1Q7YQ

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 51
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q7yQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q7yQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q7yQ03
1S72P 1VQ8P 3G71P 3CC2P 1M90Q 1VQ5P 1M1KQ 3CCLP 3CPWO 1VQOP 3CCQP 1VQ9P 3CD6P 3CCUP 1Q81Q 2QEXP 1K8AQ 1QVFO 1K9MQ 1VQMP 1VQPP 1JJ2O 1KD1Q 3G6EP 1VQ7P 3CXCO 1N8RQ 1KQSO 3OW2O 1VQLP 1YJNP 1K73Q 1YIJP 1W2BO 1VQ4P 3CCVP 1YHQP 1KC8Q 3CC4P 1VQNP 2OTJP 3CCJP 1QVGO 3I56P 1YJ9P 1Q86Q 1Q82Q 1VQKP 1YI2P 3CCMP 2OTLP 1YITP 1NJIQ 3CCEP 3CMAP 1YJWP 3I55P 3CMEP 2QA4P 3CC7P 1VQ6P 3CCRP 3CCSP 1Q7YQ 3G4SP
chains in the Genus database with same CATH superfamily
1QX8A 2KXPB 2M3BA 2P7JA 1IMQA 2Z5IA 3L75J 3MD0A 2JKVA 4HJGH 3C1LA 1OWAA 2PEMA 5AW7B 7CEIA 2MVUA 2M5AA 2JJLA 2UWJE 3BASA 1YQ4C 3P8CD 2YKQA 3VMZA 2JP3A 3AEAC 2JYGA 1OVRA 1BCCG 1SLQA 4UB8E 5KP7B 4NPFX 1AQ5A 1YQ3C 2C9LY 1JCCA 3CWBD 1BXIA 1IK9A 3GG2A 3KQGA 2Q9IA 3H1HG 5B66H 1GXHA 3Q5SA 3CPWO 2QJPB 1CEIA 1Q2NA 2WWWA 5KAFH 1IO4A 2N6YA 3FWLA 1HGVA 1NTKJ 3RL0C 2ITAA 3OA7A 2N9BA 1GK4A 5KKZC 2FYUE 1XTCC 1BE3J 3CCUP 3N7NA 3HE4A 1N7LA 1RE3A 1OW6A 4W7YA 1LJ2A 2XV5A 2DGYA 3RK2C 1RF0C 1H88A 2JYLA 1URQA 3D71A 1SQVE 1X22A 1YBKA 2JWAA 1JUNA 1VQ6P 1VQ5P 1USEA 1PPJG 3LW5J 4L73A 1HVVA 3GW6A 4QNBA 1OMIA 1VF5C 2Z44A 5B66E 4HKGA 4MRTC 3B5IA 3CCVP 2FYZA 2H88C 4OGQB 1IJDB 2CGQA 4XFJA 5KLIB 1MFZA 2Q1KA 2KZJA 2D2CD 1FE6A 4D6TD 5KAFE 2N98A 1X79B 1NTZK 1YTZI 2LIUA 1LWUA 5DJUB 2OYOA 2JR8A 5BU8B 2KG6A 2FYNC 4AQRD 1AFOA 1EDLA 2K1AA 3L74D 2GA1A 2N1TD 2JQ4A 3FXEA 2PEJA 2P10A 1SQQE 4Y99B 2HR3A 3M06A 1KILE 1NTME 1JOCA 4YXWH 5H2FH 1Q81Q 2XNXA 3IN6A 4TT3H 1CSBA 4ZNCA 5APYA 1Y8AA 1ZR4A 3KYQA 1JTHB 2ZAEB 4F37A 2HPCB 2R5DA 3NXSA 1RF1A 1SQBJ 3L75G 2PY8A 4QKOA 3GF3A 4U3FG 1HF9A 1SQPE 2M5RA 4L74A 2K3RA 1P84D 4PH1A 3D6YA 3NMDA 1ZP0C 2JB0A 1L0LE 2E1MA 1K73Q 3O6QB 2MD9A 1OXZA 2AEFA 3CL3D 2XT1A 2GDWA 5AVXB 3G29A 4H13D 4COPA 3CI9A 2W83C 2KZIA 4BPGA 1FU1A 3V2NA 2M8LA 2KP8A 4XFZA 1N7SC 2GDYA 5H2FE 3M0AA 1M8OB 1GU5A 3RG6C 5GTIH 1SQXJ 4CPGA 1FZAA 1BSNA 3SWYA 1HWTC 3G1GA 1M1JC 4WY4D 4BXLA 1CI6A 3AE9C 1AQTA 1SFCD 2QJYB 2OYHB 2N6ZA 1L0NK 1NAYA 1S5LX 2IBZG 3HE5A 3A3YB 4K35A 1K04A 1X3OA 1J1DB 2GZFA 3G9RA 4WB4A 5F2KA 3CXHD 2N1TB 4DT0A 2PNGA 4XFYA 3DS1A 1PPJD 2HODB 4XRQA 3HE4B 4KHXA 2KI7B 3OAKA 2ZFCA 2KK7A 2WSCJ 3RK3C 3H1JJ 2WSEJ 4R4MA 2J58A 5GTIE 5EW5E 1BE3E 2J59M 1VQ7P 1KILD 5CCHA 1NTMD 4DG9A 2LKIA 1W5CE 2LIWA 2I1JA 1AJYA 2JGPA 1HY8A 1M6EX 1RO2A 1VHNA 2N9YB 1X0TA 1OVUA 3H1LG 2OYIB 4ZMDA 1ZXGA 2QNWA 2KG9A 1VQPP 3G6EP 3GKLC 4W7ZA 4D6TJ 5HGNA 2ZYGA 1L0LD 3II6A 2VLPA 2YO3A 2GYKA 1S2EA 1DNYA 3A0HH 3HUSA 2WPSA 2AFEA 3G28A 3ABVC 3KDPB 4KJMA 1KYOI 1T2KC 2AXTH 1JO5A 1M74A 3Q3DA 2OTJP 4Z1MH 2KS1A 2M0BA 4JPZB 3MUDC 3HD7A 3AEGC 3L75D 3L72G 2KORA 1CW5A 3H32A 3GMAA 1Y47A 2B87B 2HYNA 1A43A 2M8PA 1RQVA 4M3LA 3CX5I 1KB9E 2FVEA 2JU1A 2KOOA 3RK2B 3HRNA 4C7NA 2P1JA 1WMKA 2GZGA 1JNMA 2MR8A 2L91A 1DEBA 2QEXP 1SQBE 5CJ0A 3VN0A 1VF5B 2P9XA 1VL2A 2FQ1A 3A0HE 3V4QA 4BPFA 4N6JA 5CHXA 2AVAA 2FYUJ 2R44A 3CWBG 5KTBA 5K5GB 3HYBA 2AXTE 4WBAA 1E6JP 4N3YB 1IMPA 1OW8A 3WUUA 1NTKD 1SQVJ 1JMBA 5AVWB 2FYNB 3L73E 1BE3D 1L4AA 1YITP 3TK1A 5KLVK 4DJGA 1GL2C 2WSEH 3MUDA 1LTAC 1N2DC 2K0XA 2KGEA 1SQXE 1QVFO 1EDIA 1YTZT 3T97B 1G2CB 1NU1E 1XTGB 2IFMA 4L76A 2ZT9C 3CLQA 3G71P 1M1KQ 2WPVB 3SSUA 1IZNB 1PP9E 5KJ7A 3V2RA 4KT0J 2KNCA 5EJDA 1ZMBA 1PGQA 2K5XA 2GUVA 2IPPA 5AW1B 1JY2P 4YTPC 1FS0E 1QL2A 2E75C 5AVUB 2WPQA 2A06D 4YXDC 4HYTB 2CWOA 4I1LA 1Q86Q 1M56D 1SQQJ 2K88A 3GHGA 2IBZI 4CA3A 3I55P 1OW7A 4GIFA 2R5BA 1HBWA 4D6TG 3AE8C 3GF7A 3M91A 1FJKA 3EWKA 4I6MC 1N7SB 3VP8A 1KB9D 2O01N 2NPSA 1D1DA 3M9BA 1SQPJ 2Q5UA 3CC2P 3L74G 1JY3N 1GL2A 3H1IJ 1M1JB 2GM4A 4UB6H 1YHQP 1SQBD 1DEEG 2WPRA 3NFQA 3VMAA 1ZR2A 4U0DA 1VQ8P 4OGQD 3EFGA 1PZQA 3USSA 2LF4A 3AEEC 4TLFA 1RE3C 2QE7H 2WSSH 1URQC 5AW8B 2IDBA 4IL6X 1EZVD 1PGOA 2FADA 1BAJA 2K9JB 1LTTC 4GODA 1USDA 3FGAD 2KSJA 3L73D 3AE2C 2VSQA 4N78D 2FFDA 1T8ZA 2AF8A 2DW3A 2FYUG 3EJEA 1SQXD 2PRRA 1EC5A 3B4SA 1PL5A 3H47A 4GKGA 3D70A 1ZLLA 4GR2A 4UB6E 1E5WA 1LTJA 1FZCA 1LWUC 3UIAA 1ZW0A 3WUVA 2X2BA 1JJ2O 2WITA 4XE5B 3GJNA 1PP9D 4U0CA 3CC4P 3V6IA 1GXGA 5CCGA 2K9YA 2WTYA 1JY2N 4IOIH 2E5YA 2QVAA 1QL1A 2RN0A 4K3AA 4BRYA 2BQ1E 4GOEA 4Y28J 1KTMA 1AV1A 2LMLA 1PIXA 1NO4A 3P05A 2PFXA 3SFDC 1LP1A 2YMKA 3I56P 1RF1C 3TGUE 1A02F 4I2LC 3H1JD 3CCSP 1NGMB 2GZEA 1NTZE 4WWIA 1Y9BA 2LXCB 3R4YA 1UIIA 3V2PA 1KYOH 2KB7P 2M3EA 1BGYE 1AVYA 4R0MA 2FXPA 1NTMG 2KR5A 4JF7A 3A7OA 3L70E 3PTZA 4PXHB 2KOGA 3VTPC 1E0HA 3CX5H 4B86A 1G1JA 1RH5B 5BS1A 1LT9C 2LL8A 2A45I 2FQ2A 2W8ZA 1AF8A 1L0LG 3B4QA 1A8OA 5AVVB 2EG5A 1PEUA 2WT7A 1GMJA 3MP7B 2P58A 4M0IA 1AVOA 3F89A 1MZ8A 2ZXXA 3DS5A 1MFTA 1KYOE 1OIPA 3RBZA 1FDOA 5KP6B 4WY4A 2ZYDA 1IFJA 1SFCA 3RG2A 2KWLA 5KLVJ 1HH0A 2LPKA 2Y0DA 5KAIH 5BVZA 2LOLA 4U7JA 3H1IE 5BU5A 1GW4A 3CX5E 2PENA 1SS1A 2M8RA 2G3AA 2ZT9B 3HTKA 2RMZA 1NWQA 2FXMA 3NY7B 5CCHC 1FAVA 2FYUD 4IL6H 5CZDB 3L73J 2M5AB 5APXA 2KGCA 1L0NE 1EXIA 1FDIA 1N86A 1DIPA 3PH0A 1IC2A 1LT9A 1E79H 2EFJA 3F5HA 1M90Q 4U0BA 5M1BA 1SQVD 3RL0D 3CE7A 1KILA 1P84I 1NTZD 1KMIZ 2POHA 1NU1J 3Q5PA 1NTKG 2FY8A 1L0LK 4AUWA 1LT1A 2XKMA 1BGYD 3A2AA 3RK2D 1GPJA 1BE3G 1RE4A 3HUSC 5KAIE 1PP9J 2W6BA 4BWNA 1DX7A 3DS2A 2JAZA 3L70D 1K9MQ 4GR6A 2L5GB 2Q3IA 5CBOA 1DH3A 1IFMA 1ZN5A 2Y9YA 3R2PA 2JU2A 3HD7C 2Q6QA 1VF5D 3PP5A 2J5UA 1M7LA 4IL6E 2BUOA 2MF4A 1J1EC 1SVFA 1L0HA 2KGAA 2Z45A 3MTUE 3VYIA 1SQQD 3G21A 1LP1B 3S9OA 4I7ZC 3LIEA 1HGZA 2E74C 1URQB 2N5IA 2A06G 1NJIQ 1PEQA 1UIXA 1YJWP 2BCCE 3TNUA 4RKUJ 4O9BA 2MVVA 1H89A 4IFDK 1HUCA 1QGKB 2QSIA 3RK3E 1KYOD 3H25A 2IBZE 3KXDA 4OWFA 3C8VA 5AW2B 2XDJA 1SQPD 4PV1C 3ZDMA 3CXHI 3CCMP 3DS0A 3B71A 3AEBC 3H1ID 2Z5HA 3Q5RA 2QJPC 1H0TA 2CQ8A 1LWUB 1N73A 5AW6B 4L75A 1NTKK 1MZ9A 3RBXA 1KORA 1L4AC 5AW9B 2LR2A 4JYCA 1IUQA 1QVGO 2K37A 3M9HA 2JEEA 2BHVA 1LTBC 1SQBG 2L6EA 3RL0B 2MR7A 1NAFA 1PV3A 2PEQA 3Q1MA 4H0LC 3TDKA 5KKZB 3CCQP 3SWFA 5AW3B 1J2JB 3V5BA 2ZJSE 2BEZF 4C46A 3B5NC 2SPZA 2HLOA 1YIJP 1HQBA 1M57D 2PGDA 4HH2A 1F80D 1JY3P 2QJKC 1RF1B 1EZVG 3WMM0 1R5SA 2B89A 4ZKPA 1EDKA 1N7SD 1NVOA 2GDXA 5KJ7C 1IFDA 3QWOC 5HV8A 2O01J 3L73G 2KOPA 1PEMA 1KQSO 2QM8A 1OZHA 1W2BO 1KC8Q 3GHGC 2Y0EA 5KLVE 1UJZA 1RY3A 2P67A 1SQXG 2EIAA 5JPAA 4PD4I 2NZ2A 3CCRP 2C9NY 4IFMA 4WYMA 1DD4A 1GZLA 3A5TA 2WVRA 1UNKA 3RGUA 2FHSC 2BEQD 5TJHA 2E43A 1ZV8A 3L72E 2H43A 2YO2A 5AVRB 3TGUJ 2KLVA 2NPSC 1NTZJ 1PP9G 2W27A 3AEFC 1GW3A 4JBZA 3DS4A 2KG8A 2CK3H 1AA0A 5DJTB 3EQ2A 1BDDA 1CI6B 1BGYJ 2VLQA 1ZNVA 2XZRA 2IYPA 1GTWA 1SQBK 1KQLA 1GDTA 3B5NA 3RK3D 4C7RA 2KW2A 1NKZB 3FWNA 3L70J 3L71E 3C9IA 4UHPB 2A45H 2ERHA 1IK7A 1S5LH 2QA4P 1KFMA 4RJTA 2XU6A 5AVYB 1JB0J 3HE5B 2L0QA 5APWA 3H1JG 3DPHA 1FC2C 1FOSF 1AYIA 3I5CA 3NTEA 2GZIA 3Q2YA 5F2OA 1QLED 1R8EA 2FFDC 2FBWC 2R3CA 1T3UA 2O1KA 4IFFA 4JQ0D 1SQXK 2H89C 1HJBA 3IFMA 1T2KD 3PJSK 2W6AA 2KOSA 1LTJC 3WU2H 1FZCC 2KOQA 4LC1A 2E42A 2YKOA 2K94A 1S5LE 2OYHC 2OGUA 1IFNA 2IFNA 4H2YC 1ZMEC 2B88A 5CCGC 1Z6MA 2KODA 1T3JA 3BCCE 2L4BA 3V2QA 2YMYA 2PP6A 2D2CC 1LGHB 2CPBA 3EFFK 1JTHA 1S3JA 2HPCA 2O01H 3LMOA 3IF4A 3HUSB 5KLVD 3ITKA 2QG4A 2QM7A 3CD6P 3JSVC 1EXJA 3EJDA 1P84H 1HTLC 1FZGA 1L0NJ 3V4WA 2PEKA 1T8KA 2R3SA 3AE6C 2HG5D 2KS1B 3L37A 1X8YA 3L35A 3O6QA 3M9QA 2H8PD 1KB9I 3HD7B 4EDFA 3CC7P 3P7KA 3H1KE 3H32B 3AE3C 1ZRTE 1J1EB 5AVSB 1PFIA 1LTIC 1G1IA 1K8AQ 2IYOA 4U3FJ 3RK3B 4HKZH 1VQMP 3L74E 4I7ZB 1FDMA 3WU2E 2XXMA 1FZFA 1RO0A 2E74B 4C7NB 2VLOA 2CG5B 1NKNA 1VDFA 3VMYA 3G26A 1MKMA 5AVZB 2NPSD 4XROA 3AE1C 2E76C 4R4LA 3L71D 1NU1D 4H2WC 3MGNA 2OYIC 1ACPA 3TGUG 1SQVG 1GL2D 5AW4B 4ASWA 2XV6A 1NTZG 4LGDE 2I1KA 2JO1A 2OYHA 4PV1B 1EZVI 2FQ0A 2WSFH 4H13C 1P84E 1VQ9P 3MZWB 2K92A 2VRSA 1NQ4A 1BGYG 2IX7C 3W68A 1OVVA 5APUA 2KLUA 2ZT9D 5AW5B 1YYCA 3TYYA 3K5BA 3L70G 2NRGA 2BCCJ 1BCCE 2LKMA 3CXHH 1L4AB 5AVQB 2N1TA 3E7KA 3CMAP 2C0WA 2E75D 1VKUA 4WY4C 4W80A 1SFCC 2Y0CA 2HODA 4H0LB 3RL0g 3SWKA 1PGPA 3M0DC 3P8MC 3LRYA 3BRTB 3H1HE 3B5NB 2Q7CA 2Q3EA 3L36A 1SQQG 2EHTA 1RNIA 5HGLA 2JBGA 2HFED 2YNYA 5CMZA 4LLHA 3CCEP 3VP9A 2QJKB 3TF5A 2YIUC 3D6ZA 2E5TA 3BCCD 4PH0A 5L8RJ 2KNCB 2V4HA 2W90A 2FYUK 2KYVA 3AE5C 3GZLA 2OYIA 1WRGA 4MN4C 1HJ0A 1N8RQ 3OW2O 2K93A 2N50A 1JCDA 5APVA 3GHGB 2OTKE 5APTA 1SQPG 3G1IA 1QRJA 5CCGD 2QRXA 4H44C 3JC22 1SQVK 1KILC 5HVCA 5I4TG 3H1IG 3CXHE 1FZBA 3H1KD 2IZ1A 3AECC 2LXBA 2V7QH 3N4XA 3H1LJ 1KD1Q 3M1MA 4GT1A 1ZRTD 1NOHA 2BASA 1PPJE 2OQQA 1U7MA 2NPSB 1FJPA 1RE4C 2OTLP 1JM0A 3CMEP 4PD4H 1Q7YQ 1URQD 2O1JA 1L0NG 1GL2B 3B8EB 2B87A 2Z46A 5C39A 2PAJA 3M0DA 1R5LA 2WQYC 1YJNP 3O8ZA 2H7HA 1RF0A 1MUUA 3Q20A 4A7PA 2I8DA 3MGEA 1DD3A 3H6PA 2NO8A 3L72J 1U57A 2GUSA 1VQOP 1NH4A 1SQQK 1X9VA 1KQFB 5E79H 1W2EA 2E76D 3LIDA 1NTMK 2CPSA 1BDCA 2ONTA 1EIAA 2JWDA 3VMXA 1EQ7A 2E75B 3GZMA 4OVNF 1GD2E 3S1KA 3AE4C 1BCCD 3MIWA 2L9FA 2IZ0A 3TGUD 2B9BA 2FFDB 2K2QA 2MKVA 3QH9A 1SQPK 4PD4E 3L71J 3CXCO 2G8YA 3L75E 3KPEA 4U3FE 4EYYQ 1WT6A 1VQNP 3H1HD 1LTJB 5BS2A 3CWBJ 1FZCB 1N73C 1PEOA 3E1RA 4GDOA 4QMAA 2C0XA 3AE7C 3U43A 2BCCG 4NPEA 2XZ0D 2MY5A 1S4XA 2W6JH 1VQ4P 2YXQB 3HZQA 3T97A 2WPTA 5E79E 1G2CA 2D2CB 4DOJA 3LW5H 1LTSC 3DS3A 1LTGC 4BRYB 3EJBA 3AEDC 5TISH 1CZQA 1ZOYC 4COCA 3P32A 2PEOA 2VLNA 3U1CA 3CCJP 1K05A 1YI2P 4DCKA 2ZVOB 3VRLC 1NYHA 1Z56A 2XNDH 1NTKE 1L0IA 1FR2A 2KGDA 3VOPA 1H8AA 1NHLA 4H44D 2Y9ZA 1DV5A 4GOFA 3BCCJ 5CBNA 1JMMA 1A02J 1N7SA 1KB9H 2MJZA 2N5HA 1S1CX 2GZJA 3G4SP 4EIJA 2E76B 3TSIA 2FVAA 3CX5D 2OARA 2JDIH 3KZIH 1M6NA 2M8NA 3PHLA 1M1JA 3W67A 1EDJA 1JEKA 1EMVA 3H1KJ 2FXOA 4XA4A 2FAEA 2AEMA 5TISE 3MHVA 4H13B 3DTJA 5EFWB 1L0ND 1OFCX 2WT7B 3L74J 2A06E 4WVZA 5KLVG 2FVFA 2AFDA 2KSEA 4XFXA 1QEXA 2JO0A 2DNWA 3SFEC 2YKPA 3OJAB 1FOSE 1U7JA 2ZXEB 5CCHD 3U1AA 3H1LE 1YJ9P 4PD4D 2P2UA 3BRVB 2K9JA 4U3FD 4WY4B 1OR5A 3U59A 5GTHH 3NTNA 3JCUH 3WUTA 1SFCB 4U0EA 3BVHA 1VPCA 2FKWB 1KV4A 4IZ6A 4OGQC 2Z4EA 5KLIC 3KZIE 4BPHA 2ZYAA 3HTKB 4NEOA 2YIUB 2YXRB 5KP8B 1L2PA 4PJ0H 2K0DX 3FX0A 5DCKA 1D7MA 3L71G 1NU1G 2AEJA 1RQUA 1BCCJ 3E2DA 2XZ1C 1S9KE 1LT9B 1KFNA 5HGMA 4Y99C 2AXCA 3HD7D 4H44B 3H1HJ 1Q90D 1KILB 2BCCD 2O3JA 1EZVE 4RO0A 4YPCA 4ASVA 2ZVNB 3PLNA 3H4EA 5B5EH 3P8CE 3KHUA 5GTHE 1KN7A 3JCUE 1JY3O 5HGOA 5AW0B 3IR9A 4OH8B 5APQA 2IBZD 1FZEA 2ROQA 5CJ4A 2WSCH 4N78E 2E74D 2WMMA 3L4FA 2WSFJ 5F2NA 3A0BH 4EI2A 4U0AA 1KLPA 3CWBE 1KZUB 3E1IA 1VQLP 2QIWA 4PJ0E 3FXDA 2A45G 4ZKUA 2KUBA 3H0DA 4HB1A 1S72P 4PV1D 1T6AA 3BCCG 2K0YA 1EOQA 1VQKP 1Q82Q 3TNUB 1AUMA 1IFPA 4U0FA 1K30A 1NTMJ 1TU3F 1NU1K 1L4AD 1SP4A 5B5EE 3H1LD 4H2XC 3CCLP 1PGJA 1GK6A 2PEIA 2WZ7A 3IAOA 5AVTB 2CNRA 2QJYC 2RKLA 5APSA 3H1KG 4H0LD 2KIKA 3H1JE 4PWVB 3A0BE 4DZOA 1LNQA 3B5ND 4UB8H 4EOTA 3WBHA 1KQGB 1OX3A 1RHZB 4JYBA 1GU4A 1H0TB 1N73B 3PRJA 2L22A 1L0LJ 3GLMA 1J1DC 1JY2O 5KJ7D 1IFIA 3S4RA 3BATA 2N1TC 3G0VA 2LTEA 1FBMA 2FACA 2R32A 4RESB 2V7QJ 1BSHA 2RH0A 2EHSA 3L72D 4IPYA 4NPDA 4D6TE 3G3ZA 1S9KD 1MV8A 4AYCA
chains in the Genus database with same CATH topology
3DTJA 4XROA 1RO2A 5BS2A 3NTEA 3CC2P 2BUOA 1VQ5P 3G29A 5F2NA 1PEOA 5F2OA 5I4TG 1E6JP 4U0AA 2BQ1E 2Z45A 4COPA 4QNBA 4XFXA 2Z44A 1VQPP 3G21A 2M8LA 1KD1Q 3M1MA 2JO0A 3G6EP 1PEMA 2PEMA 1KQSO 2XV6A 3P05A 4XFZA 1VQLP 3B5IA 1VQ4P 5HGNA 1W2BO 3CCVP 1YHQP 1KC8Q 3HZQA 3I56P 1YJ9P 2OTLP 1YITP 2EIAA 5JPAA 1YJWP 3RG6C 2PENA 1NJIQ 4U0DA 3CMEP 1PEQA 3CCRP 3CCSP 3H0DA 1Q7YQ 1VQ9P 1S72P 1VQ8P 4WYMA 3DS3A 2LF4A 2JYGA 3G28A 3G1GA 4U0EA 1QVFO 2Z46A 4COCA 1M74A 1YJNP 2PEOA 1EOQA 2KODA 2OTJP 3CCJP 1VQKP 1Q82Q 1YI2P 1BAJA 1AUMA 3CCMP 3Q20A 3CMAP 3DS0A 4U0FA 1K30A 2EFJA 3VRLC 3MGEA 2PEJA 3G71P 1M90Q 1M1KQ 3DS4A 4U0BA 3CCLP 1A43A 3CPWO 2M8PA 1VQOP 3CD6P 2PEIA 5DCKA 3LRYA 1Q81Q 3E2DA 2PEKA 1ZMBA 2ONTA 5BS1A 1EIAA 5F2KA 1RNIA 5HGLA 2CWOA 1IUQA 1QVGO 1Q86Q 4XFYA 3DS1A 3WBHA 2BHVA 3H47A 3CCEP 2L6EA 3I55P 2QA4P 5HGMA 3CC7P 3G4SP 4GR2A 4XRQA 4PH0A 2PEQA 2PY8A 3DPHA 1A8OA 3CCQP 2EG5A 3DS2A 3CCUP 2OARA 4PH1A 2QEXP 1PEUA 1K8AQ 1M6NA 1K9MQ 4GR6A 2M8NA 1VQMP 1JJ2O 2P9XA 3H4EA 1VQ7P 3CXCO 1N8RQ 3OW2O 2DGYA 2XXMA 2E1MA 4M0IA 1RO0A 1K73Q 1YIJP 4U0CA 3G0VA 3CC4P 1VQNP 2JYLA 5HGOA 4IPYA 3G1IA 1M6EX 2XT1A 1D1DA 1QRJA 3DS5A 1VQ6P 3G26A 3HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 P;  1VQ8 P;  3G71 P;  3CC2 P;  1M90 Q;  1VQ5 P;  1M1K Q;  3CCL P;  3CPW O;  1VQO P;  3CCQ P;  1VQ9 P;  3CD6 P;  3CCU P;  1Q81 Q;  2QEX P;  1K8A Q;  1QVF O;  1K9M Q;  1VQM P;  1VQP P;  1JJ2 O;  1KD1 Q;  3G6E P;  1VQ7 P;  3CXC O;  1N8R Q;  1KQS O;  3OW2 O;  1VQL P;  1YJN P;  1K73 Q;  1YIJ P;  1W2B O;  1VQ4 P;  3CCV P;  1YHQ P;  1KC8 Q;  3CC4 P;  1VQN P;  2OTJ P;  3CCJ P;  1QVG O;  3I56 P;  1YJ9 P;  1Q86 Q;  1Q82 Q;  1VQK P;  1YI2 P;  3CCM P;  2OTL P;  1YIT P;  1NJI Q;  3CCE P;  3CMA P;  1YJW P;  3I55 P;  3CME P;  2QA4 P;  3CC7 P;  1VQ6 P;  3CCR P;  3CCS P;  1Q7Y Q;  3G4S P; 
#chains in the Genus database with same CATH topology
 1QX8 A;  2KXP B;  2M3B A;  2P7J A;  1IMQ A;  2Z5I A;  3L75 J;  3MD0 A;  2JKV A;  4HJG H;  3C1L A;  1OWA A;  2PEM A;  5AW7 B;  7CEI A;  2MVU A;  2M5A A;  2JJL A;  2UWJ E;  3BAS A;  1YQ4 C;  3P8C D;  2YKQ A;  3VMZ A;  2JP3 A;  3AEA C;  2JYG A;  1OVR A;  1BCC G;  1SLQ A;  4UB8 E;  5KP7 B;  4NPF X;  1AQ5 A;  1YQ3 C;  2C9L Y;  1JCC A;  3CWB D;  1BXI A;  1IK9 A;  3GG2 A;  3KQG A;  2Q9I A;  3H1H G;  5B66 H;  1GXH A;  3Q5S A;  3CPW O;  2QJP B;  1CEI A;  1Q2N A;  2WWW A;  5KAF H;  1IO4 A;  2N6Y A;  3FWL A;  1HGV A;  1NTK J;  3RL0 C;  2ITA A;  3OA7 A;  2N9B A;  1GK4 A;  5KKZ C;  2FYU E;  1XTC C;  1BE3 J;  3CCU P;  3N7N A;  3HE4 A;  1N7L A;  1RE3 A;  1OW6 A;  4W7Y A;  1LJ2 A;  2XV5 A;  2DGY A;  3RK2 C;  1RF0 C;  1H88 A;  2JYL A;  1URQ A;  3D71 A;  1SQV E;  1X22 A;  1YBK A;  2JWA A;  1JUN A;  1VQ6 P;  1VQ5 P;  1USE A;  1PPJ G;  3LW5 J;  4L73 A;  1HVV A;  3GW6 A;  4QNB A;  1OMI A;  1VF5 C;  2Z44 A;  5B66 E;  4HKG A;  4MRT C;  3B5I A;  3CCV P;  2FYZ A;  2H88 C;  4OGQ B;  1IJD B;  2CGQ A;  4XFJ A;  5KLI B;  1MFZ A;  2Q1K A;  2KZJ A;  2D2C D;  1FE6 A;  4D6T D;  5KAF E;  2N98 A;  1X79 B;  1NTZ K;  1YTZ I;  2LIU A;  1LWU A;  5DJU B;  2OYO A;  2JR8 A;  5BU8 B;  2KG6 A;  2FYN C;  4AQR D;  1AFO A;  1EDL A;  2K1A A;  3L74 D;  2GA1 A;  2N1T D;  2JQ4 A;  3FXE A;  2PEJ A;  2P10 A;  1SQQ E;  4Y99 B;  2HR3 A;  3M06 A;  1KIL E;  1NTM E;  1JOC A;  4YXW H;  5H2F H;  1Q81 Q;  2XNX A;  3IN6 A;  4TT3 H;  1CSB A;  4ZNC A;  5APY A;  1Y8A A;  1ZR4 A;  3KYQ A;  1JTH B;  2ZAE B;  4F37 A;  2HPC B;  2R5D A;  3NXS A;  1RF1 A;  1SQB J;  3L75 G;  2PY8 A;  4QKO A;  3GF3 A;  4U3F G;  1HF9 A;  1SQP E;  2M5R A;  4L74 A;  2K3R A;  1P84 D;  4PH1 A;  3D6Y A;  3NMD A;  1ZP0 C;  2JB0 A;  1L0L E;  2E1M A;  1K73 Q;  3O6Q B;  2MD9 A;  1OXZ A;  2AEF A;  3CL3 D;  2XT1 A;  2GDW A;  5AVX B;  3G29 A;  4H13 D;  4COP A;  3CI9 A;  2W83 C;  2KZI A;  4BPG A;  1FU1 A;  3V2N A;  2M8L A;  2KP8 A;  4XFZ A;  1N7S C;  2GDY A;  5H2F E;  3M0A A;  1M8O B;  1GU5 A;  3RG6 C;  5GTI H;  1SQX J;  4CPG A;  1FZA A;  1BSN A;  3SWY A;  1HWT C;  3G1G A;  1M1J C;  4WY4 D;  4BXL A;  1CI6 A;  3AE9 C;  1AQT A;  1SFC D;  2QJY B;  2OYH B;  2N6Z A;  1L0N K;  1NAY A;  1S5L X;  2IBZ G;  3HE5 A;  3A3Y B;  4K35 A;  1K04 A;  1X3O A;  1J1D B;  2GZF A;  3G9R A;  4WB4 A;  5F2K A;  3CXH D;  2N1T B;  4DT0 A;  2PNG A;  4XFY A;  3DS1 A;  1PPJ D;  2HOD B;  4XRQ A;  3HE4 B;  4KHX A;  2KI7 B;  3OAK A;  2ZFC A;  2KK7 A;  2WSC J;  3RK3 C;  3H1J J;  2WSE J;  4R4M A;  2J58 A;  5GTI E;  5EW5 E;  1BE3 E;  2J59 M;  1VQ7 P;  1KIL D;  5CCH A;  1NTM D;  4DG9 A;  2LKI A;  1W5C E;  2LIW A;  2I1J A;  1AJY A;  2JGP A;  1HY8 A;  1M6E X;  1RO2 A;  1VHN A;  2N9Y B;  1X0T A;  1OVU A;  3H1L G;  2OYI B;  4ZMD A;  1ZXG A;  2QNW A;  2KG9 A;  1VQP P;  3G6E P;  3GKL C;  4W7Z A;  4D6T J;  5HGN A;  2ZYG A;  1L0L D;  3II6 A;  2VLP A;  2YO3 A;  2GYK A;  1S2E A;  1DNY A;  3A0H H;  3HUS A;  2WPS A;  2AFE A;  3G28 A;  3ABV C;  3KDP B;  4KJM A;  1KYO I;  1T2K C;  2AXT H;  1JO5 A;  1M74 A;  3Q3D A;  2OTJ P;  4Z1M H;  2KS1 A;  2M0B A;  4JPZ B;  3MUD C;  3HD7 A;  3AEG C;  3L75 D;  3L72 G;  2KOR A;  1CW5 A;  3H32 A;  3GMA A;  1Y47 A;  2B87 B;  2HYN A;  1A43 A;  2M8P A;  1RQV A;  4M3L A;  3CX5 I;  1KB9 E;  2FVE A;  2JU1 A;  2KOO A;  3RK2 B;  3HRN A;  4C7N A;  2P1J A;  1WMK A;  2GZG A;  1JNM A;  2MR8 A;  2L91 A;  1DEB A;  2QEX P;  1SQB E;  5CJ0 A;  3VN0 A;  1VF5 B;  2P9X A;  1VL2 A;  2FQ1 A;  3A0H E;  3V4Q A;  4BPF A;  4N6J A;  5CHX A;  2AVA A;  2FYU J;  2R44 A;  3CWB G;  5KTB A;  5K5G B;  3HYB A;  2AXT E;  4WBA A;  1E6J P;  4N3Y B;  1IMP A;  1OW8 A;  3WUU A;  1NTK D;  1SQV J;  1JMB A;  5AVW B;  2FYN B;  3L73 E;  1BE3 D;  1L4A A;  1YIT P;  3TK1 A;  5KLV K;  4DJG A;  1GL2 C;  2WSE H;  3MUD A;  1LTA C;  1N2D C;  2K0X A;  2KGE A;  1SQX E;  1QVF O;  1EDI A;  1YTZ T;  3T97 B;  1G2C B;  1NU1 E;  1XTG B;  2IFM A;  4L76 A;  2ZT9 C;  3CLQ A;  3G71 P;  1M1K Q;  2WPV B;  3SSU A;  1IZN B;  1PP9 E;  5KJ7 A;  3V2R A;  4KT0 J;  2KNC A;  5EJD A;  1ZMB A;  1PGQ A;  2K5X A;  2GUV A;  2IPP A;  5AW1 B;  1JY2 P;  4YTP C;  1FS0 E;  1QL2 A;  2E75 C;  5AVU B;  2WPQ A;  2A06 D;  4YXD C;  4HYT B;  2CWO A;  4I1L A;  1Q86 Q;  1M56 D;  1SQQ J;  2K88 A;  3GHG A;  2IBZ I;  4CA3 A;  3I55 P;  1OW7 A;  4GIF A;  2R5B A;  1HBW A;  4D6T G;  3AE8 C;  3GF7 A;  3M91 A;  1FJK A;  3EWK A;  4I6M C;  1N7S B;  3VP8 A;  1KB9 D;  2O01 N;  2NPS A;  1D1D A;  3M9B A;  1SQP J;  2Q5U A;  3CC2 P;  3L74 G;  1JY3 N;  1GL2 A;  3H1I J;  1M1J B;  2GM4 A;  4UB6 H;  1YHQ P;  1SQB D;  1DEE G;  2WPR A;  3NFQ A;  3VMA A;  1ZR2 A;  4U0D A;  1VQ8 P;  4OGQ D;  3EFG A;  1PZQ A;  3USS A;  2LF4 A;  3AEE C;  4TLF A;  1RE3 C;  2QE7 H;  2WSS H;  1URQ C;  5AW8 B;  2IDB A;  4IL6 X;  1EZV D;  1PGO A;  2FAD A;  1BAJ A;  2K9J B;  1LTT C;  4GOD A;  1USD A;  3FGA D;  2KSJ A;  3L73 D;  3AE2 C;  2VSQ A;  4N78 D;  2FFD A;  1T8Z A;  2AF8 A;  2DW3 A;  2FYU G;  3EJE A;  1SQX D;  2PRR A;  1EC5 A;  3B4S A;  1PL5 A;  3H47 A;  4GKG A;  3D70 A;  1ZLL A;  4GR2 A;  4UB6 E;  1E5W A;  1LTJ A;  1FZC A;  1LWU C;  3UIA A;  1ZW0 A;  3WUV A;  2X2B A;  1JJ2 O;  2WIT A;  4XE5 B;  3GJN A;  1PP9 D;  4U0C A;  3CC4 P;  3V6I A;  1GXG A;  5CCG A;  2K9Y A;  2WTY A;  1JY2 N;  4IOI H;  2E5Y A;  2QVA A;  1QL1 A;  2RN0 A;  4K3A A;  4BRY A;  2BQ1 E;  4GOE A;  4Y28 J;  1KTM A;  1AV1 A;  2LML A;  1PIX A;  1NO4 A;  3P05 A;  2PFX A;  3SFD C;  1LP1 A;  2YMK A;  3I56 P;  1RF1 C;  3TGU E;  1A02 F;  4I2L C;  3H1J D;  3CCS P;  1NGM B;  2GZE A;  1NTZ E;  4WWI A;  1Y9B A;  2LXC B;  3R4Y A;  1UII A;  3V2P A;  1KYO H;  2KB7 P;  2M3E A;  1BGY E;  1AVY A;  4R0M A;  2FXP A;  1NTM G;  2KR5 A;  4JF7 A;  3A7O A;  3L70 E;  3PTZ A;  4PXH B;  2KOG A;  3VTP C;  1E0H A;  3CX5 H;  4B86 A;  1G1J A;  1RH5 B;  5BS1 A;  1LT9 C;  2LL8 A;  2A45 I;  2FQ2 A;  2W8Z A;  1AF8 A;  1L0L G;  3B4Q A;  1A8O A;  5AVV B;  2EG5 A;  1PEU A;  2WT7 A;  1GMJ A;  3MP7 B;  2P58 A;  4M0I A;  1AVO A;  3F89 A;  1MZ8 A;  2ZXX A;  3DS5 A;  1MFT A;  1KYO E;  1OIP A;  3RBZ A;  1FDO A;  5KP6 B;  4WY4 A;  2ZYD A;  1IFJ A;  1SFC A;  3RG2 A;  2KWL A;  5KLV J;  1HH0 A;  2LPK A;  2Y0D A;  5KAI H;  5BVZ A;  2LOL A;  4U7J A;  3H1I E;  5BU5 A;  1GW4 A;  3CX5 E;  2PEN A;  1SS1 A;  2M8R A;  2G3A A;  2ZT9 B;  3HTK A;  2RMZ A;  1NWQ A;  2FXM A;  3NY7 B;  5CCH C;  1FAV A;  2FYU D;  4IL6 H;  5CZD B;  3L73 J;  2M5A B;  5APX A;  2KGC A;  1L0N E;  1EXI A;  1FDI A;  1N86 A;  1DIP A;  3PH0 A;  1IC2 A;  1LT9 A;  1E79 H;  2EFJ A;  3F5H A;  1M90 Q;  4U0B A;  5M1B A;  1SQV D;  3RL0 D;  3CE7 A;  1KIL A;  1P84 I;  1NTZ D;  1KMI Z;  2POH A;  1NU1 J;  3Q5P A;  1NTK G;  2FY8 A;  1L0L K;  4AUW A;  1LT1 A;  2XKM A;  1BGY D;  3A2A A;  3RK2 D;  1GPJ A;  1BE3 G;  1RE4 A;  3HUS C;  5KAI E;  1PP9 J;  2W6B A;  4BWN A;  1DX7 A;  3DS2 A;  2JAZ A;  3L70 D;  1K9M Q;  4GR6 A;  2L5G B;  2Q3I A;  5CBO A;  1DH3 A;  1IFM A;  1ZN5 A;  2Y9Y A;  3R2P A;  2JU2 A;  3HD7 C;  2Q6Q A;  1VF5 D;  3PP5 A;  2J5U A;  1M7L A;  4IL6 E;  2BUO A;  2MF4 A;  1J1E C;  1SVF A;  1L0H A;  2KGA A;  2Z45 A;  3MTU E;  3VYI A;  1SQQ D;  3G21 A;  1LP1 B;  3S9O A;  4I7Z C;  3LIE A;  1HGZ A;  2E74 C;  1URQ B;  2N5I A;  2A06 G;  1NJI Q;  1PEQ A;  1UIX A;  1YJW P;  2BCC E;  3TNU A;  4RKU J;  4O9B A;  2MVV A;  1H89 A;  4IFD K;  1HUC A;  1QGK B;  2QSI A;  3RK3 E;  1KYO D;  3H25 A;  2IBZ E;  3KXD A;  4OWF A;  3C8V A;  5AW2 B;  2XDJ A;  1SQP D;  4PV1 C;  3ZDM A;  3CXH I;  3CCM P;  3DS0 A;  3B71 A;  3AEB C;  3H1I D;  2Z5H A;  3Q5R A;  2QJP C;  1H0T A;  2CQ8 A;  1LWU B;  1N73 A;  5AW6 B;  4L75 A;  1NTK K;  1MZ9 A;  3RBX A;  1KOR A;  1L4A C;  5AW9 B;  2LR2 A;  4JYC A;  1IUQ A;  1QVG O;  2K37 A;  3M9H A;  2JEE A;  2BHV A;  1LTB C;  1SQB G;  2L6E A;  3RL0 B;  2MR7 A;  1NAF A;  1PV3 A;  2PEQ A;  3Q1M A;  4H0L C;  3TDK A;  5KKZ B;  3CCQ P;  3SWF A;  5AW3 B;  1J2J B;  3V5B A;  2ZJS E;  2BEZ F;  4C46 A;  3B5N C;  2SPZ A;  2HLO A;  1YIJ P;  1HQB A;  1M57 D;  2PGD A;  4HH2 A;  1F80 D;  1JY3 P;  2QJK C;  1RF1 B;  1EZV G;  3WMM 0;  1R5S A;  2B89 A;  4ZKP A;  1EDK A;  1N7S D;  1NVO A;  2GDX A;  5KJ7 C;  1IFD A;  3QWO C;  5HV8 A;  2O01 J;  3L73 G;  2KOP A;  1PEM A;  1KQS O;  2QM8 A;  1OZH A;  1W2B O;  1KC8 Q;  3GHG C;  2Y0E A;  5KLV E;  1UJZ A;  1RY3 A;  2P67 A;  1SQX G;  2EIA A;  5JPA A;  4PD4 I;  2NZ2 A;  3CCR P;  2C9N Y;  4IFM A;  4WYM A;  1DD4 A;  1GZL A;  3A5T A;  2WVR A;  1UNK A;  3RGU A;  2FHS C;  2BEQ D;  5TJH A;  2E43 A;  1ZV8 A;  3L72 E;  2H43 A;  2YO2 A;  5AVR B;  3TGU J;  2KLV A;  2NPS C;  1NTZ J;  1PP9 G;  2W27 A;  3AEF C;  1GW3 A;  4JBZ A;  3DS4 A;  2KG8 A;  2CK3 H;  1AA0 A;  5DJT B;  3EQ2 A;  1BDD A;  1CI6 B;  1BGY J;  2VLQ A;  1ZNV A;  2XZR A;  2IYP A;  1GTW A;  1SQB K;  1KQL A;  1GDT A;  3B5N A;  3RK3 D;  4C7R A;  2KW2 A;  1NKZ B;  3FWN A;  3L70 J;  3L71 E;  3C9I A;  4UHP B;  2A45 H;  2ERH A;  1IK7 A;  1S5L H;  2QA4 P;  1KFM A;  4RJT A;  2XU6 A;  5AVY B;  1JB0 J;  3HE5 B;  2L0Q A;  5APW A;  3H1J G;  3DPH A;  1FC2 C;  1FOS F;  1AYI A;  3I5C A;  3NTE A;  2GZI A;  3Q2Y A;  5F2O A;  1QLE D;  1R8E A;  2FFD C;  2FBW C;  2R3C A;  1T3U A;  2O1K A;  4IFF A;  4JQ0 D;  1SQX K;  2H89 C;  1HJB A;  3IFM A;  1T2K D;  3PJS K;  2W6A A;  2KOS A;  1LTJ C;  3WU2 H;  1FZC C;  2KOQ A;  4LC1 A;  2E42 A;  2YKO A;  2K94 A;  1S5L E;  2OYH C;  2OGU A;  1IFN A;  2IFN A;  4H2Y C;  1ZME C;  2B88 A;  5CCG C;  1Z6M A;  2KOD A;  1T3J A;  3BCC E;  2L4B A;  3V2Q A;  2YMY A;  2PP6 A;  2D2C C;  1LGH B;  2CPB A;  3EFF K;  1JTH A;  1S3J A;  2HPC A;  2O01 H;  3LMO A;  3IF4 A;  3HUS B;  5KLV D;  3ITK A;  2QG4 A;  2QM7 A;  3CD6 P;  3JSV C;  1EXJ A;  3EJD A;  1P84 H;  1HTL C;  1FZG A;  1L0N J;  3V4W A;  2PEK A;  1T8K A;  2R3S A;  3AE6 C;  2HG5 D;  2KS1 B;  3L37 A;  1X8Y A;  3L35 A;  3O6Q A;  3M9Q A;  2H8P D;  1KB9 I;  3HD7 B;  4EDF A;  3CC7 P;  3P7K A;  3H1K E;  3H32 B;  3AE3 C;  1ZRT E;  1J1E B;  5AVS B;  1PFI A;  1LTI C;  1G1I A;  1K8A Q;  2IYO A;  4U3F J;  3RK3 B;  4HKZ H;  1VQM P;  3L74 E;  4I7Z B;  1FDM A;  3WU2 E;  2XXM A;  1FZF A;  1RO0 A;  2E74 B;  4C7N B;  2VLO A;  2CG5 B;  1NKN A;  1VDF A;  3VMY A;  3G26 A;  1MKM A;  5AVZ B;  2NPS D;  4XRO A;  3AE1 C;  2E76 C;  4R4L A;  3L71 D;  1NU1 D;  4H2W C;  3MGN A;  2OYI C;  1ACP A;  3TGU G;  1SQV G;  1GL2 D;  5AW4 B;  4ASW A;  2XV6 A;  1NTZ G;  4LGD E;  2I1K A;  2JO1 A;  2OYH A;  4PV1 B;  1EZV I;  2FQ0 A;  2WSF H;  4H13 C;  1P84 E;  1VQ9 P;  3MZW B;  2K92 A;  2VRS A;  1NQ4 A;  1BGY G;  2IX7 C;  3W68 A;  1OVV A;  5APU A;  2KLU A;  2ZT9 D;  5AW5 B;  1YYC A;  3TYY A;  3K5B A;  3L70 G;  2NRG A;  2BCC J;  1BCC E;  2LKM A;  3CXH H;  1L4A B;  5AVQ B;  2N1T A;  3E7K A;  3CMA P;  2C0W A;  2E75 D;  1VKU A;  4WY4 C;  4W80 A;  1SFC C;  2Y0C A;  2HOD A;  4H0L B;  3RL0 g;  3SWK A;  1PGP A;  3M0D C;  3P8M C;  3LRY A;  3BRT B;  3H1H E;  3B5N B;  2Q7C A;  2Q3E A;  3L36 A;  1SQQ G;  2EHT A;  1RNI A;  5HGL A;  2JBG A;  2HFE D;  2YNY A;  5CMZ A;  4LLH A;  3CCE P;  3VP9 A;  2QJK B;  3TF5 A;  2YIU C;  3D6Z A;  2E5T A;  3BCC D;  4PH0 A;  5L8R J;  2KNC B;  2V4H A;  2W90 A;  2FYU K;  2KYV A;  3AE5 C;  3GZL A;  2OYI A;  1WRG A;  4MN4 C;  1HJ0 A;  1N8R Q;  3OW2 O;  2K93 A;  2N50 A;  1JCD A;  5APV A;  3GHG B;  2OTK E;  5APT A;  1SQP G;  3G1I A;  1QRJ A;  5CCG D;  2QRX A;  4H44 C;  3JC2 2;  1SQV K;  1KIL C;  5HVC A;  5I4T G;  3H1I G;  3CXH E;  1FZB A;  3H1K D;  2IZ1 A;  3AEC C;  2LXB A;  2V7Q H;  3N4X A;  3H1L J;  1KD1 Q;  3M1M A;  4GT1 A;  1ZRT D;  1NOH A;  2BAS A;  1PPJ E;  2OQQ A;  1U7M A;  2NPS B;  1FJP A;  1RE4 C;  2OTL P;  1JM0 A;  3CME P;  4PD4 H;  1Q7Y Q;  1URQ D;  2O1J A;  1L0N G;  1GL2 B;  3B8E B;  2B87 A;  2Z46 A;  5C39 A;  2PAJ A;  3M0D A;  1R5L A;  2WQY C;  1YJN P;  3O8Z A;  2H7H A;  1RF0 A;  1MUU A;  3Q20 A;  4A7P A;  2I8D A;  3MGE A;  1DD3 A;  3H6P A;  2NO8 A;  3L72 J;  1U57 A;  2GUS A;  1VQO P;  1NH4 A;  1SQQ K;  1X9V A;  1KQF B;  5E79 H;  1W2E A;  2E76 D;  3LID A;  1NTM K;  2CPS A;  1BDC A;  2ONT A;  1EIA A;  2JWD A;  3VMX A;  1EQ7 A;  2E75 B;  3GZM A;  4OVN F;  1GD2 E;  3S1K A;  3AE4 C;  1BCC D;  3MIW A;  2L9F A;  2IZ0 A;  3TGU D;  2B9B A;  2FFD B;  2K2Q A;  2MKV A;  3QH9 A;  1SQP K;  4PD4 E;  3L71 J;  3CXC O;  2G8Y A;  3L75 E;  3KPE A;  4U3F E;  4EYY Q;  1WT6 A;  1VQN P;  3H1H D;  1LTJ B;  5BS2 A;  3CWB J;  1FZC B;  1N73 C;  1PEO A;  3E1R A;  4GDO A;  4QMA A;  2C0X A;  3AE7 C;  3U43 A;  2BCC G;  4NPE A;  2XZ0 D;  2MY5 A;  1S4X A;  2W6J H;  1VQ4 P;  2YXQ B;  3HZQ A;  3T97 A;  2WPT A;  5E79 E;  1G2C A;  2D2C B;  4DOJ A;  3LW5 H;  1LTS C;  3DS3 A;  1LTG C;  4BRY B;  3EJB A;  3AED C;  5TIS H;  1CZQ A;  1ZOY C;  4COC A;  3P32 A;  2PEO A;  2VLN A;  3U1C A;  3CCJ P;  1K05 A;  1YI2 P;  4DCK A;  2ZVO B;  3VRL C;  1NYH A;  1Z56 A;  2XND H;  1NTK E;  1L0I A;  1FR2 A;  2KGD A;  3VOP A;  1H8A A;  1NHL A;  4H44 D;  2Y9Z A;  1DV5 A;  4GOF A;  3BCC J;  5CBN A;  1JMM A;  1A02 J;  1N7S A;  1KB9 H;  2MJZ A;  2N5H A;  1S1C X;  2GZJ A;  3G4S P;  4EIJ A;  2E76 B;  3TSI A;  2FVA A;  3CX5 D;  2OAR A;  2JDI H;  3KZI H;  1M6N A;  2M8N A;  3PHL A;  1M1J A;  3W67 A;  1EDJ A;  1JEK A;  1EMV A;  3H1K J;  2FXO A;  4XA4 A;  2FAE A;  2AEM A;  5TIS E;  3MHV A;  4H13 B;  3DTJ A;  5EFW B;  1L0N D;  1OFC X;  2WT7 B;  3L74 J;  2A06 E;  4WVZ A;  5KLV G;  2FVF A;  2AFD A;  2KSE A;  4XFX A;  1QEX A;  2JO0 A;  2DNW A;  3SFE C;  2YKP A;  3OJA B;  1FOS E;  1U7J A;  2ZXE B;  5CCH D;  3U1A A;  3H1L E;  1YJ9 P;  4PD4 D;  2P2U A;  3BRV B;  2K9J A;  4U3F D;  4WY4 B;  1OR5 A;  3U59 A;  5GTH H;  3NTN A;  3JCU H;  3WUT A;  1SFC B;  4U0E A;  3BVH A;  1VPC A;  2FKW B;  1KV4 A;  4IZ6 A;  4OGQ C;  2Z4E A;  5KLI C;  3KZI E;  4BPH A;  2ZYA A;  3HTK B;  4NEO A;  2YIU B;  2YXR B;  5KP8 B;  1L2P A;  4PJ0 H;  2K0D X;  3FX0 A;  5DCK A;  1D7M A;  3L71 G;  1NU1 G;  2AEJ A;  1RQU A;  1BCC J;  3E2D A;  2XZ1 C;  1S9K E;  1LT9 B;  1KFN A;  5HGM A;  4Y99 C;  2AXC A;  3HD7 D;  4H44 B;  3H1H J;  1Q90 D;  1KIL B;  2BCC D;  2O3J A;  1EZV E;  4RO0 A;  4YPC A;  4ASV A;  2ZVN B;  3PLN A;  3H4E A;  5B5E H;  3P8C E;  3KHU A;  5GTH E;  1KN7 A;  3JCU E;  1JY3 O;  5HGO A;  5AW0 B;  3IR9 A;  4OH8 B;  5APQ A;  2IBZ D;  1FZE A;  2ROQ A;  5CJ4 A;  2WSC H;  4N78 E;  2E74 D;  2WMM A;  3L4F A;  2WSF J;  5F2N A;  3A0B H;  4EI2 A;  4U0A A;  1KLP A;  3CWB E;  1KZU B;  3E1I A;  1VQL P;  2QIW A;  4PJ0 E;  3FXD A;  2A45 G;  4ZKU A;  2KUB A;  3H0D A;  4HB1 A;  1S72 P;  4PV1 D;  1T6A A;  3BCC G;  2K0Y A;  1EOQ A;  1VQK P;  1Q82 Q;  3TNU B;  1AUM A;  1IFP A;  4U0F A;  1K30 A;  1NTM J;  1TU3 F;  1NU1 K;  1L4A D;  1SP4 A;  5B5E E;  3H1L D;  4H2X C;  3CCL P;  1PGJ A;  1GK6 A;  2PEI A;  2WZ7 A;  3IAO A;  5AVT B;  2CNR A;  2QJY C;  2RKL A;  5APS A;  3H1K G;  4H0L D;  2KIK A;  3H1J E;  4PWV B;  3A0B E;  4DZO A;  1LNQ A;  3B5N D;  4UB8 H;  4EOT A;  3WBH A;  1KQG B;  1OX3 A;  1RHZ B;  4JYB A;  1GU4 A;  1H0T B;  1N73 B;  3PRJ A;  2L22 A;  1L0L J;  3GLM A;  1J1D C;  1JY2 O;  5KJ7 D;  1IFI A;  3S4R A;  3BAT A;  2N1T C;  3G0V A;  2LTE A;  1FBM A;  2FAC A;  2R32 A;  4RES B;  2V7Q J;  1BSH A;  2RH0 A;  2EHS A;  3L72 D;  4IPY A;  4NPD A;  4D6T E;  3G3Z A;  1S9K D;  1MV8 A;  4AYC A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  4XRO A;  1RO2 A;  5BS2 A;  3NTE A;  3CC2 P;  2BUO A;  1VQ5 P;  3G29 A;  5F2N A;  1PEO A;  5F2O A;  5I4T G;  1E6J P;  4U0A A;  2BQ1 E;  2Z45 A;  4COP A;  4QNB A;  4XFX A;  2Z44 A;  1VQP P;  3G21 A;  2M8L A;  1KD1 Q;  3M1M A;  2JO0 A;  3G6E P;  1PEM A;  2PEM A;  1KQS O;  2XV6 A;  3P05 A;  4XFZ A;  1VQL P;  3B5I A;  1VQ4 P;  5HGN A;  1W2B O;  3CCV P;  1YHQ P;  1KC8 Q;  3HZQ A;  3I56 P;  1YJ9 P;  2OTL P;  1YIT P;  2EIA A;  5JPA A;  1YJW P;  3RG6 C;  2PEN A;  1NJI Q;  4U0D A;  3CME P;  1PEQ A;  3CCR P;  3CCS P;  3H0D A;  1Q7Y Q;  1VQ9 P;  1S72 P;  1VQ8 P;  4WYM A;  3DS3 A;  2LF4 A;  2JYG A;  3G28 A;  3G1G A;  4U0E A;  1QVF O;  2Z46 A;  4COC A;  1M74 A;  1YJN P;  2PEO A;  1EOQ A;  2KOD A;  2OTJ P;  3CCJ P;  1VQK P;  1Q82 Q;  1YI2 P;  1BAJ A;  1AUM A;  3CCM P;  3Q20 A;  3CMA P;  3DS0 A;  4U0F A;  1K30 A;  2EFJ A;  3VRL C;  3MGE A;  2PEJ A;  3G71 P;  1M90 Q;  1M1K Q;  3DS4 A;  4U0B A;  3CCL P;  1A43 A;  3CPW O;  2M8P A;  1VQO P;  3CD6 P;  2PEI A;  5DCK A;  3LRY A;  1Q81 Q;  3E2D A;  2PEK A;  1ZMB A;  2ONT A;  5BS1 A;  1EIA A;  5F2K A;  1RNI A;  5HGL A;  2CWO A;  1IUQ A;  1QVG O;  1Q86 Q;  4XFY A;  3DS1 A;  3WBH A;  2BHV A;  3H47 A;  3CCE P;  2L6E A;  3I55 P;  2QA4 P;  5HGM A;  3CC7 P;  3G4S P;  4GR2 A;  4XRQ A;  4PH0 A;  2PEQ A;  2PY8 A;  3DPH A;  1A8O A;  3CCQ P;  2EG5 A;  3DS2 A;  3CCU P;  2OAR A;  4PH1 A;  2QEX P;  1PEU A;  1K8A Q;  1M6N A;  1K9M Q;  4GR6 A;  2M8N A;  1VQM P;  1JJ2 O;  2P9X A;  3H4E A;  1VQ7 P;  3CXC O;  1N8R Q;  3OW2 O;  2DGY A;  2XXM A;  2E1M A;  4M0I A;  1RO0 A;  1K73 Q;  1YIJ P;  4U0C A;  3G0V A;  3CC4 P;  1VQN P;  2JYL A;  5HGO A;  4IPY A;  3G1I A;  1M6E X;  2XT1 A;  1D1D A;  1QRJ A;  3DS5 A;  1VQ6 P;  3G26 A;  3HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...