LA 3HUSB 1J1DB 2IBZE 1YTZI 1FE6A 1NVOA 5KJ7D 1K73Q 3GMAA 1K8AQ 3H1KD 2ZVOB 3A2AA 5GTHH 1KILB 2JU1A 4HH2A 2LIWA 5B66E 5KAIE 5AVTB 1PEOA 3VRLC 2K0XA 3FWNA 2ZYDA 4NPFX 1YTZT 1SQBE 3RG2A 4D6TJ 1KILC 2HR3A 2KOPA 1UNKA 1GMJA 2XZ1C 2FVEA 2CPBA 3OJAB 2M5AA 1QVGO 3ITKA 4WBAA 2FVFA 3D70A 2Z5HA 3M0DA 1JEKA 1ZV8A 1NTMG 2ERHA 2H89C 4HKGA 3H0DA 4BRYB 3AE5C 1VQMP 1LWUA 1SFCB 1T3JA 3BCCG 2KB7P 1PZQA 2QNWA 5E79E 3TNUA 2OYIA 1BSNA 2ZT9D 2HLOA 2E74B 4GT1A 1BGYD 3P7KA 5KAFE 3PP5A 3O6QB 3IN6A 2D2CC 1SVFA 2YO2A 1JNMA 2FFDB 2AXTH 2JR8A 3HZQA 1R8EA 3WU2H 1BCCD 1VF5D 1PP9J 1KFNA 1L0LG 5AW4B 2R3SA 4D6TG 2JB0A 2GZGA 5HGNA 2ITAA 1RO0A 1N86A 1IFJA 3G1GA 3S1KA 4JPZB 4LLHA 1PL5A 1JJ2O 5TJHA 2OYHC 4PD4D 2GZJA 3L73D 3CCLP 2EFJA 1BDCA 1SQQE 3M9QA 1MZ9A 4GODA 1L4AD 2LMLA 1EMVA 3CX5I 1KTMA 1HF9A 2VLNA 3RL0C 3LRYA 3EFGA 1A43A 1HJBA 4N3YB 1NKNA 2W90A 4XFYA 4ZMDA 5CMZA 1FBMA 3Q2YA 2YXQB 3NXSA 2FACA 3HD7A 3KYQA 2FQ1A 1VQKP 2KSJA 2KYVA 2XDJA 4BPHA 1OW8A 1BCCE 1PP9G 1URQD 3CXCO 2E76D 4BXLA 1U7JA 4OWFA 3IF4A 1JMMA 2KG9A 2B88A 5H2FE 1G1JA 1PPJE 3HE5A 3MHVA 2CPSA 3G3ZA 2KS1B 2IZ1A 3B8EB 1DD4A 5KKZB 1GL2B 4H0LD 5APWA 2LPKA 3VP9A 3JCUH 1NHLA 1FOSF 4OGQB 3RL0D 4WWIA 5GTIE 1Q2NA 3FXEA 3NY7B 2JO0A 1L0LK 4JYCA 2IFMA 3H1LE 4H0LC 2MJZA 1KV4A 4L75A 3SWYA 3L75D 3H1ID 3P8CE 1LT1A 1YJWP 3BASA 2W6JH 3M06A 7CEIA 2RMZA 5BVZA 2Q3EA 5CJ0A 1X8YA 3H1LG 3RBZA 1WMKA 1Q86Q 3L70D 4TLFA 5APYA 3EJDA 1KD1Q 2LL8A 4K3AA 3QWOC 3TYYA 3TDKA 4W7YA 1EXJA 4WVZA 1AQ5A 2Q3IA 3MUDA 1VF5C 4U7JA 4XRQA 4Y99C 3GZLA 1T2KD 2H88C 4CA3A 2WPRA 2QE7H 4H44C 2WT7B 3I55P 1GDTA 4U0EA 2HG5D 1KMIZ 1SQXK 2BASA 2J59M 1BCCG 1PP9E 2A45I 1NWQA 2FYNC 1VQ5P 1YQ3C 5B5EE 1LTGC 2GZIA 1SQVK 1BE3G 2QSIA 3WUVA 3VN0A 1FR2A 2YKPA 3AE4C 3L74J 2KG8A 3AEFC 5AVYB 2ZXXA 1RE4A 1URQC 1L0ND 2N5IA 5GTIH 5DJUB 2KG6A 3V5BA 3L70E 1HWTC 1T8ZA 1KILD 3A7OA 2QVAA 3G6EP 1GL2C 1JY2O 1NTMD 4PD4I 5APVA 1JM0A 5I4TG 1N8RQ 5F2KA 3USSA 3ZDMA 1E79H 2QRXA 3H1JG 1W2EA 3VYIA 1IUQA 4U0BA 2MF4A 2FYUJ 4D6TE 2P10A 5KJ7C 3GW6A 3H4EA 3I5CA 1SQQK 3V2NA 2V4HA 2O01H 1SQVG 2MKVA 1BE3J 1GZLA 3L35A 5CCHC 1YIJP 1RE3A 1S5LX 2BHVA 2M8LA 4DZOA 1SS1A 3A0BH 1GK6A 3GF7A 1UIIA 1LTAC 4AQRD 1M57D 4Y99B 1N73A 3KXDA 3RG6C 1L4AB 2KW2A 1RF0A 1H0TA 2Q6QA 2K0YA 3L71G 3CPWO 2MY5A 3CCEP 1NTKE 3C8VA 3L70J 4R0MA 2PY8A 2H7HA 1JY3O 3CCVP 1GXGA 1KILE 1M1JB 5M1BA 3IR9A 1GXHA 2ZFCA 1VPCA 2YMYA 1L0HA 2KNCA 4QNBA 3EQ2A 2KK7A 2E76B 3B5NB 3N4XA 1JO5A 3AEDC 1NU1E 4UB6H 3H1HJ 1LJ2A 1PGJA 3GHGB 3TGUJ 2VSQA 3A0BE 2R32A 3CCRP 1IK9A 1E5WA 1KLPA 3UIAA 3JCUE 1IZNB 2M5AB 1KZUB 1S5LH 1N2DC 5KLIC 1YJ9P 3RK2B 3L72D 4WYMA 3M1MA 1KC8Q 2WMMA 2Q7CA 5C39A 3FGAD 1K30A 1OFCX 3SWKA 5K5GB 1EZVI 1Z56A 3C9IA 3TNUB 2X2BA 3DPHA 2LOLA 2VLPA 2ONTA 1Q81Q 4PV1C 2QJYC 1FU1A 2PGDA 2JWAA 4O9BA 4PH1A 4EDFA 3H1HG 2I8DA 2H43A 2QJPB 1WT6A 2LKMA 3M0DC 1SQXE 3BCCJ 2P2UA 2IZ0A 4PD4H 1IFNA 1LT9A 1NU1D 2PEIA 2R3CA 3HD7C 4B86A 4I6MC 4R4LA 1KQGB 1AFOA 1FZAA 2IYOA 5KLVD 3B4SA 4COCA 4KJMA 1OXZA 1USDA 2FXPA 3W68A 2L91A 2OTKE 2KR5A 3E1IA 4EYYQ 1K04A 5CHXA 1Q82Q 3H1KG 5AVZB 4I7ZB 2EG5A 2A06E 2ZJSE 1NTZJ 2KUBA 4ASWA 3S9OA 4IL6H 3V4QA 1L2PA 2AEMA 1J1EB 4KHXA 2KLUA 1A8OA 3V2QA 1BGYJ 2Y9YA 4GR2A 1L0LE 3PRJA 4M0IA 2FYUG 2WPSA 3WBHA 1VQ8P 3RK3D 1DEEG 3RBXA 2K5XA 3VTPC 2C0XA 2OTLP 1BDDA 2GM4A 5KLVJ 1AF8A 4U0AA 3WUUA 4L74A 2QM8A 2E76C 3N7NA 2MVUA 2XT1A 2W83C 3GF3A 3II6A 3SFEC 2XNDH 3M9HA 3Q1MA 1OIPA 2VRSA 3L74E 1SFCA 1N7SB 1NTKK 5KLIB 1QVFO 4XROA 3JSVC 5AVVB 5H2FH 1ZRTD 4IOIH 4EI2A 2JBGA 2JYGA 5E79H 1VHNA 1EXIA 1LTJA 2FHSC 4H2YC 1AUMA 2ZAEB 3L72J 4HJGH 3AE7C 2K92A 3H47A 2ZVNB 5APUA 3BRVB 1HJ0A 2Q5UA 2BEZF 1YQ4C 2DW3A 1JOCA 3CC4P 1SQBD 3ABVC 1HVVA 4C46A 2HODA 4DCKA 1UJZA 3LIEA 1JTHB 3GHGA 1E6JP 1LP1A 4C7NB 3G0VA 1NU1J 3H1HD 4K35A 4H44B 1SQXG 1FOSE 5AW6B 1KYOE 1P84I 3K5BA 3RK3E 1ZN5A 3S4RA 2FFDA 4IL6E 3LMOA 1L4AC 5GTHE 5EW5E 1NGMB 1K05A 3CXHD 1UIXA 5BS1A 5F2OA 2KOQA 2KZIA 2WSSH 1GW4A 2A06G 3PHLA 2M3EA 1SQVJ 5APQA 4GIFA 1JY3N 1EIAA 3H1IG 4XE5B 3W67A 1EDLA 1KQFB 1CI6A 4H13B 1HGVA 3SSUA 2QM7A 1P84H 1URQA 1MFTA 5HVCA 2R5BA 4DJGA 2K37A 5DCKA 2QJYB 3D71A 2GUSA 1T8KA 2KODA 2AVAA 1KYOD 2E75C 3TGUE 2AFDA 1GU5A 3CWBE 1RHZB 1HY8A 2CQ8A 1LTJB 1MFZA 4H13D 5CBOA 2FYUD 2FYUK 1VQPP 4GR6A 2JO1A 2W6BA 3NTNA 3AEGC 1M90Q 4WY4C 2BCCD 2M8NA 4XFXA 3MZWB 3G9RA 4WY4A 4OGQC 2O01N 2N98A 4AUWA 5F2NA 3M9BA 4PWVB 2E74C 2GUVA 2WSCH 2CGQA 1Q7YQ 3AEBC 1RE3C 2D2CD 1DD3A 1W5CE 3IFMA 4HYTB 1NTZG 2XZRA 1HQBA 2WQYC 3H6PA 3B5IA 1FZFA 4N6JA 1NH4A 4U0FA 5AVUB 3V4WA 3AECC 3G71P 2G3AA 2P7JA 2H8PD 3NTEA 2K88A 1BE3E 2AFEA 3CMAP 1IFMA 2WTYA 1AJYA 1PV3A 2K1AA 5AW5B 4I7ZC 1VDFA 2PRRA 5AVRB 1AA0A 3A0HE 4N78D 4Y28J 5TISE 4HB1A 1OX3A 3A0HH 5EFWB 2WZ7A 3CCQP 1NTMJ 4EIJA 5APXA 3F89A 1IFIA 4U3FG 1L0NK 3B5NC 5CCHD 4ASVA 2WSCJ 2E75B 2BCCJ 3FXDA 1N73C 1R5LA 4JF7A 3VMAA 1PEUA 2ZT9C 1X22A 2ZXEB 3L74D 1NTMK 5AW1B 5APTA 1IMPA 5HGOA 1EOQA 2MVVA 1DH3A 1OZHA 2N50A 5AW3B 3F5HA 1S72P 2LF4A 1E0HA 3RK2D 1FZCB 2XV5A 5CCGA 2I1KA 2K0DX 1N73B 1NU1K 3CD6P 1ZRTE 4IFDK 3P05A 3VOPA 1ACPA 4JYBA 4RESB 2C9LY 4XFJA 3HUSA 5L8RJ 4UB6E 3VMYA 1GL2D 2Z45A 1QRJA 1IK7A 1EZVD 2K9JA 1OW6A 5KJ7A 1M6EX 2L4BA 2OGUA 2BQ1E 3TF5A 2WPTA 3PJSK 1VQOP 1H88A 1JY3P 4JBZA 2LTEA 2YO3A 2NRGA 3PTZA 3CCJP 2M8PA 4W7ZA 3GJNA 3G29A 3CI9A 2WSFH 2HPCA 1DNYA 2N1TD 1NTKJ 1NYHA 5KP8B 2E5YA 2FXOA 2MR7A 2JKVA 1KFMA 3HTKA 2KOOA 2EHTA 2XNXA 1RF0C 4OGQD 2GYKA 1OR5A 2N1TA 1FJKA 3CCMP 1X79B 2PEOA 1F80D 4BRYA 4OH8B 2ROQA 3M91A 1FJPA 5CZDB 3EJBA 3B4QA 2MD9A 1AV1A 2E5TA 1VKUA 3CWBG 1HTLC 1VQNP 2JDIH 4GDOA 4XA4A 2WPQA 2NZ2A 2YIUB 1BCCJ 2W6AA 1S9KE 4BPGA 2KNCB 5AVSB 2PAJA 1PEMA 1U57A 2CNRA 1SLQA 2E42A 2YKQA 2EHSA 3H1LD 1EZVE 2O01J 2PEQA 5AW8B 3G26A 2FADA 3L71J 1K9MQ 3H1IE 2AEFA 5KKZC 3CCUP 3MGEA 3KPEA 3L37A 3QH9A 2XZ0D 2DNWA 2B9BA 2FYUE 3U43A 3OW2O 3Q5RA 2NPSD 1ZNVA 2AF8A 5HGMA 2PENA 1KILA 3L73J 5AVWB 1LWUB 2Q1KA 5KLVK 1NAYA 1S2EA 5AW7B 2PEMA 4PJ0H 1BXIA 2KGEA 1EC5A 5JPAA 1S5LE 1SQPD 3WU2E 4TT3H 1FDOA 2IBZD 1PPJG 1PFIA 1M8OB 3D6YA 2E74D 3SFDC 1PPJD 1JTHA 2K93A 1JB0J 1M1JA 1PP9D 5CBNA 3L74G 1QL1A 3HD7D 3HD7B 1VQ4P 1VQ9P 5AW9B 1JCCA 1ZMEC 2M5RA 1HGZA 2O3JA 1L0NG 1L0NE 1H8AA 1NTZD 1IFDA 3CX5D 1D7MA 3L73E 3B71A 1DX7A 1PEQA 1SQQD 3CC7P 1FAVA 1GL2A 4COPA 2LXBA 1ZW0A 1RQVA 2E75D 1KQSO 2DGYA 3H1HE 2JJLA 2Y0DA 3U1AA 2KWLA 2WVRA 1Y47A 3KDPB 2POHA 5KLVG 4F37A 1P84E 2J5UA 3CMEP 4BPFA 2JQ4A 2KI7B 2Z44A 4YTPC 1KORA 5KP6B 1VQ6P 1GW3A 3BCCD 4D6TD 3KQGA 2IDBA 3V6IA 2A45G 3CWBJ 2NPSB 4IZ6A 3E2DA 1DEBA 2PEJA 4U0CA 2OYHB 2GDWA 3GHGC 1M56D 3H1KJ 2WWWA 1YHQP 2YIUC 2LKIA 2WPVB 1EDIA 2IBZG 1NKZB 4LGDE 2ZYGA 3MD0A 3CXHH 3G4SP 1JY2N 1QLED 1RH5B 2OARA 2Y9ZA 1FS0E 2P9XA 2XXMA 3V2PA 2KS1A 4GKGA 3TGUD 2KOSA 2IYPA 3Q20A 4ZKUA 1EDJA 4UHPB 3TGUG 1LTJC 2CK3H 5BU5A 1FC2C 2RKLA 5AVQB 5CJ4A 2FYZA 4U3FD 4Z1MH 2R5DA 1RO2A 1M6NA 1P84D 2KIKA 2K9YA 3D6ZA 1YI2P 3CXHI 5TISH 3P32A 1YITP 1G2CB 1JUNA 1PIXA 3B5ND 1HUCA 2HODB 1L0LJ 2I1JA 2J58A 2WT7A 2Q9IA 1YBKA 2LXCB 1KB9E 1L4AA 2N5HA 3E1RA 4OVNF 1OVVA 3L72E 4PV1D 2VLOA 2SPZA 3TK1A 2OYIB 5CCGD 3H1JE 4L73A 4NEOA 1H89A 1JCDA 2L9FA 4U3FJ 1YJNP 2FBWC 2O1KA 1EQ7A 3R2PA 2JYLA 1BE3D 2C0WA 2KSEA 3RL0B 1URQB 3HRNA 2QJKC 2ZT9B 3HYBA 1NAFA 3CCSP 2RH0A 3EFFK 1HH0A 2K94A 1LGHB 3HE4B 1LTBC 2JGPA 3CLQA 3FX0A 2OTJP 1X0TA 1BGYE 2N6YA 3GLMA 2C9NY 4H44D 5AW2B 1KN7A 4IFFA 3MGNA 3H1JJ 4L76A 5B66H 3RL0g 5DJTB 3DTJA 2KORA 4U3FE 1PGPA 2Y0CA 2G8YA 4CPGA 4U0DA 1SQVE 1N7SD 1T3UA 5HV8A 3AEAC 1MZ8A 2FXMA 1L0NJ 1ZP0C 2KLVA 2M3BA 4BWNA 1JMBA 3BVHA 4YPCA 2CG5B 1RF1A 1AQTA 1SFCD 1TU3F 2ZYAA 2HYNA 1LWUC 3LW5H 1RF1C 2FKWB 1FZGA 1CZQA 1S3JA 2XV6A 4PD4E 5KAFH 3L75E 3WUTA 1W2BO 3DS4A 3DS5A 1KB9I 2K3RA 1WRGA 1LTSC 2GA1A 2P1JA 5BU8B 4LC1A 4PXHB 1CI6B 2KZJA 2W8ZA 1SQQJ 4RO0A 3DS0A 2RN0A 2E43A 1LTIC 3BATA 2FQ2A 2UWJE 3HUSC 1GU4A 3H32B 3E7KA 4A7PA 2PFXA 5KAIH 3H1IJ 1M1JC 3VP8A 3L75J 1MV8A 1VL2A 1H0TB 1SQPK 1ZR4A 1T2KC 1FZEA 2R44A 1EDKA 4RJTA 1L0IA 1XTGB 2FQ0A 3C1LA 2N6ZA 1Y9BA 4NPDA 1VQ7P 2A06D 2P58A 1SQBG 1ZXGA 5AVXB 3AE2C 1SQPJ 3AEEC 3L73G 3KHUA 3B5NA 1FZBA 4RKUJ 3RK3C 3GKLC 1XTCC 4PJ0E 4H13C 3HE5B 5B5EH 2Z5IA 2GDXA 2PEKA 1NTME 3PLNA 1G2CA 3DS2A 3CC2P 3CX5H 1X3OA 5CCGC 3SWFA 3L71D 1AVYA 3H1LJ 4XFZA 2Z4EA 2KOGA 4QMAA 3CXHE 1USEA 2QA4P 1J2JB 2D2CB 3VMZA 3CL3D 3RK2C 1LTTC 2O1JA 2AXCA 3HE4A 3L72G 2BEQD 2XU6A 2QJPC 1OMIA 2GZFA 4DT0A 1IMQA 3LW5J 1U7MA 4WY4D 2W27A 4DOJA 1CW5A 4H0LB 3M0AA 2N1TB 1M74A 1LP1B 4C7NA 1ZR2A 4PV1B 1GK4A 5KTBA 1LT9C 1QL2A 2A45H 3BRTB 1CSBA 1S4XA 3MTUE 3G28A 4JQ0D 1N7LA 1N7SA 3O6QA 4AYCA 1KB9D 1NQ4A 4HKZH 3I56P 2Y0EA 4NPEA 3R4YA 2VLQA 2N1TC 1OWAA 1OW7A 1J1EC 3CX5E 3O8ZA 2GDYA 3TSIA 2V7QJ 2M0BA 4MN4C 4MRTC 1NTKD 3L71E 2BCCG 2FAEA 1IFPA 1PGQA 4YXWH 2N9BA 1NTKG 1Q90D 3L4FA 2QG4A 2GZEA 4EOTA 2WSFJ 3P8MC 2BCCE 3G1IA 1BGYG 2B87A 3V2RA 2WSEJ 3AE3C 4C7RA 3EJEA 2P67A 1YYCA 4IL6X 1QGKB 4PH0A 2NPSC 3GG2A 2BUOA 1OVUA 2PNGA 2B89A 3U1CA 2FVAA 4DG9A 3U59A 1IJDB 2L0QA 1GTWA 2JEEA 3Q5PA 1FDMA 4QKOA 3RK3B 3OAKA 3EWKA 3MUDC 3H32A 3L36A 1M1KQ 2LIUA 1R5SA 2IBZI 1QEXA 1RNIA 1A02J 1OVRA 3A3YB 1CEIA 4WY4B 1BAJA 2CWOA 3G21A 1SFCC 3MIWA 2IFNA 1G1IA 2OYOA 1DV5A 2B87B 2Z46A 3P8CD 4I1LA 2KGDA 1FDIA 2EIAA 4GOFA 4R4MA 2QEXP 2OYHA 4N78E 1NJIQ 1IC2A 2YKOA 3OA7A 2AXTE 1JY2P 1MUUA 4M3LA 1AVOA 3L75G 2AEJA 3VMXA 3H25A 2FY8A 2KGAA 3DS3A 1DIPA 1X9VA 4I2LC 1QX8A 3KZIE 3RGUA 3WMM0 2WITA 4KT0J 3NFQA 4UB8H 1KQLA 5EJDA 2WSEH 2IX7C 3MP7B 5BS2A 2FYNB 1D1DA 2OQQA 2FFDC 2XKMA 5APSA 2KXPB 2OYIC 1ZLLA 2K2QA 1VF5B 2KGCA 1KYOI 4ZKPA 1RE4C 2YNYA 1L0LD 2V7QH 4YXDC 3H1JD 1Z6MA 1FZCC 1LNQA 1KB9H 3NMDA 1RY3A 1FZCA 1MKMA 3L70G 4W80A 1S1CX 2N9YB 1IO4A 5HGLA 3AE9C 1SQXD 2M8RA 4IPYA 4H2WC 1SP4A 1NOHA 4WB4A 1EZVG 1ZMBA 2IPPA 2K9JB 2QIWA 1HBWA 1T6AA 2KP8A 4ZNCA 5KLVE 1N7SC 1Y8AA 1NU1G 4UB8E 2YMKA 1RF1B 1SQBK 2L22A 2E1MA 1SQXJ 3BCCE 3CE7A 3IAOA 1KYOH 3KZIH 3H1KE 3T97B 1SQPE 1SQPG 4GOEA 1GD2E 5CCHA 2LR2A 1SQVD 2PP6A 3A5TA 4H2XC 2YXRB 2HPCB 2HFED 2JAZA 1ZOYC 1RQUA 2NO8A 1S9KD 3Q5SA 1BSHA 3HTKB 3Q3DA 3AE8C
chains in the Genus database with same CATH topology
1VQPP 4GR6A 2PEKA 1KQSO 1PEUA 2DGYA 1M90Q 1Q82Q 2L6EA 2M8NA 4QNBA 4XFXA 3CC4P 4PH0A 5HGOA 1EOQA 3DS2A 1YI2P 2EG5A 3CC2P 1S72P 2BUOA 2LF4A 1PEMA 1YITP 1E6JP 3G6EP 1VQLP 2XV6A 3CMEP 3G0VA 2PEQA 3CD6P 3G26A 4XFZA 1K9MQ 3P05A 5F2NA 5I4TG 2Z44A 1W2BO 1N8RQ 5F2KA 1VQ6P 3DS4A 3DS5A 3CCRP 3HZQA 3CCUP 2QA4P 2JO0A 3MGEA 3DS1A 1A8OA 2Z45A 1M1KQ 1QRJA 4GR2A 1IUQA 1Q7YQ 3E2DA 1M6EX 1RNIA 4M0IA 5HGLA 4U0BA 3OW2O 5HGNA 1RO0A 2BQ1E 1YJWP 2PEJA 3WBHA 4IPYA 5BS1A 4U0CA 3G1GA 5F2OA 1BAJA 2CWOA 3G21A 1YJ9P 5HGMA 1YJNP 1VQ8P 3H4EA 4WYMA 1VQOP 3M1MA 2PENA 1KC8Q 2JYLA 1Q86Q 1ZMBA 1M74A 3DS0A 1K30A 1YHQP 3B5IA 1KD1Q 1JJ2O 2OTLP 2Z46A 4U0FA 4U0AA 3CCJP 3HYBA 2EIAA 1K73Q 3G71P 3CCSP 1K8AQ 3CCLP 2M8PA 2EFJA 2PEMA 2QEXP 3G29A 1YIJP 2XT1A 3DPHA 3G28A 3NTEA 2BHVA 2M8LA 5JPAA 1NJIQ 2ONTA 3CMAP 4XRQA 3G4SP 2E1MA 1Q81Q 4PH1A 3I56P 1EIAA 1PEOA 3VRLC 2OARA 3LRYA 2OTJP 3DS3A 3RG6C 1VQNP 1VQ4P 3I55P 2P9XA 1VQ9P 4U0EA 1A43A 1VQ7P 2XXMA 3CCMP 2PEOA 3Q20A 4XFYA 2PEIA 3CCQP 3DTJA 5DCKA 1QVGO 1QVFO 4XROA 3CPWO 1VQ5P 2KODA 2JYGA 3CCEP 4COCA 1PEQA 1VQKP 4U0DA 3G1IA 2PY8A 3CXCO 1AUMA 3CCVP 3CC7P 5BS2A 4COPA 3H0DA 1RO2A 1VQMP 3H47A 1D1DA 1M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  3CCU P;  1VQP P;  2QA4 P;  3CCJ P;  1KQS O;  1K73 Q;  3CCM P;  3G71 P;  3CCS P;  1K8A Q;  3CCL P;  1M90 Q;  2QEX P;  1Q82 Q;  1YIJ P;  1M1K Q;  3CCQ P;  1QVG O;  1QVF O;  3CC4 P;  1NJI Q;  1YI2 P;  3CMA P;  1Q7Y Q;  3CPW O;  1VQ5 P;  3CC2 P;  3G4S P;  3OW2 O;  1Q81 Q;  1S72 P;  1YJW P;  3CCE P;  3I56 P;  1YIT P;  3G6E P;  1VQL P;  1YJ9 P;  1YJN P;  1VQ8 P;  1VQK P;  3CME P;  1VQO P;  3CXC O;  1KC8 Q;  1Q86 Q;  2OTJ P;  3CCV P;  3CD6 P;  3CC7 P;  1YHQ P;  1K9M Q;  3I55 P;  1KD1 Q;  1VQ4 P;  1JJ2 O;  1VQ9 P;  1VQN P;  1W2B O;  1N8R Q;  2OTL P;  1VQM P;  1VQ7 P;  1VQ6 P; 
#chains in the Genus database with same CATH topology
 1NTZ E;  5AW0 B;  2L5G B;  2NPS A;  2L6E A;  3CWB D;  3GZM A;  1LT9 B;  2JP3 A;  4IFM A;  1GPJ A;  3FWL A;  3PH0 A;  1VQL P;  2QJK B;  1SQQ G;  3JC2 2;  1J1D C;  1PGO A;  1A02 F;  1NO4 A;  3T97 A;  3AE6 C;  2JU2 A;  2JWD A;  5KP7 B;  3AE1 C;  1SQB J;  3DS1 A;  2MR8 A;  1NTZ K;  3LID A;  1AYI A;  1M7L A;  3HUS B;  1J1D B;  2IBZ E;  1YTZ I;  1FE6 A;  1NVO A;  5KJ7 D;  1K73 Q;  3GMA A;  1K8A Q;  3H1K D;  2ZVO B;  3A2A A;  5GTH H;  1KIL B;  2JU1 A;  4HH2 A;  2LIW A;  5B66 E;  5KAI E;  5AVT B;  1PEO A;  3VRL C;  2K0X A;  3FWN A;  2ZYD A;  4NPF X;  1YTZ T;  1SQB E;  3RG2 A;  4D6T J;  1KIL C;  2HR3 A;  2KOP A;  1UNK A;  1GMJ A;  2XZ1 C;  2FVE A;  2CPB A;  3OJA B;  2M5A A;  1QVG O;  3ITK A;  4WBA A;  2FVF A;  3D70 A;  2Z5H A;  3M0D A;  1JEK A;  1ZV8 A;  1NTM G;  2ERH A;  2H89 C;  4HKG A;  3H0D A;  4BRY B;  3AE5 C;  1VQM P;  1LWU A;  1SFC B;  1T3J A;  3BCC G;  2KB7 P;  1PZQ A;  2QNW A;  5E79 E;  3TNU A;  2OYI A;  1BSN A;  2ZT9 D;  2HLO A;  2E74 B;  4GT1 A;  1BGY D;  3P7K A;  5KAF E;  3PP5 A;  3O6Q B;  3IN6 A;  2D2C C;  1SVF A;  2YO2 A;  1JNM A;  2FFD B;  2AXT H;  2JR8 A;  3HZQ A;  1R8E A;  3WU2 H;  1BCC D;  1VF5 D;  1PP9 J;  1KFN A;  1L0L G;  5AW4 B;  2R3S A;  4D6T G;  2JB0 A;  2GZG A;  5HGN A;  2ITA A;  1RO0 A;  1N86 A;  1IFJ A;  3G1G A;  3S1K A;  4JPZ B;  4LLH A;  1PL5 A;  1JJ2 O;  5TJH A;  2OYH C;  4PD4 D;  2GZJ A;  3L73 D;  3CCL P;  2EFJ A;  1BDC A;  1SQQ E;  3M9Q A;  1MZ9 A;  4GOD A;  1L4A D;  2LML A;  1EMV A;  3CX5 I;  1KTM A;  1HF9 A;  2VLN A;  3RL0 C;  3LRY A;  3EFG A;  1A43 A;  1HJB A;  4N3Y B;  1NKN A;  2W90 A;  4XFY A;  4ZMD A;  5CMZ A;  1FBM A;  3Q2Y A;  2YXQ B;  3NXS A;  2FAC A;  3HD7 A;  3KYQ A;  2FQ1 A;  1VQK P;  2KSJ A;  2KYV A;  2XDJ A;  4BPH A;  1OW8 A;  1BCC E;  1PP9 G;  1URQ D;  3CXC O;  2E76 D;  4BXL A;  1U7J A;  4OWF A;  3IF4 A;  1JMM A;  2KG9 A;  2B88 A;  5H2F E;  1G1J A;  1PPJ E;  3HE5 A;  3MHV A;  2CPS A;  3G3Z A;  2KS1 B;  2IZ1 A;  3B8E B;  1DD4 A;  5KKZ B;  1GL2 B;  4H0L D;  5APW A;  2LPK A;  3VP9 A;  3JCU H;  1NHL A;  1FOS F;  4OGQ B;  3RL0 D;  4WWI A;  5GTI E;  1Q2N A;  3FXE A;  3NY7 B;  2JO0 A;  1L0L K;  4JYC A;  2IFM A;  3H1L E;  4H0L C;  2MJZ A;  1KV4 A;  4L75 A;  3SWY A;  3L75 D;  3H1I D;  3P8C E;  1LT1 A;  1YJW P;  3BAS A;  2W6J H;  3M06 A;  7CEI A;  2RMZ A;  5BVZ A;  2Q3E A;  5CJ0 A;  1X8Y A;  3H1L G;  3RBZ A;  1WMK A;  1Q86 Q;  3L70 D;  4TLF A;  5APY A;  3EJD A;  1KD1 Q;  2LL8 A;  4K3A A;  3QWO C;  3TYY A;  3TDK A;  4W7Y A;  1EXJ A;  4WVZ A;  1AQ5 A;  2Q3I A;  3MUD A;  1VF5 C;  4U7J A;  4XRQ A;  4Y99 C;  3GZL A;  1T2K D;  2H88 C;  4CA3 A;  2WPR A;  2QE7 H;  4H44 C;  2WT7 B;  3I55 P;  1GDT A;  4U0E A;  2HG5 D;  1KMI Z;  1SQX K;  2BAS A;  2J59 M;  1BCC G;  1PP9 E;  2A45 I;  1NWQ A;  2FYN C;  1VQ5 P;  1YQ3 C;  5B5E E;  1LTG C;  2GZI A;  1SQV K;  1BE3 G;  2QSI A;  3WUV A;  3VN0 A;  1FR2 A;  2YKP A;  3AE4 C;  3L74 J;  2KG8 A;  3AEF C;  5AVY B;  2ZXX A;  1RE4 A;  1URQ C;  1L0N D;  2N5I A;  5GTI H;  5DJU B;  2KG6 A;  3V5B A;  3L70 E;  1HWT C;  1T8Z A;  1KIL D;  3A7O A;  2QVA A;  3G6E P;  1GL2 C;  1JY2 O;  1NTM D;  4PD4 I;  5APV A;  1JM0 A;  5I4T G;  1N8R Q;  5F2K A;  3USS A;  3ZDM A;  1E79 H;  2QRX A;  3H1J G;  1W2E A;  3VYI A;  1IUQ A;  4U0B A;  2MF4 A;  2FYU J;  4D6T E;  2P10 A;  5KJ7 C;  3GW6 A;  3H4E A;  3I5C A;  1SQQ K;  3V2N A;  2V4H A;  2O01 H;  1SQV G;  2MKV A;  1BE3 J;  1GZL A;  3L35 A;  5CCH C;  1YIJ P;  1RE3 A;  1S5L X;  2BHV A;  2M8L A;  4DZO A;  1SS1 A;  3A0B H;  1GK6 A;  3GF7 A;  1UII A;  1LTA C;  4AQR D;  1M57 D;  4Y99 B;  1N73 A;  3KXD A;  3RG6 C;  1L4A B;  2KW2 A;  1RF0 A;  1H0T A;  2Q6Q A;  2K0Y A;  3L71 G;  3CPW O;  2MY5 A;  3CCE P;  1NTK E;  3C8V A;  3L70 J;  4R0M A;  2PY8 A;  2H7H A;  1JY3 O;  3CCV P;  1GXG A;  1KIL E;  1M1J B;  5M1B A;  3IR9 A;  1GXH A;  2ZFC A;  1VPC A;  2YMY A;  1L0H A;  2KNC A;  4QNB A;  3EQ2 A;  2KK7 A;  2E76 B;  3B5N B;  3N4X A;  1JO5 A;  3AED C;  1NU1 E;  4UB6 H;  3H1H J;  1LJ2 A;  1PGJ A;  3GHG B;  3TGU J;  2VSQ A;  3A0B E;  2R32 A;  3CCR P;  1IK9 A;  1E5W A;  1KLP A;  3UIA A;  3JCU E;  1IZN B;  2M5A B;  1KZU B;  1S5L H;  1N2D C;  5KLI C;  1YJ9 P;  3RK2 B;  3L72 D;  4WYM A;  3M1M A;  1KC8 Q;  2WMM A;  2Q7C A;  5C39 A;  3FGA D;  1K30 A;  1OFC X;  3SWK A;  5K5G B;  1EZV I;  1Z56 A;  3C9I A;  3TNU B;  2X2B A;  3DPH A;  2LOL A;  2VLP A;  2ONT A;  1Q81 Q;  4PV1 C;  2QJY C;  1FU1 A;  2PGD A;  2JWA A;  4O9B A;  4PH1 A;  4EDF A;  3H1H G;  2I8D A;  2H43 A;  2QJP B;  1WT6 A;  2LKM A;  3M0D C;  1SQX E;  3BCC J;  2P2U A;  2IZ0 A;  4PD4 H;  1IFN A;  1LT9 A;  1NU1 D;  2PEI A;  2R3C A;  3HD7 C;  4B86 A;  4I6M C;  4R4L A;  1KQG B;  1AFO A;  1FZA A;  2IYO A;  5KLV D;  3B4S A;  4COC A;  4KJM A;  1OXZ A;  1USD A;  2FXP A;  3W68 A;  2L91 A;  2OTK E;  2KR5 A;  3E1I A;  4EYY Q;  1K04 A;  5CHX A;  1Q82 Q;  3H1K G;  5AVZ B;  4I7Z B;  2EG5 A;  2A06 E;  2ZJS E;  1NTZ J;  2KUB A;  4ASW A;  3S9O A;  4IL6 H;  3V4Q A;  1L2P A;  2AEM A;  1J1E B;  4KHX A;  2KLU A;  1A8O A;  3V2Q A;  1BGY J;  2Y9Y A;  4GR2 A;  1L0L E;  3PRJ A;  4M0I A;  2FYU G;  2WPS A;  3WBH A;  1VQ8 P;  3RK3 D;  1DEE G;  3RBX A;  2K5X A;  3VTP C;  2C0X A;  2OTL P;  1BDD A;  2GM4 A;  5KLV J;  1AF8 A;  4U0A A;  3WUU A;  4L74 A;  2QM8 A;  2E76 C;  3N7N A;  2MVU A;  2XT1 A;  2W83 C;  3GF3 A;  3II6 A;  3SFE C;  2XND H;  3M9H A;  3Q1M A;  1OIP A;  2VRS A;  3L74 E;  1SFC A;  1N7S B;  1NTK K;  5KLI B;  1QVF O;  4XRO A;  3JSV C;  5AVV B;  5H2F H;  1ZRT D;  4IOI H;  4EI2 A;  2JBG A;  2JYG A;  5E79 H;  1VHN A;  1EXI A;  1LTJ A;  2FHS C;  4H2Y C;  1AUM A;  2ZAE B;  3L72 J;  4HJG H;  3AE7 C;  2K92 A;  3H47 A;  2ZVN B;  5APU A;  3BRV B;  1HJ0 A;  2Q5U A;  2BEZ F;  1YQ4 C;  2DW3 A;  1JOC A;  3CC4 P;  1SQB D;  3ABV C;  1HVV A;  4C46 A;  2HOD A;  4DCK A;  1UJZ A;  3LIE A;  1JTH B;  3GHG A;  1E6J P;  1LP1 A;  4C7N B;  3G0V A;  1NU1 J;  3H1H D;  4K35 A;  4H44 B;  1SQX G;  1FOS E;  5AW6 B;  1KYO E;  1P84 I;  3K5B A;  3RK3 E;  1ZN5 A;  3S4R A;  2FFD A;  4IL6 E;  3LMO A;  1L4A C;  5GTH E;  5EW5 E;  1NGM B;  1K05 A;  3CXH D;  1UIX A;  5BS1 A;  5F2O A;  2KOQ A;  2KZI A;  2WSS H;  1GW4 A;  2A06 G;  3PHL A;  2M3E A;  1SQV J;  5APQ A;  4GIF A;  1JY3 N;  1EIA A;  3H1I G;  4XE5 B;  3W67 A;  1EDL A;  1KQF B;  1CI6 A;  4H13 B;  1HGV A;  3SSU A;  2QM7 A;  1P84 H;  1URQ A;  1MFT A;  5HVC A;  2R5B A;  4DJG A;  2K37 A;  5DCK A;  2QJY B;  3D71 A;  2GUS A;  1T8K A;  2KOD A;  2AVA A;  1KYO D;  2E75 C;  3TGU E;  2AFD A;  1GU5 A;  3CWB E;  1RHZ B;  1HY8 A;  2CQ8 A;  1LTJ B;  1MFZ A;  4H13 D;  5CBO A;  2FYU D;  2FYU K;  1VQP P;  4GR6 A;  2JO1 A;  2W6B A;  3NTN A;  3AEG C;  1M90 Q;  4WY4 C;  2BCC D;  2M8N A;  4XFX A;  3MZW B;  3G9R A;  4WY4 A;  4OGQ C;  2O01 N;  2N98 A;  4AUW A;  5F2N A;  3M9B A;  4PWV B;  2E74 C;  2GUV A;  2WSC H;  2CGQ A;  1Q7Y Q;  3AEB C;  1RE3 C;  2D2C D;  1DD3 A;  1W5C E;  3IFM A;  4HYT B;  1NTZ G;  2XZR A;  1HQB A;  2WQY C;  3H6P A;  3B5I A;  1FZF A;  4N6J A;  1NH4 A;  4U0F A;  5AVU B;  3V4W A;  3AEC C;  3G71 P;  2G3A A;  2P7J A;  2H8P D;  3NTE A;  2K88 A;  1BE3 E;  2AFE A;  3CMA P;  1IFM A;  2WTY A;  1AJY A;  1PV3 A;  2K1A A;  5AW5 B;  4I7Z C;  1VDF A;  2PRR A;  5AVR B;  1AA0 A;  3A0H E;  4N78 D;  4Y28 J;  5TIS E;  4HB1 A;  1OX3 A;  3A0H H;  5EFW B;  2WZ7 A;  3CCQ P;  1NTM J;  4EIJ A;  5APX A;  3F89 A;  1IFI A;  4U3F G;  1L0N K;  3B5N C;  5CCH D;  4ASV A;  2WSC J;  2E75 B;  2BCC J;  3FXD A;  1N73 C;  1R5L A;  4JF7 A;  3VMA A;  1PEU A;  2ZT9 C;  1X22 A;  2ZXE B;  3L74 D;  1NTM K;  5AW1 B;  5APT A;  1IMP A;  5HGO A;  1EOQ A;  2MVV A;  1DH3 A;  1OZH A;  2N50 A;  5AW3 B;  3F5H A;  1S72 P;  2LF4 A;  1E0H A;  3RK2 D;  1FZC B;  2XV5 A;  5CCG A;  2I1K A;  2K0D X;  1N73 B;  1NU1 K;  3CD6 P;  1ZRT E;  4IFD K;  3P05 A;  3VOP A;  1ACP A;  4JYB A;  4RES B;  2C9L Y;  4XFJ A;  3HUS A;  5L8R J;  4UB6 E;  3VMY A;  1GL2 D;  2Z45 A;  1QRJ A;  1IK7 A;  1EZV D;  2K9J A;  1OW6 A;  5KJ7 A;  1M6E X;  2L4B A;  2OGU A;  2BQ1 E;  3TF5 A;  2WPT A;  3PJS K;  1VQO P;  1H88 A;  1JY3 P;  4JBZ A;  2LTE A;  2YO3 A;  2NRG A;  3PTZ A;  3CCJ P;  2M8P A;  4W7Z A;  3GJN A;  3G29 A;  3CI9 A;  2WSF H;  2HPC A;  1DNY A;  2N1T D;  1NTK J;  1NYH A;  5KP8 B;  2E5Y A;  2FXO A;  2MR7 A;  2JKV A;  1KFM A;  3HTK A;  2KOO A;  2EHT A;  2XNX A;  1RF0 C;  4OGQ D;  2GYK A;  1OR5 A;  2N1T A;  1FJK A;  3CCM P;  1X79 B;  2PEO A;  1F80 D;  4BRY A;  4OH8 B;  2ROQ A;  3M91 A;  1FJP A;  5CZD B;  3EJB A;  3B4Q A;  2MD9 A;  1AV1 A;  2E5T A;  1VKU A;  3CWB G;  1HTL C;  1VQN P;  2JDI H;  4GDO A;  4XA4 A;  2WPQ A;  2NZ2 A;  2YIU B;  1BCC J;  2W6A A;  1S9K E;  4BPG A;  2KNC B;  5AVS B;  2PAJ A;  1PEM A;  1U57 A;  2CNR A;  1SLQ A;  2E42 A;  2YKQ A;  2EHS A;  3H1L D;  1EZV E;  2O01 J;  2PEQ A;  5AW8 B;  3G26 A;  2FAD A;  3L71 J;  1K9M Q;  3H1I E;  2AEF A;  5KKZ C;  3CCU P;  3MGE A;  3KPE A;  3L37 A;  3QH9 A;  2XZ0 D;  2DNW A;  2B9B A;  2FYU E;  3U43 A;  3OW2 O;  3Q5R A;  2NPS D;  1ZNV A;  2AF8 A;  5HGM A;  2PEN A;  1KIL A;  3L73 J;  5AVW B;  1LWU B;  2Q1K A;  5KLV K;  1NAY A;  1S2E A;  5AW7 B;  2PEM A;  4PJ0 H;  1BXI A;  2KGE A;  1EC5 A;  5JPA A;  1S5L E;  1SQP D;  3WU2 E;  4TT3 H;  1FDO A;  2IBZ D;  1PPJ G;  1PFI A;  1M8O B;  3D6Y A;  2E74 D;  3SFD C;  1PPJ D;  1JTH A;  2K93 A;  1JB0 J;  1M1J A;  1PP9 D;  5CBN A;  3L74 G;  1QL1 A;  3HD7 D;  3HD7 B;  1VQ4 P;  1VQ9 P;  5AW9 B;  1JCC A;  1ZME C;  2M5R A;  1HGZ A;  2O3J A;  1L0N G;  1L0N E;  1H8A A;  1NTZ D;  1IFD A;  3CX5 D;  1D7M A;  3L73 E;  3B71 A;  1DX7 A;  1PEQ A;  1SQQ D;  3CC7 P;  1FAV A;  1GL2 A;  4COP A;  2LXB A;  1ZW0 A;  1RQV A;  2E75 D;  1KQS O;  2DGY A;  3H1H E;  2JJL A;  2Y0D A;  3U1A A;  2KWL A;  2WVR A;  1Y47 A;  3KDP B;  2POH A;  5KLV G;  4F37 A;  1P84 E;  2J5U A;  3CME P;  4BPF A;  2JQ4 A;  2KI7 B;  2Z44 A;  4YTP C;  1KOR A;  5KP6 B;  1VQ6 P;  1GW3 A;  3BCC D;  4D6T D;  3KQG A;  2IDB A;  3V6I A;  2A45 G;  3CWB J;  2NPS B;  4IZ6 A;  3E2D A;  1DEB A;  2PEJ A;  4U0C A;  2OYH B;  2GDW A;  3GHG C;  1M56 D;  3H1K J;  2WWW A;  1YHQ P;  2YIU C;  2LKI A;  2WPV B;  1EDI A;  2IBZ G;  1NKZ B;  4LGD E;  2ZYG A;  3MD0 A;  3CXH H;  3G4S P;  1JY2 N;  1QLE D;  1RH5 B;  2OAR A;  2Y9Z A;  1FS0 E;  2P9X A;  2XXM A;  3V2P A;  2KS1 A;  4GKG A;  3TGU D;  2KOS A;  2IYP A;  3Q20 A;  4ZKU A;  1EDJ A;  4UHP B;  3TGU G;  1LTJ C;  2CK3 H;  5BU5 A;  1FC2 C;  2RKL A;  5AVQ B;  5CJ4 A;  2FYZ A;  4U3F D;  4Z1M H;  2R5D A;  1RO2 A;  1M6N A;  1P84 D;  2KIK A;  2K9Y A;  3D6Z A;  1YI2 P;  3CXH I;  5TIS H;  3P32 A;  1YIT P;  1G2C B;  1JUN A;  1PIX A;  3B5N D;  1HUC A;  2HOD B;  1L0L J;  2I1J A;  2J58 A;  2WT7 A;  2Q9I A;  1YBK A;  2LXC B;  1KB9 E;  1L4A A;  2N5H A;  3E1R A;  4OVN F;  1OVV A;  3L72 E;  4PV1 D;  2VLO A;  2SPZ A;  3TK1 A;  2OYI B;  5CCG D;  3H1J E;  4L73 A;  4NEO A;  1H89 A;  1JCD A;  2L9F A;  4U3F J;  1YJN P;  2FBW C;  2O1K A;  1EQ7 A;  3R2P A;  2JYL A;  1BE3 D;  2C0W A;  2KSE A;  3RL0 B;  1URQ B;  3HRN A;  2QJK C;  2ZT9 B;  3HYB A;  1NAF A;  3CCS P;  2RH0 A;  3EFF K;  1HH0 A;  2K94 A;  1LGH B;  3HE4 B;  1LTB C;  2JGP A;  3CLQ A;  3FX0 A;  2OTJ P;  1X0T A;  1BGY E;  2N6Y A;  3GLM A;  2C9N Y;  4H44 D;  5AW2 B;  1KN7 A;  4IFF A;  3MGN A;  3H1J J;  4L76 A;  5B66 H;  3RL0 g;  5DJT B;  3DTJ A;  2KOR A;  4U3F E;  1PGP A;  2Y0C A;  2G8Y A;  4CPG A;  4U0D A;  1SQV E;  1N7S D;  1T3U A;  5HV8 A;  3AEA C;  1MZ8 A;  2FXM A;  1L0N J;  1ZP0 C;  2KLV A;  2M3B A;  4BWN A;  1JMB A;  3BVH A;  4YPC A;  2CG5 B;  1RF1 A;  1AQT A;  1SFC D;  1TU3 F;  2ZYA A;  2HYN A;  1LWU C;  3LW5 H;  1RF1 C;  2FKW B;  1FZG A;  1CZQ A;  1S3J A;  2XV6 A;  4PD4 E;  5KAF H;  3L75 E;  3WUT A;  1W2B O;  3DS4 A;  3DS5 A;  1KB9 I;  2K3R A;  1WRG A;  1LTS C;  2GA1 A;  2P1J A;  5BU8 B;  4LC1 A;  4PXH B;  1CI6 B;  2KZJ A;  2W8Z A;  1SQQ J;  4RO0 A;  3DS0 A;  2RN0 A;  2E43 A;  1LTI C;  3BAT A;  2FQ2 A;  2UWJ E;  3HUS C;  1GU4 A;  3H32 B;  3E7K A;  4A7P A;  2PFX A;  5KAI H;  3H1I J;  1M1J C;  3VP8 A;  3L75 J;  1MV8 A;  1VL2 A;  1H0T B;  1SQP K;  1ZR4 A;  1T2K C;  1FZE A;  2R44 A;  1EDK A;  4RJT A;  1L0I A;  1XTG B;  2FQ0 A;  3C1L A;  2N6Z A;  1Y9B A;  4NPD A;  1VQ7 P;  2A06 D;  2P58 A;  1SQB G;  1ZXG A;  5AVX B;  3AE2 C;  1SQP J;  3AEE C;  3L73 G;  3KHU A;  3B5N A;  1FZB A;  4RKU J;  3RK3 C;  3GKL C;  1XTC C;  4PJ0 E;  4H13 C;  3HE5 B;  5B5E H;  2Z5I A;  2GDX A;  2PEK A;  1NTM E;  3PLN A;  1G2C A;  3DS2 A;  3CC2 P;  3CX5 H;  1X3O A;  5CCG C;  3SWF A;  3L71 D;  1AVY A;  3H1L J;  4XFZ A;  2Z4E A;  2KOG A;  4QMA A;  3CXH E;  1USE A;  2QA4 P;  1J2J B;  2D2C B;  3VMZ A;  3CL3 D;  3RK2 C;  1LTT C;  2O1J A;  2AXC A;  3HE4 A;  3L72 G;  2BEQ D;  2XU6 A;  2QJP C;  1OMI A;  2GZF A;  4DT0 A;  1IMQ A;  3LW5 J;  1U7M A;  4WY4 D;  2W27 A;  4DOJ A;  1CW5 A;  4H0L B;  3M0A A;  2N1T B;  1M74 A;  1LP1 B;  4C7N A;  1ZR2 A;  4PV1 B;  1GK4 A;  5KTB A;  1LT9 C;  1QL2 A;  2A45 H;  3BRT B;  1CSB A;  1S4X A;  3MTU E;  3G28 A;  4JQ0 D;  1N7L A;  1N7S A;  3O6Q A;  4AYC A;  1KB9 D;  1NQ4 A;  4HKZ H;  3I56 P;  2Y0E A;  4NPE A;  3R4Y A;  2VLQ A;  2N1T C;  1OWA A;  1OW7 A;  1J1E C;  3CX5 E;  3O8Z A;  2GDY A;  3TSI A;  2V7Q J;  2M0B A;  4MN4 C;  4MRT C;  1NTK D;  3L71 E;  2BCC G;  2FAE A;  1IFP A;  1PGQ A;  4YXW H;  2N9B A;  1NTK G;  1Q90 D;  3L4F A;  2QG4 A;  2GZE A;  4EOT A;  2WSF J;  3P8M C;  2BCC E;  3G1I A;  1BGY G;  2B87 A;  3V2R A;  2WSE J;  3AE3 C;  4C7R A;  3EJE A;  2P67 A;  1YYC A;  4IL6 X;  1QGK B;  4PH0 A;  2NPS C;  3GG2 A;  2BUO A;  1OVU A;  2PNG A;  2B89 A;  3U1C A;  2FVA A;  4DG9 A;  3U59 A;  1IJD B;  2L0Q A;  1GTW A;  2JEE A;  3Q5P A;  1FDM A;  4QKO A;  3RK3 B;  3OAK A;  3EWK A;  3MUD C;  3H32 A;  3L36 A;  1M1K Q;  2LIU A;  1R5S A;  2IBZ I;  1QEX A;  1RNI A;  1A02 J;  1OVR A;  3A3Y B;  1CEI A;  4WY4 B;  1BAJ A;  2CWO A;  3G21 A;  1SFC C;  3MIW A;  2IFN A;  1G1I A;  2OYO A;  1DV5 A;  2B87 B;  2Z46 A;  3P8C D;  4I1L A;  2KGD A;  1FDI A;  2EIA A;  4GOF A;  4R4M A;  2QEX P;  2OYH A;  4N78 E;  1NJI Q;  1IC2 A;  2YKO A;  3OA7 A;  2AXT E;  1JY2 P;  1MUU A;  4M3L A;  1AVO A;  3L75 G;  2AEJ A;  3VMX A;  3H25 A;  2FY8 A;  2KGA A;  3DS3 A;  1DIP A;  1X9V A;  4I2L C;  1QX8 A;  3KZI E;  3RGU A;  3WMM 0;  2WIT A;  4KT0 J;  3NFQ A;  4UB8 H;  1KQL A;  5EJD A;  2WSE H;  2IX7 C;  3MP7 B;  5BS2 A;  2FYN B;  1D1D A;  2OQQ A;  2FFD C;  2XKM A;  5APS A;  2KXP B;  2OYI C;  1ZLL A;  2K2Q A;  1VF5 B;  2KGC A;  1KYO I;  4ZKP A;  1RE4 C;  2YNY A;  1L0L D;  2V7Q H;  4YXD C;  3H1J D;  1Z6M A;  1FZC C;  1LNQ A;  1KB9 H;  3NMD A;  1RY3 A;  1FZC A;  1MKM A;  3L70 G;  4W80 A;  1S1C X;  2N9Y B;  1IO4 A;  5HGL A;  3AE9 C;  1SQX D;  2M8R A;  4IPY A;  4H2W C;  1SP4 A;  1NOH A;  4WB4 A;  1EZV G;  1ZMB A;  2IPP A;  2K9J B;  2QIW A;  1HBW A;  1T6A A;  2KP8 A;  4ZNC A;  5KLV E;  1N7S C;  1Y8A A;  1NU1 G;  4UB8 E;  2YMK A;  1RF1 B;  1SQB K;  2L22 A;  2E1M A;  1SQX J;  3BCC E;  3CE7 A;  3IAO A;  1KYO H;  3KZI H;  3H1K E;  3T97 B;  1SQP E;  1SQP G;  4GOE A;  1GD2 E;  5CCH A;  2LR2 A;  1SQV D;  2PP6 A;  3A5T A;  4H2X C;  2YXR B;  2HPC B;  2HFE D;  2JAZ A;  1ZOY C;  1RQU A;  2NO8 A;  1S9K D;  3Q5S A;  1BSH A;  3HTK B;  3Q3D A;  3AE8 C; 
#chains in the Genus database with same CATH homology
 1VQP P;  4GR6 A;  2PEK A;  1KQS O;  1PEU A;  2DGY A;  1M90 Q;  1Q82 Q;  2L6E A;  2M8N A;  4QNB A;  4XFX A;  3CC4 P;  4PH0 A;  5HGO A;  1EOQ A;  3DS2 A;  1YI2 P;  2EG5 A;  3CC2 P;  1S72 P;  2BUO A;  2LF4 A;  1PEM A;  1YIT P;  1E6J P;  3G6E P;  1VQL P;  2XV6 A;  3CME P;  3G0V A;  2PEQ A;  3CD6 P;  3G26 A;  4XFZ A;  1K9M Q;  3P05 A;  5F2N A;  5I4T G;  2Z44 A;  1W2B O;  1N8R Q;  5F2K A;  1VQ6 P;  3DS4 A;  3DS5 A;  3CCR P;  3HZQ A;  3CCU P;  2QA4 P;  2JO0 A;  3MGE A;  3DS1 A;  1A8O A;  2Z45 A;  1M1K Q;  1QRJ A;  4GR2 A;  1IUQ A;  1Q7Y Q;  3E2D A;  1M6E X;  1RNI A;  4M0I A;  5HGL A;  4U0B A;  3OW2 O;  5HGN A;  1RO0 A;  2BQ1 E;  1YJW P;  2PEJ A;  3WBH A;  4IPY A;  5BS1 A;  4U0C A;  3G1G A;  5F2O A;  1BAJ A;  2CWO A;  3G21 A;  1YJ9 P;  5HGM A;  1YJN P;  1VQ8 P;  3H4E A;  4WYM A;  1VQO P;  3M1M A;  2PEN A;  1KC8 Q;  2JYL A;  1Q86 Q;  1ZMB A;  1M74 A;  3DS0 A;  1K30 A;  1YHQ P;  3B5I A;  1KD1 Q;  1JJ2 O;  2OTL P;  2Z46 A;  4U0F A;  4U0A A;  3CCJ P;  3HYB A;  2EIA A;  1K73 Q;  3G71 P;  3CCS P;  1K8A Q;  3CCL P;  2M8P A;  2EFJ A;  2PEM A;  2QEX P;  3G29 A;  1YIJ P;  2XT1 A;  3DPH A;  3G28 A;  3NTE A;  2BHV A;  2M8L A;  5JPA A;  1NJI Q;  2ONT A;  3CMA P;  4XRQ A;  3G4S P;  2E1M A;  1Q81 Q;  4PH1 A;  3I56 P;  1EIA A;  1PEO A;  3VRL C;  2OAR A;  3LRY A;  2OTJ P;  3DS3 A;  3RG6 C;  1VQN P;  1VQ4 P;  3I55 P;  2P9X A;  1VQ9 P;  4U0E A;  1A43 A;  1VQ7 P;  2XXM A;  3CCM P;  2PEO A;  3Q20 A;  4XFY A;  2PEI A;  3CCQ P;  3DTJ A;  5DCK A;  1QVG O;  1QVF O;  4XRO A;  3CPW O;  1VQ5 P;  2KOD A;  2JYG A;  3CCE P;  4COC A;  1PEQ A;  1VQK P;  4U0D A;  3G1I A;  2PY8 A;  3CXC O;  1AUM A;  3CCV P;  3CC7 P;  5BS2 A;  4COP A;  3H0D A;  1RO2 A;  1VQM P;  3H47 A;  1D1D A;  1M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...