1Q7YQ

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 51
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q7yQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q7yQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q7yQ03
3CD6P 2QA4P 1W2BO 1KC8Q 1KQSO 1YJWP 3CMAP 3G71P 1VQ8P 3CPWO 3I55P 1VQLP 1Q82Q 1VQPP 1YHQP 3G4SP 1N8RQ 3CC2P 1QVGO 3CXCO 1YI2P 1VQ4P 3CCJP 1YJ9P 3CCRP 1K8AQ 3CCVP 1M90Q 1Q81Q 1VQKP 1VQOP 3CCLP 3CCQP 1YJNP 1VQ6P 3OW2O 1VQ9P 3CCUP 3CCSP 1VQ5P 1Q86Q 3CC7P 1VQNP 1JJ2O 1NJIQ 1YIJP 1K73Q 3I56P 3CC4P 3CMEP 1YITP 2OTLP 2OTJP 1KD1Q 1VQMP 3CCEP 3CCMP 1S72P 1Q7YQ 1K9MQ 1QVFO 1M1KQ 2QEXP 3G6EP 1VQ7P
chains in the Genus database with same CATH superfamily
1K04A 1LTAC 1KQSO 3RK3C 5APSA 2E75B 2QE7H 1FAVA 2GDYA 4JYCA 4ZNCA 3G26A 4WB4A 1HWTC 1M1JB 1JCDA 4OGQD 3F89A 2M3EA 4WY4D 1ZOYC 4JYBA 1L0NJ 3GJNA 3O6QA 2N6ZA 2O01N 3WU2H 1KB9E 2BEZF 1FBMA 3EFGA 2E5TA 2EHTA 2CPBA 1BCCG 3PRJA 2OQQA 3H1HG 3TK1A 3L74D 1PZQA 1HGVA 1WRGA 1LTJC 1NTMJ 1VQ5P 1Q86Q 1URQB 1BGYE 1SP4A 1AJYA 5HV8A 3OA7A 5APQA 5KLVG 2ZXEB 3A0BE 4H2YC 1ZMEC 2FXPA 3L71J 3MUDA 1KORA 1VQ6P 1IMQA 2KXPB 3CXHI 4Y99C 1T8KA 3B4QA 4GIFA 1L0ND 3HD7D 4PXHB 2MD9A 2AEMA 2H89C 3AE5C 4NEOA 1BCCE 1XTGB 2KYVA 1FE6A 2Z4EA 2A06E 1NTMD 4H13C 3AEEC 1NOHA 3PH0A 1GL2A 2XZRA 5B5EE 2KS1A 1FZCB 2J5UA 4XFZA 4U3FE 4GT1A 2KLVA 3WMM0 1NYHA 2HODA 2PP6A 3L71D 2IYPA 3L72G 1ACPA 3FGAD 2OYIA 2Y9ZA 2KNCB 1EQ7A 4PV1C 3Q2YA 3DS1A 1SQPE 2VLPA 1L2PA 1FZEA 1SQBG 2I1JA 3QH9A 1H0TA 2YO2A 3SSUA 2ZAEB 1RF0C 1SQVK 3SFDC 1VQ7P 2FYNC 5I4TG 3AE7C 5AW1B 2FY8A 3DS5A 1PGQA 1CZQA 1Q82Q 1VQPP 2BQ1E 4Y28J 4OWFA 3H1JJ 5H2FH 4H44D 4C7NB 4DCKA 5APVA 1DD4A 1BAJA 3FX0A 2PEIA 2FYUG 1ZLLA 4RO0A 2E75D 1PL5A 2KODA 3L72E 1X22A 3CCMP 3K5BA 4EI2A 5BVZA 2JYLA 3TGUJ 3CPWO 3EJEA 2VLQA 2H43A 2KWLA 1FDIA 3G29A 2E74C 2BCCG 1USDA 2AXTE 2BUOA 4BXLA 1RE4C 3H1IG 3HD7A 5CCGC 2P7JA 1RO2A 4L73A 2LXCB 2BASA 1HY8A 1R5SA 1NTZG 1BSHA 3V5BA 3WBHA 3H1JD 3Q5PA 1HGZA 1ZXGA 2D2CC 3CCJP 2H7HA 1DX7A 3AEFC 4H13B 1A43A 1S9KE 4PWVB 4ZKPA 1NWQA 1M7LA 2KZIA 4HYTB 2N1TC 2MJZA 1SFCA 1HJ0A 1FZGA 1IFIA 4DZOA 4RJTA 2JEEA 2FADA 3TGUD 2YO3A 3CD6P 3GZLA 4HKZH 1FZAA 3GHGC 1FZFA 1X79B 2IYOA 2PEOA 2O1KA 2IX7C 3L73G 2K93A 2BCCE 2ZT9C 5AW0B 3SWFA 1YBKA 5CJ4A 3H1IE 1FZBA 2JJLA 4LLHA 2EFJA 3B5ND 1NTZE 4PD4E 4CPGA 1R5LA 1OW7A 5TISH 2Y0DA 2LKIA 4L75A 2R32A 4COCA 4JBZA 2OYHB 1S3JA 1BGYJ 3RK3D 2QJPB 2L5GB 3BRTB 4AYCA 2K92A 1UIIA 2M8NA 3LMOA 4GOEA 1Y9BA 5HGLA 3A0HE 3H6PA 2AFEA 2W6JH 1M1JA 2FFDA 1AFOA 2QM7A 1PEQA 1QRJA 3F5HA 5AVWB 3PLNA 1LT9B 2YIUB 1K73Q 4W7YA 1OVRA 3Q5RA 4QKOA 1BCCJ 1KB9D 3NFQA 1EMVA 1NKNA 1A02F 2D2CB 1ZR4A 2QSIA 2PENA 1KQGB 3A3YB 1BGYD 3V4WA 3VP8A 3TNUA 2WTYA 4BRYB 2GDWA 1RF1A 1BSNA 1OMIA 2CNRA 5KKZB 1VDFA 1UJZA 2KG8A 2M5RA 3IAOA 2K88A 4U3FJ 1CEIA 1AA0A 1AUMA 3G1IA 3LRYA 1JNMA 5KTBA 4NPFX 3L70G 2KGDA 1SQVG 1EZVE 5AVSB 3VOPA 3RK2C 5KAIE 1SQPJ 2POHA 5JPAA 2M3BA 3O6QB 2KGCA 3M0DC 1Y47A 3B5NA 4D6TE 1X0TA 1BCCD 2AEJA 2N9BA 2FVFA 3CXHH 1M1KQ 4H13D 1ZR2A 3H25A 2O3JA 2A06D 1PEOA 2JBGA 1YHQP 2QJYC 3CXCO 4PJ0E 2KOOA 3I5CA 1VF5C 4H0LB 1KMIZ 2RH0A 1OWAA 1N7LA 3L72J 4U3FD 2ZYAA 2WWWA 4PV1D 1ZRTE 1KZUB 3L70E 2O01J 4RESB 2XT1A 2YKQA 3D6YA 2A45I 1SQBJ 3CC2P 1X3OA 4IPYA 1SQPD 1NAYA 2Q3IA 3RL0B 2KSJA 2W90A 4GDOA 3WU2E 4UB6H 2PEQA 2WPQA 4C7NA 2R5DA 2LIWA 2PEJA 2VSQA 4H2XC 1OW8A 4F37A 1G1IA 1L4AC 2R3CA 3VRLC 2WMMA 1GL2B 3L36A 3JCUH 1QL2A 1SS1A 4EDFA 2KS1B 4YXWH 3L72D 2N50A 1RO0A 1LTTC 1FR2A 2HR3A 3AE6C 3AE1C 2CWOA 2LKMA 2MVUA 2OYIB 1GTWA 2IPPA 2E74D 1VQLP 1GZLA 2KUBA 2OGUA 3U43A 2BCCJ 2KSEA 2JP3A 4U0FA 2IBZG 5CCGD 1VL2A 3GF3A 1EDLA 1H0TB 2C0WA 3H1IJ 4WY4B 3H0DA 1W5CE 2KW2A 1NTZJ 2D2CD 1MUUA 2JKVA 1JY3N 1KN7A 4R4MA 4GR2A 3AE9C 3RL0g 1JUNA 2N1TD 2QJYB 3KPEA 1EOQA 1S9KD 3BASA 1N8RQ 4MRTC 1GW3A 5BU8B 1HVVA 3GW6A 1NU1K 2CQ8A 3CX5E 2W6AA 2GUSA 1HQBA 2FQ0A 2MY5A 3TSIA 2E42A 2ZT9D 2NZ2A 1JM0A 1PPJG 2IBZE 2BCCD 3CWBG 1F80D 2W27A 3MZWB 5APTA 3CL3D 1RF0A 3RBXA 3I55P 3H1ID 1SQXK 1MFZA 3HD7B 1NTZD 1HUCA 2Z5IA 4PD4D 1L0HA 1X8YA 2RKLA 2GZJA 3II6A 3IF4A 3CMEP 1OW6A 2M5AB 3Q5SA 4MN4C 3V2PA 2OYHA 5CHXA 2G3AA 4H0LD 2VLOA 2ZYDA 5KAFH 4BPGA 5AVYB 1PPJE 2K0DX 4W80A 1LTSC 3CWBE 1JTHA 2Q6QA 3V2NA 4EYYQ 3S4RA 5CZDB 1RE4A 1CSBA 4ASVA 2YMKA 5KLIC 1LGHB 1KB9I 1PIXA 2N5IA 1LWUB 2E76C 4I6MC 1S5LH 4D6TJ 3G21A 3R2PA 3RGUA 2E5YA 2K1AA 3CCEP 4H44B 3H32A 2FBWC 2N1TA 1Z56A 1GMJA 2JWDA 2Q1KA 3KDPB 4QNBA 1QL1A 1S5LX 2NPSC 2WPRA 2FXOA 3RK2D 3L70J 5KP6B 4IL6H 2FFDB 1NQ4A 1JMBA 1J1DC 1L0LG 1EZVD 3R4YA 3RBZA 4IFMA 1QVGO 4BPHA 1NTKG 2DGYA 5BS2A 4D6TD 1N73C 4R0MA 1BDCA 1GXHA 2P67A 4ASWA 1VQNP 1WT6A 1VF5D 3MP7B 4IL6X 3TNUB 1RE3A 3KYQA 1M6EX 1H8AA 1RF1B 2QVAA 5GTIH 2CG5B 2IZ1A 2L4BA 2YKOA 5AVRB 1CW5A 3HYBA 4U7JA 1ZRTD 1T8ZA 3L70D 2M8PA 3CC7P 1L0LE 3HUSC 3DS4A 4YXDC 2WPSA 3USSA 2QNWA 1NTKE 3JSVC 3H1HE 4H2WC 4RKUJ 3B5NB 2A45H 1E6JP 3MGEA 2UWJE 5CMZA 1M57D 4UHPB 1L4AD 3O8ZA 5KLVE 1HF9A 2WPTA 4HH2A 2WT7A 5TJHA 3RK3B 3HZQA 5KP8B 2WSCH 2Z46A 2PFXA 2K0XA 2B87A 2NPSB 3B8EB 2NO8A 1R8EA 2FVEA 1SQXG 3LIDA 2FACA 2B9BA 2B88A 1KILE 2EG5A 2FAEA 4WY4A 2QG4A 3M0DA 4IZ6A 3NTEA 1KILC 1N73B 1JOCA 1JY3P 3CCRP 1LTGC 1LTJB 2I1KA 4COPA 3S1KA 3JC22 2KI7B 1IFPA 3L4FA 3G1GA 2QEXP 1L0NK 2FQ2A 3CX5D 2X2BA 1SQQG 4YPCA 1SQBE 1VQOP 1KFMA 3KZIH 3HUSB 3CWBJ 3P8MC 2IBZD 1OFCX 4Y99B 4Z1MH 2K5XA 1NTMK 2L9FA 4XE5B 1NJIQ 4M0IA 1K05A 1ZP0C 2OTKE 1PP9G 3H47A 1OVUA 3GMAA 2L91A 2KG9A 2PGDA 3P7KA 2Q7CA 1PV3A 4GODA 5BU5A 2M5AA 1N86A 4TLFA 1DV5A 2C9NY 3PTZA 3KHUA 4B86A 2FYUE 1L4AA 3DS0A 1S2EA 2W6BA 2SPZA 2BHVA 1U57A 1JJ2O 4I1LA 1SQQE 5HGNA 3V4QA 2R3SA 1P84E 2B89A 3CLQA 1PPJD 4PV1B 1YJ9P 1K8AQ 2JU2A 1GW4A 5AW3B 2CK3H 3CWBD 4TT3H 1VQ9P 2ROQA 7CEIA 5CJ0A 2WVRA 3VTPC 2ITAA 2E76D 2FYNB 2VRSA 1LWUA 1LP1B 2PRRA 5B66E 3M0AA 4C46A 4UB8E 3G4SP 2V7QJ 1LTBC 3B4SA 5DJTB 3E2DA 3ZDMA 1KB9H 2YXQB 1YJNP 2Q9IA 4U0DA 4IFDK 5APXA 2R44A 3DS3A 3L73E 2NPSD 3C9IA 3M9BA 3A0BH 1EZVI 1JTHB 2EIAA 2E74B 3HE5A 1L0LJ 3V2RA 2KORA 1KQFB 1LTIC 3U59A 2L6EA 1OX3A 1LT1A 1NTKJ 3MTUE 4XFXA 3H1HJ 3VMZA 2GYKA 1KYOE 1N2DC 1FOSE 2FQ1A 2JGPA 1FDMA 2Z44A 2XKMA 5KLVJ 3H32B 2N1TB 2QRXA 3WUTA 1MZ8A 1IFDA 1KQLA 4U0BA 4N78E 2VLNA 3AEAC 1AYIA 3QWOC 1JO5A 3GHGB 5CBOA 3IR9A 1JY2N 5B5EH 2ZT9B 4DOJA 2MKVA 2XU6A 1K30A 1L0LD 2RN0A 3L37A 3CCSP 1FU1A 3SWYA 1NTKD 5AW8B 2FHSC 3BRVB 3D70A 5EJDA 3H1HD 2H8PD 1YQ4C 4U0EA 5HVCA 1K9MQ 1Y8AA 3L75G 1S5LE 2Z5HA 5KLVD 2AFDA 2H88C 2XXMA 5K5GB 1AQ5A 1RQUA 2N98A 2K9JB 2HPCB 4N3YB 1J1EC 1AQTA 1NKZB 1DEEG 1NGMB 2NPSA 1SQVE 1NTMG 3CMAP 1KTMA 1E79H 2MF4A 2P1JA 2WSFJ 4IL6E 1KILD 3AE8C 2NRGA 1YTZT 3CCUP 1W2EA 3L71G 2Z45A 2ZVOB 1N73A 5EFWB 1JY3O 3L75E 2L0QA 2AXTH 1LTJA 4OVNF 2PEKA 3C8VA 2K2QA 5KP7B 2FYUJ 2A45G 2YMYA 1GK6A 2WT7B 3CX5I 4C7RA 3V2QA 5E79H 1L0IA 1SQQJ 5HGMA 2B87B 3HUSA 1SQBD 2KLUA 3RK2B 2KOSA 3ITKA 2AEFA 4HB1A 1SFCC 2MR7A 2I8DA 1GU5A 5KLVK 5AVVB 2R5BA 2Y0EA 5HGOA 1HH0A 1AF8A 4I2LC 4XRQA 1KV4A 2FKWB 2KR5A 2LMLA 1DNYA 3H1KG 1N7SC 4K35A 2FYUD 4PD4H 4HJGH 1VF5B 4KT0J 5F2NA 1M56D 1SLQA 1NH4A 1SQPK 1RY3A 3G0VA 1SQQD 2ZVNB 3FWNA 3E1IA 3V6IA 1P84D 1YQ3C 3L73J 1IC2A 2W83C 2WSEJ 2GZEA 1GDTA 3UIAA 5CCHC 3LW5H 1HBWA 2EHSA 1KILA 3A0HH 1VHNA 4U0AA 1LP1A 2AXCA 1H88A 3M1MA 3C1LA 3SFEC 3H1KE 2HFED 1L4AB 5H2FE 1NVOA 2LPKA 4PH1A 1SQBK 3TF5A 2N6YA 1CI6B 3D6ZA 3MIWA 3L73D 5DJUB 1URQC 1NAFA 5AW7B 2P9XA 3GKLC 2V4HA 1QEXA 4XFYA 5AW4B 2XNDH 5CCGA 2ZYGA 3NTNA 3M9HA 4DJGA 1OVVA 3HTKB 3G28A 1IMPA 5KAIH 1KYOD 2K9YA 1VQMP 1N7SB 1DH3A 1W2BO 1RHZB 4I7ZC 1USEA 2XZ1C 1ZW0A 4N78D 3GHGA 1M6NA 1G2CB 4PJ0H 1A8OA 1T3JA 3EJDA 1JY2P 1NTZK 2KK7A 1YITP 1SQVJ 2P2UA 4ZKUA 1BGYG 1QGKB 3HE5B 3EJBA 2JU1A 2QA4P 1FZCC 2GZGA 3DTJA 2LR2A 2XV6A 1FC2C 2KOGA 1IO4A 4WVZA 1TU3F 1NO4A 3L75J 5TISE 1IJDB 2XV5A 3G3ZA 1ZV8A 1EC5A 2GA1A 2GZIA 2K9JA 2HPCA 1YYCA 1DD3A 1Q81Q 3EWKA 1HTLC 3T97B 5KJ7C 4QMAA 3OAKA 2A06G 2DNWA 3U1CA 1JEKA 2P10A 1SQVD 1YIJP 1WMKA 2KB7P 5KLIB 4KHXA 4U3FG 1EDJA 2E76B 3WUVA 3L75D 2E43A 3VP9A 3RG2A 1NU1G 2LXBA 1UIXA 3BCCG 1GXGA 3VN0A 1QLED 1SQPG 1Q7YQ 4I7ZB 3E7KA 3E1RA 1X9VA 1ZNVA 3HE4A 3NMDA 3NY7B 4JQ0D 2LTEA 1RQVA 1IFNA 3WUUA 2MVVA 2XZ0D 2WSCJ 3FXEA 3GF7A 2Y9YA 3CX5H 2JYGA 1SFCD 4U0CA 1J1DB 4R4LA 3H4EA 1PGJA 3PJSK 4JPZB 3G71P 1BE3G 1M74A 1S4XA 2WQYC 3AE2C 1M90Q 1NU1E 3BCCE 3BVHA 1N7SD 1G1JA 3W67A 3CXHE 3H1KJ 4WYMA 1XTCC 3VMYA 1IUQA 2QJKC 2AVAA 5AW6B 3FXDA 2PNGA 1KC8Q 1RNIA 1P84I 5AVZB 1DEBA 1SQXE 4GR6A 2OYHC 2KOQA 1DIPA 5GTHH 5CCHD 1LJ2A 2QJPC 1MKMA 1BE3E 2M0BA 1ZMBA 2O1JA 1IZNB 2C9LY 2OARA 4PD4I 2WSSH 1IFJA 1KLPA 2Y0CA 1KFNA 2L22A 1S1CX 3VMAA 2FVAA 5APYA 4EOTA 1OIPA 2QM8A 3H1KD 4OH8B 4UB6E 1LT9C 1IK9A 3G9RA 3KXDA 4LGDE 3I56P 2OTJP 2YIUC 1EDIA 4NPDA 1S72P 5DCKA 1VKUA 1RH5B 1CI6A 2XNXA 3JCUE 2LF4A 1URQD 1EXIA 2ZFCA 5E79E 1MZ9A 2FXMA 1LNQA 1EXJA 1PP9E 3H1LG 2HYNA 3B71A 5KKZC 3HRNA 1Q90D 3HTKA 1KILB 3VYIA 2P58A 3DPHA 1KYOI 4YTPC 2RMZA 2MR8A 3MGNA 3S9OA 2WZ7A 1N7SA 4GKGA 4CA3A 1E0HA 2QJKB 3OJAB 2V7QH 3P8CE 2ONTA 3AEGC 1G2CA 2GUVA 1JY2O 3H1LE 3AE3C 3Q1MA 2KOPA 2LIUA 4H0LC 5CCHA 1RE3C 1T6AA 1NHLA 1Q2NA 3MUDC 4GOFA 3TYYA 3G6EP 1Z6MA 2HLOA 3GZMA 3IFMA 2YNYA 3AECC 3NXSA 4ZMDA 3CCLP 3MD0A 1EZVG 2J58A 3RL0C 2JO1A 5KJ7D 5KAFE 2ERHA 4D6TG 3EFFK 3L74G 3T97A 1URQA 4JF7A 2LL8A 5APWA 3CE7A 2N5HA 1FS0E 1GL2C 3CCQP 1T2KC 4W7ZA 5F2KA 3PHLA 2YKPA 4XROA 2OYIC 3N4XA 2BEQD 1VPCA 1T3UA 3IN6A 3D71A 3LIEA 1VQ8P 2PEMA 1HJBA 2JR8A 1VQ4P 1NU1J 3BCCJ 4AQRD 2KGEA 4OGQC 1L0NG 4WY4C 4PH0A 3AEDC 3M06A 1PFIA 2M8LA 3L74E 3P32A 2M8RA 1J2JB 1MV8A 2KIKA 1YJWP 4DG9A 3DS2A 3FWLA 1SQXJ 3PP5A 2J59M 2JO0A 4IOIH 1AVOA 4WBAA 5AVTB 4NPEA 1FZCA 1VQKP 2O01H 2G8YA 1M8OB 3GLMA 1BE3J 2KNCA 3CI9A 1GK4A 2WSFH 1PEUA 2N9YB 1FDOA 2ZXXA 1QVFO 1FOSF 4DT0A 2CGQA 1L0NE 3U1AA 1NU1D 3BCCD 1U7JA 2GM4A 1YI2P 3CXHD 2LOLA 1BXIA 3HD7C 1L0LK 2WPVB 3VMXA 3P05A 3HE4B 4KJMA 5CBNA 1NTME 2OTLP 5KJ7A 3EQ2A 5GTIE 1NTKK 3BATA 3KQGA 2GZFA 1GU4A 1A02J 2OYOA 3M91A 2IBZI 4BPFA 2QIWA 3A7OA 3TDKA 1SQXD 3W68A 1AV1A 1P84H 3L71E 3M9QA 3CCVP 3SWKA 3N7NA 1PP9J 2K3RA 1EIAA 3A2AA 1BE3D 2HODB 4K3AA 2K94A 2FYZA 2IDBA 1PGOA 1FJPA 1IFMA 1EDKA 2K37A 4OGQB 1BDDA 1D1DA 2KP8A 5B66H 4O9BA 4UB8H 4L76A 2JB0A 1J1EB 1LWUC 4EIJA 4A7PA 5AVXB 3H1JG 5C39A 1GPJA 1GD2E 4LC1A 2KZJA 4H44C 2JDIH 5EW5E 1PGPA 3AE4C 3MHVA 3H1LJ 1E5WA 3AEBC 1JMMA 5BS1A 1UNKA 4HKGA 5F2OA 2DW3A 1PP9D 2E75C 3Q3DA 1H89A 1JB0J 2WSEH 3OW2O 3TGUG 2HG5D 1OR5A 4IFFA 4XFJA 2PY8A 3LW5J 1PEMA 4XA4A 1OXZA 1OZHA 2K0YA 1FJKA 1M1JC 2FFDC 4L74A 5AW5B 4BWNA 2W8ZA 1KYOH 2JWAA 3ABVC 2E1MA 3RG6C 3P8CD 2CPSA 3H1JE 1U7MA 2WITA 3CC4P 2KG6A 1YTZI 3H1LD 1D7MA 2GDXA 1JCCA 3KZIE 1RF1C 2YXRB 5AW2B 5GTHE 1SFCB 3TGUE 3Q20A 1ZN5A 2FYUK 4M3LA 5AW9B 5APUA 4AUWA 2Q5UA 1MFTA 1SQQK 2JQ4A 1LT9A 2XDJA 3RL0D 5M1BA 3B5IA 3A5TA 1IK7A 3L35A 2IFNA 2IZ0A 1AVYA 2Q3EA 4N6JA 2ZJSE 2KGAA 3GG2A 3B5NC 2IFMA 1SVFA 2PAJA 3L74J 5AVQB 2AF8A 1QX8A 5AVUB 3RK3E 1GL2D 2C0XA 1T2KD 4WWIA 1KD1Q 4BRYA 5L8RJ 2JAZA
chains in the Genus database with same CATH topology
3CD6P 1KC8Q 1RNIA 2PEKA 1YJWP 1KQSO 4U0FA 3DS2A 2PEOA 4PH1A 5BS1A 2JO0A 5F2OA 1E6JP 2Z44A 3MGEA 3H0DA 4GR6A 1Q81Q 1VQKP 3DS0A 3DS1A 3G26A 5JPAA 3OW2O 3G21A 2PY8A 2BHVA 2EFJA 4U0BA 1JJ2O 1PEMA 1YIJP 3CCEP 1PEUA 5HGMA 2P9XA 1ZMBA 5HGNA 1QVFO 4GR2A 1M1KQ 3G6EP 1VQ7P 2OARA 4XFYA 3HZQA 5I4TG 3DS5A 1EOQA 2Z46A 1Q82Q 1VQPP 1YHQP 1PEOA 1N8RQ 2BQ1E 3CXCO 1YI2P 4COCA 1YJ9P 1K8AQ 1K30A 2E1MA 3RG6C 3CCLP 3G28A 4QNBA 1BAJA 1VQ9P 5HGOA 2PEIA 3P05A 3CCSP 1VQ5P 1Q86Q 4XRQA 2EG5A 3CC4P 2OTLP 3I56P 2OTJP 2KODA 1VQMP 3CCMP 1S72P 1Q7YQ 5DCKA 2M8NA 4U0EA 1K9MQ 2XT1A 1W2BO 3NTEA 5HGLA 2JYLA 2LF4A 3CPWO 3I55P 3G4SP 3CC2P 1QVGO 5F2NA 2DGYA 3Q20A 4IPYA 3CCRP 1PEQA 5BS2A 3CCVP 1QRJA 2XXMA 3E2DA 3CCQP 1M6NA 1EIAA 3G29A 1YJNP 3G0VA 1VQ6P 1A8OA 4COPA 2BUOA 4U0DA 1VQNP 2JYGA 1K73Q 3CMEP 4U0CA 1YITP 5F2KA 4XROA 2PEQA 1RO2A 3G1GA 3H4EA 3DS3A 2QEXP 2PEJA 1M6EX 2QA4P 3B5IA 3CMAP 3G71P 1VQ8P 3DPHA 1M74A 2PEMA 2PENA 3WBHA 3DTJA 3VRLC 1D1DA 1VQ4P 2XV6A 3CCJP 2EIAA 1M90Q 1A43A 1VQOP 3HYBA 4PH0A 4U0AA 1RO0A 2M8PA 2L6EA 3CCUP 3CC7P 2M8LA 2Z45A 3DS4A 3M1MA 4WYMA 2CWOA 2ONTA 1NJIQ 1IUQA 4M0IA 1KD1Q 1AUMA 3G1IA 4XFXA 1VQLP 3LRYA 3H47A 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 P;  2QA4 P;  1W2B O;  1KC8 Q;  1KQS O;  1YJW P;  3CMA P;  3G71 P;  1VQ8 P;  3CPW O;  3I55 P;  1VQL P;  1Q82 Q;  1VQP P;  1YHQ P;  3G4S P;  1N8R Q;  3CC2 P;  1QVG O;  3CXC O;  1YI2 P;  1VQ4 P;  3CCJ P;  1YJ9 P;  3CCR P;  1K8A Q;  3CCV P;  1M90 Q;  1Q81 Q;  1VQK P;  1VQO P;  3CCL P;  3CCQ P;  1YJN P;  1VQ6 P;  3OW2 O;  1VQ9 P;  3CCU P;  3CCS P;  1VQ5 P;  1Q86 Q;  3CC7 P;  1VQN P;  1JJ2 O;  1NJI Q;  1YIJ P;  1K73 Q;  3I56 P;  3CC4 P;  3CME P;  1YIT P;  2OTL P;  2OTJ P;  1KD1 Q;  1VQM P;  3CCE P;  3CCM P;  1S72 P;  1Q7Y Q;  1K9M Q;  1QVF O;  1M1K Q;  2QEX P;  3G6E P;  1VQ7 P; 
#chains in the Genus database with same CATH topology
 1K04 A;  1LTA C;  1KQS O;  3RK3 C;  5APS A;  2E75 B;  2QE7 H;  1FAV A;  2GDY A;  4JYC A;  4ZNC A;  3G26 A;  4WB4 A;  1HWT C;  1M1J B;  1JCD A;  4OGQ D;  3F89 A;  2M3E A;  4WY4 D;  1ZOY C;  4JYB A;  1L0N J;  3GJN A;  3O6Q A;  2N6Z A;  2O01 N;  3WU2 H;  1KB9 E;  2BEZ F;  1FBM A;  3EFG A;  2E5T A;  2EHT A;  2CPB A;  1BCC G;  3PRJ A;  2OQQ A;  3H1H G;  3TK1 A;  3L74 D;  1PZQ A;  1HGV A;  1WRG A;  1LTJ C;  1NTM J;  1VQ5 P;  1Q86 Q;  1URQ B;  1BGY E;  1SP4 A;  1AJY A;  5HV8 A;  3OA7 A;  5APQ A;  5KLV G;  2ZXE B;  3A0B E;  4H2Y C;  1ZME C;  2FXP A;  3L71 J;  3MUD A;  1KOR A;  1VQ6 P;  1IMQ A;  2KXP B;  3CXH I;  4Y99 C;  1T8K A;  3B4Q A;  4GIF A;  1L0N D;  3HD7 D;  4PXH B;  2MD9 A;  2AEM A;  2H89 C;  3AE5 C;  4NEO A;  1BCC E;  1XTG B;  2KYV A;  1FE6 A;  2Z4E A;  2A06 E;  1NTM D;  4H13 C;  3AEE C;  1NOH A;  3PH0 A;  1GL2 A;  2XZR A;  5B5E E;  2KS1 A;  1FZC B;  2J5U A;  4XFZ A;  4U3F E;  4GT1 A;  2KLV A;  3WMM 0;  1NYH A;  2HOD A;  2PP6 A;  3L71 D;  2IYP A;  3L72 G;  1ACP A;  3FGA D;  2OYI A;  2Y9Z A;  2KNC B;  1EQ7 A;  4PV1 C;  3Q2Y A;  3DS1 A;  1SQP E;  2VLP A;  1L2P A;  1FZE A;  1SQB G;  2I1J A;  3QH9 A;  1H0T A;  2YO2 A;  3SSU A;  2ZAE B;  1RF0 C;  1SQV K;  3SFD C;  1VQ7 P;  2FYN C;  5I4T G;  3AE7 C;  5AW1 B;  2FY8 A;  3DS5 A;  1PGQ A;  1CZQ A;  1Q82 Q;  1VQP P;  2BQ1 E;  4Y28 J;  4OWF A;  3H1J J;  5H2F H;  4H44 D;  4C7N B;  4DCK A;  5APV A;  1DD4 A;  1BAJ A;  3FX0 A;  2PEI A;  2FYU G;  1ZLL A;  4RO0 A;  2E75 D;  1PL5 A;  2KOD A;  3L72 E;  1X22 A;  3CCM P;  3K5B A;  4EI2 A;  5BVZ A;  2JYL A;  3TGU J;  3CPW O;  3EJE A;  2VLQ A;  2H43 A;  2KWL A;  1FDI A;  3G29 A;  2E74 C;  2BCC G;  1USD A;  2AXT E;  2BUO A;  4BXL A;  1RE4 C;  3H1I G;  3HD7 A;  5CCG C;  2P7J A;  1RO2 A;  4L73 A;  2LXC B;  2BAS A;  1HY8 A;  1R5S A;  1NTZ G;  1BSH A;  3V5B A;  3WBH A;  3H1J D;  3Q5P A;  1HGZ A;  1ZXG A;  2D2C C;  3CCJ P;  2H7H A;  1DX7 A;  3AEF C;  4H13 B;  1A43 A;  1S9K E;  4PWV B;  4ZKP A;  1NWQ A;  1M7L A;  2KZI A;  4HYT B;  2N1T C;  2MJZ A;  1SFC A;  1HJ0 A;  1FZG A;  1IFI A;  4DZO A;  4RJT A;  2JEE A;  2FAD A;  3TGU D;  2YO3 A;  3CD6 P;  3GZL A;  4HKZ H;  1FZA A;  3GHG C;  1FZF A;  1X79 B;  2IYO A;  2PEO A;  2O1K A;  2IX7 C;  3L73 G;  2K93 A;  2BCC E;  2ZT9 C;  5AW0 B;  3SWF A;  1YBK A;  5CJ4 A;  3H1I E;  1FZB A;  2JJL A;  4LLH A;  2EFJ A;  3B5N D;  1NTZ E;  4PD4 E;  4CPG A;  1R5L A;  1OW7 A;  5TIS H;  2Y0D A;  2LKI A;  4L75 A;  2R32 A;  4COC A;  4JBZ A;  2OYH B;  1S3J A;  1BGY J;  3RK3 D;  2QJP B;  2L5G B;  3BRT B;  4AYC A;  2K92 A;  1UII A;  2M8N A;  3LMO A;  4GOE A;  1Y9B A;  5HGL A;  3A0H E;  3H6P A;  2AFE A;  2W6J H;  1M1J A;  2FFD A;  1AFO A;  2QM7 A;  1PEQ A;  1QRJ A;  3F5H A;  5AVW B;  3PLN A;  1LT9 B;  2YIU B;  1K73 Q;  4W7Y A;  1OVR A;  3Q5R A;  4QKO A;  1BCC J;  1KB9 D;  3NFQ A;  1EMV A;  1NKN A;  1A02 F;  2D2C B;  1ZR4 A;  2QSI A;  2PEN A;  1KQG B;  3A3Y B;  1BGY D;  3V4W A;  3VP8 A;  3TNU A;  2WTY A;  4BRY B;  2GDW A;  1RF1 A;  1BSN A;  1OMI A;  2CNR A;  5KKZ B;  1VDF A;  1UJZ A;  2KG8 A;  2M5R A;  3IAO A;  2K88 A;  4U3F J;  1CEI A;  1AA0 A;  1AUM A;  3G1I A;  3LRY A;  1JNM A;  5KTB A;  4NPF X;  3L70 G;  2KGD A;  1SQV G;  1EZV E;  5AVS B;  3VOP A;  3RK2 C;  5KAI E;  1SQP J;  2POH A;  5JPA A;  2M3B A;  3O6Q B;  2KGC A;  3M0D C;  1Y47 A;  3B5N A;  4D6T E;  1X0T A;  1BCC D;  2AEJ A;  2N9B A;  2FVF A;  3CXH H;  1M1K Q;  4H13 D;  1ZR2 A;  3H25 A;  2O3J A;  2A06 D;  1PEO A;  2JBG A;  1YHQ P;  2QJY C;  3CXC O;  4PJ0 E;  2KOO A;  3I5C A;  1VF5 C;  4H0L B;  1KMI Z;  2RH0 A;  1OWA A;  1N7L A;  3L72 J;  4U3F D;  2ZYA A;  2WWW A;  4PV1 D;  1ZRT E;  1KZU B;  3L70 E;  2O01 J;  4RES B;  2XT1 A;  2YKQ A;  3D6Y A;  2A45 I;  1SQB J;  3CC2 P;  1X3O A;  4IPY A;  1SQP D;  1NAY A;  2Q3I A;  3RL0 B;  2KSJ A;  2W90 A;  4GDO A;  3WU2 E;  4UB6 H;  2PEQ A;  2WPQ A;  4C7N A;  2R5D A;  2LIW A;  2PEJ A;  2VSQ A;  4H2X C;  1OW8 A;  4F37 A;  1G1I A;  1L4A C;  2R3C A;  3VRL C;  2WMM A;  1GL2 B;  3L36 A;  3JCU H;  1QL2 A;  1SS1 A;  4EDF A;  2KS1 B;  4YXW H;  3L72 D;  2N50 A;  1RO0 A;  1LTT C;  1FR2 A;  2HR3 A;  3AE6 C;  3AE1 C;  2CWO A;  2LKM A;  2MVU A;  2OYI B;  1GTW A;  2IPP A;  2E74 D;  1VQL P;  1GZL A;  2KUB A;  2OGU A;  3U43 A;  2BCC J;  2KSE A;  2JP3 A;  4U0F A;  2IBZ G;  5CCG D;  1VL2 A;  3GF3 A;  1EDL A;  1H0T B;  2C0W A;  3H1I J;  4WY4 B;  3H0D A;  1W5C E;  2KW2 A;  1NTZ J;  2D2C D;  1MUU A;  2JKV A;  1JY3 N;  1KN7 A;  4R4M A;  4GR2 A;  3AE9 C;  3RL0 g;  1JUN A;  2N1T D;  2QJY B;  3KPE A;  1EOQ A;  1S9K D;  3BAS A;  1N8R Q;  4MRT C;  1GW3 A;  5BU8 B;  1HVV A;  3GW6 A;  1NU1 K;  2CQ8 A;  3CX5 E;  2W6A A;  2GUS A;  1HQB A;  2FQ0 A;  2MY5 A;  3TSI A;  2E42 A;  2ZT9 D;  2NZ2 A;  1JM0 A;  1PPJ G;  2IBZ E;  2BCC D;  3CWB G;  1F80 D;  2W27 A;  3MZW B;  5APT A;  3CL3 D;  1RF0 A;  3RBX A;  3I55 P;  3H1I D;  1SQX K;  1MFZ A;  3HD7 B;  1NTZ D;  1HUC A;  2Z5I A;  4PD4 D;  1L0H A;  1X8Y A;  2RKL A;  2GZJ A;  3II6 A;  3IF4 A;  3CME P;  1OW6 A;  2M5A B;  3Q5S A;  4MN4 C;  3V2P A;  2OYH A;  5CHX A;  2G3A A;  4H0L D;  2VLO A;  2ZYD A;  5KAF H;  4BPG A;  5AVY B;  1PPJ E;  2K0D X;  4W80 A;  1LTS C;  3CWB E;  1JTH A;  2Q6Q A;  3V2N A;  4EYY Q;  3S4R A;  5CZD B;  1RE4 A;  1CSB A;  4ASV A;  2YMK A;  5KLI C;  1LGH B;  1KB9 I;  1PIX A;  2N5I A;  1LWU B;  2E76 C;  4I6M C;  1S5L H;  4D6T J;  3G21 A;  3R2P A;  3RGU A;  2E5Y A;  2K1A A;  3CCE P;  4H44 B;  3H32 A;  2FBW C;  2N1T A;  1Z56 A;  1GMJ A;  2JWD A;  2Q1K A;  3KDP B;  4QNB A;  1QL1 A;  1S5L X;  2NPS C;  2WPR A;  2FXO A;  3RK2 D;  3L70 J;  5KP6 B;  4IL6 H;  2FFD B;  1NQ4 A;  1JMB A;  1J1D C;  1L0L G;  1EZV D;  3R4Y A;  3RBZ A;  4IFM A;  1QVG O;  4BPH A;  1NTK G;  2DGY A;  5BS2 A;  4D6T D;  1N73 C;  4R0M A;  1BDC A;  1GXH A;  2P67 A;  4ASW A;  1VQN P;  1WT6 A;  1VF5 D;  3MP7 B;  4IL6 X;  3TNU B;  1RE3 A;  3KYQ A;  1M6E X;  1H8A A;  1RF1 B;  2QVA A;  5GTI H;  2CG5 B;  2IZ1 A;  2L4B A;  2YKO A;  5AVR B;  1CW5 A;  3HYB A;  4U7J A;  1ZRT D;  1T8Z A;  3L70 D;  2M8P A;  3CC7 P;  1L0L E;  3HUS C;  3DS4 A;  4YXD C;  2WPS A;  3USS A;  2QNW A;  1NTK E;  3JSV C;  3H1H E;  4H2W C;  4RKU J;  3B5N B;  2A45 H;  1E6J P;  3MGE A;  2UWJ E;  5CMZ A;  1M57 D;  4UHP B;  1L4A D;  3O8Z A;  5KLV E;  1HF9 A;  2WPT A;  4HH2 A;  2WT7 A;  5TJH A;  3RK3 B;  3HZQ A;  5KP8 B;  2WSC H;  2Z46 A;  2PFX A;  2K0X A;  2B87 A;  2NPS B;  3B8E B;  2NO8 A;  1R8E A;  2FVE A;  1SQX G;  3LID A;  2FAC A;  2B9B A;  2B88 A;  1KIL E;  2EG5 A;  2FAE A;  4WY4 A;  2QG4 A;  3M0D A;  4IZ6 A;  3NTE A;  1KIL C;  1N73 B;  1JOC A;  1JY3 P;  3CCR P;  1LTG C;  1LTJ B;  2I1K A;  4COP A;  3S1K A;  3JC2 2;  2KI7 B;  1IFP A;  3L4F A;  3G1G A;  2QEX P;  1L0N K;  2FQ2 A;  3CX5 D;  2X2B A;  1SQQ G;  4YPC A;  1SQB E;  1VQO P;  1KFM A;  3KZI H;  3HUS B;  3CWB J;  3P8M C;  2IBZ D;  1OFC X;  4Y99 B;  4Z1M H;  2K5X A;  1NTM K;  2L9F A;  4XE5 B;  1NJI Q;  4M0I A;  1K05 A;  1ZP0 C;  2OTK E;  1PP9 G;  3H47 A;  1OVU A;  3GMA A;  2L91 A;  2KG9 A;  2PGD A;  3P7K A;  2Q7C A;  1PV3 A;  4GOD A;  5BU5 A;  2M5A A;  1N86 A;  4TLF A;  1DV5 A;  2C9N Y;  3PTZ A;  3KHU A;  4B86 A;  2FYU E;  1L4A A;  3DS0 A;  1S2E A;  2W6B A;  2SPZ A;  2BHV A;  1U57 A;  1JJ2 O;  4I1L A;  1SQQ E;  5HGN A;  3V4Q A;  2R3S A;  1P84 E;  2B89 A;  3CLQ A;  1PPJ D;  4PV1 B;  1YJ9 P;  1K8A Q;  2JU2 A;  1GW4 A;  5AW3 B;  2CK3 H;  3CWB D;  4TT3 H;  1VQ9 P;  2ROQ A;  7CEI A;  5CJ0 A;  2WVR A;  3VTP C;  2ITA A;  2E76 D;  2FYN B;  2VRS A;  1LWU A;  1LP1 B;  2PRR A;  5B66 E;  3M0A A;  4C46 A;  4UB8 E;  3G4S P;  2V7Q J;  1LTB C;  3B4S A;  5DJT B;  3E2D A;  3ZDM A;  1KB9 H;  2YXQ B;  1YJN P;  2Q9I A;  4U0D A;  4IFD K;  5APX A;  2R44 A;  3DS3 A;  3L73 E;  2NPS D;  3C9I A;  3M9B A;  3A0B H;  1EZV I;  1JTH B;  2EIA A;  2E74 B;  3HE5 A;  1L0L J;  3V2R A;  2KOR A;  1KQF B;  1LTI C;  3U59 A;  2L6E A;  1OX3 A;  1LT1 A;  1NTK J;  3MTU E;  4XFX A;  3H1H J;  3VMZ A;  2GYK A;  1KYO E;  1N2D C;  1FOS E;  2FQ1 A;  2JGP A;  1FDM A;  2Z44 A;  2XKM A;  5KLV J;  3H32 B;  2N1T B;  2QRX A;  3WUT A;  1MZ8 A;  1IFD A;  1KQL A;  4U0B A;  4N78 E;  2VLN A;  3AEA C;  1AYI A;  3QWO C;  1JO5 A;  3GHG B;  5CBO A;  3IR9 A;  1JY2 N;  5B5E H;  2ZT9 B;  4DOJ A;  2MKV A;  2XU6 A;  1K30 A;  1L0L D;  2RN0 A;  3L37 A;  3CCS P;  1FU1 A;  3SWY A;  1NTK D;  5AW8 B;  2FHS C;  3BRV B;  3D70 A;  5EJD A;  3H1H D;  2H8P D;  1YQ4 C;  4U0E A;  5HVC A;  1K9M Q;  1Y8A A;  3L75 G;  1S5L E;  2Z5H A;  5KLV D;  2AFD A;  2H88 C;  2XXM A;  5K5G B;  1AQ5 A;  1RQU A;  2N98 A;  2K9J B;  2HPC B;  4N3Y B;  1J1E C;  1AQT A;  1NKZ B;  1DEE G;  1NGM B;  2NPS A;  1SQV E;  1NTM G;  3CMA P;  1KTM A;  1E79 H;  2MF4 A;  2P1J A;  2WSF J;  4IL6 E;  1KIL D;  3AE8 C;  2NRG A;  1YTZ T;  3CCU P;  1W2E A;  3L71 G;  2Z45 A;  2ZVO B;  1N73 A;  5EFW B;  1JY3 O;  3L75 E;  2L0Q A;  2AXT H;  1LTJ A;  4OVN F;  2PEK A;  3C8V A;  2K2Q A;  5KP7 B;  2FYU J;  2A45 G;  2YMY A;  1GK6 A;  2WT7 B;  3CX5 I;  4C7R A;  3V2Q A;  5E79 H;  1L0I A;  1SQQ J;  5HGM A;  2B87 B;  3HUS A;  1SQB D;  2KLU A;  3RK2 B;  2KOS A;  3ITK A;  2AEF A;  4HB1 A;  1SFC C;  2MR7 A;  2I8D A;  1GU5 A;  5KLV K;  5AVV B;  2R5B A;  2Y0E A;  5HGO A;  1HH0 A;  1AF8 A;  4I2L C;  4XRQ A;  1KV4 A;  2FKW B;  2KR5 A;  2LML A;  1DNY A;  3H1K G;  1N7S C;  4K35 A;  2FYU D;  4PD4 H;  4HJG H;  1VF5 B;  4KT0 J;  5F2N A;  1M56 D;  1SLQ A;  1NH4 A;  1SQP K;  1RY3 A;  3G0V A;  1SQQ D;  2ZVN B;  3FWN A;  3E1I A;  3V6I A;  1P84 D;  1YQ3 C;  3L73 J;  1IC2 A;  2W83 C;  2WSE J;  2GZE A;  1GDT A;  3UIA A;  5CCH C;  3LW5 H;  1HBW A;  2EHS A;  1KIL A;  3A0H H;  1VHN A;  4U0A A;  1LP1 A;  2AXC A;  1H88 A;  3M1M A;  3C1L A;  3SFE C;  3H1K E;  2HFE D;  1L4A B;  5H2F E;  1NVO A;  2LPK A;  4PH1 A;  1SQB K;  3TF5 A;  2N6Y A;  1CI6 B;  3D6Z A;  3MIW A;  3L73 D;  5DJU B;  1URQ C;  1NAF A;  5AW7 B;  2P9X A;  3GKL C;  2V4H A;  1QEX A;  4XFY A;  5AW4 B;  2XND H;  5CCG A;  2ZYG A;  3NTN A;  3M9H A;  4DJG A;  1OVV A;  3HTK B;  3G28 A;  1IMP A;  5KAI H;  1KYO D;  2K9Y A;  1VQM P;  1N7S B;  1DH3 A;  1W2B O;  1RHZ B;  4I7Z C;  1USE A;  2XZ1 C;  1ZW0 A;  4N78 D;  3GHG A;  1M6N A;  1G2C B;  4PJ0 H;  1A8O A;  1T3J A;  3EJD A;  1JY2 P;  1NTZ K;  2KK7 A;  1YIT P;  1SQV J;  2P2U A;  4ZKU A;  1BGY G;  1QGK B;  3HE5 B;  3EJB A;  2JU1 A;  2QA4 P;  1FZC C;  2GZG A;  3DTJ A;  2LR2 A;  2XV6 A;  1FC2 C;  2KOG A;  1IO4 A;  4WVZ A;  1TU3 F;  1NO4 A;  3L75 J;  5TIS E;  1IJD B;  2XV5 A;  3G3Z A;  1ZV8 A;  1EC5 A;  2GA1 A;  2GZI A;  2K9J A;  2HPC A;  1YYC A;  1DD3 A;  1Q81 Q;  3EWK A;  1HTL C;  3T97 B;  5KJ7 C;  4QMA A;  3OAK A;  2A06 G;  2DNW A;  3U1C A;  1JEK A;  2P10 A;  1SQV D;  1YIJ P;  1WMK A;  2KB7 P;  5KLI B;  4KHX A;  4U3F G;  1EDJ A;  2E76 B;  3WUV A;  3L75 D;  2E43 A;  3VP9 A;  3RG2 A;  1NU1 G;  2LXB A;  1UIX A;  3BCC G;  1GXG A;  3VN0 A;  1QLE D;  1SQP G;  1Q7Y Q;  4I7Z B;  3E7K A;  3E1R A;  1X9V A;  1ZNV A;  3HE4 A;  3NMD A;  3NY7 B;  4JQ0 D;  2LTE A;  1RQV A;  1IFN A;  3WUU A;  2MVV A;  2XZ0 D;  2WSC J;  3FXE A;  3GF7 A;  2Y9Y A;  3CX5 H;  2JYG A;  1SFC D;  4U0C A;  1J1D B;  4R4L A;  3H4E A;  1PGJ A;  3PJS K;  4JPZ B;  3G71 P;  1BE3 G;  1M74 A;  1S4X A;  2WQY C;  3AE2 C;  1M90 Q;  1NU1 E;  3BCC E;  3BVH A;  1N7S D;  1G1J A;  3W67 A;  3CXH E;  3H1K J;  4WYM A;  1XTC C;  3VMY A;  1IUQ A;  2QJK C;  2AVA A;  5AW6 B;  3FXD A;  2PNG A;  1KC8 Q;  1RNI A;  1P84 I;  5AVZ B;  1DEB A;  1SQX E;  4GR6 A;  2OYH C;  2KOQ A;  1DIP A;  5GTH H;  5CCH D;  1LJ2 A;  2QJP C;  1MKM A;  1BE3 E;  2M0B A;  1ZMB A;  2O1J A;  1IZN B;  2C9L Y;  2OAR A;  4PD4 I;  2WSS H;  1IFJ A;  1KLP A;  2Y0C A;  1KFN A;  2L22 A;  1S1C X;  3VMA A;  2FVA A;  5APY A;  4EOT A;  1OIP A;  2QM8 A;  3H1K D;  4OH8 B;  4UB6 E;  1LT9 C;  1IK9 A;  3G9R A;  3KXD A;  4LGD E;  3I56 P;  2OTJ P;  2YIU C;  1EDI A;  4NPD A;  1S72 P;  5DCK A;  1VKU A;  1RH5 B;  1CI6 A;  2XNX A;  3JCU E;  2LF4 A;  1URQ D;  1EXI A;  2ZFC A;  5E79 E;  1MZ9 A;  2FXM A;  1LNQ A;  1EXJ A;  1PP9 E;  3H1L G;  2HYN A;  3B71 A;  5KKZ C;  3HRN A;  1Q90 D;  3HTK A;  1KIL B;  3VYI A;  2P58 A;  3DPH A;  1KYO I;  4YTP C;  2RMZ A;  2MR8 A;  3MGN A;  3S9O A;  2WZ7 A;  1N7S A;  4GKG A;  4CA3 A;  1E0H A;  2QJK B;  3OJA B;  2V7Q H;  3P8C E;  2ONT A;  3AEG C;  1G2C A;  2GUV A;  1JY2 O;  3H1L E;  3AE3 C;  3Q1M A;  2KOP A;  2LIU A;  4H0L C;  5CCH A;  1RE3 C;  1T6A A;  1NHL A;  1Q2N A;  3MUD C;  4GOF A;  3TYY A;  3G6E P;  1Z6M A;  2HLO A;  3GZM A;  3IFM A;  2YNY A;  3AEC C;  3NXS A;  4ZMD A;  3CCL P;  3MD0 A;  1EZV G;  2J58 A;  3RL0 C;  2JO1 A;  5KJ7 D;  5KAF E;  2ERH A;  4D6T G;  3EFF K;  3L74 G;  3T97 A;  1URQ A;  4JF7 A;  2LL8 A;  5APW A;  3CE7 A;  2N5H A;  1FS0 E;  1GL2 C;  3CCQ P;  1T2K C;  4W7Z A;  5F2K A;  3PHL A;  2YKP A;  4XRO A;  2OYI C;  3N4X A;  2BEQ D;  1VPC A;  1T3U A;  3IN6 A;  3D71 A;  3LIE A;  1VQ8 P;  2PEM A;  1HJB A;  2JR8 A;  1VQ4 P;  1NU1 J;  3BCC J;  4AQR D;  2KGE A;  4OGQ C;  1L0N G;  4WY4 C;  4PH0 A;  3AED C;  3M06 A;  1PFI A;  2M8L A;  3L74 E;  3P32 A;  2M8R A;  1J2J B;  1MV8 A;  2KIK A;  1YJW P;  4DG9 A;  3DS2 A;  3FWL A;  1SQX J;  3PP5 A;  2J59 M;  2JO0 A;  4IOI H;  1AVO A;  4WBA A;  5AVT B;  4NPE A;  1FZC A;  1VQK P;  2O01 H;  2G8Y A;  1M8O B;  3GLM A;  1BE3 J;  2KNC A;  3CI9 A;  1GK4 A;  2WSF H;  1PEU A;  2N9Y B;  1FDO A;  2ZXX A;  1QVF O;  1FOS F;  4DT0 A;  2CGQ A;  1L0N E;  3U1A A;  1NU1 D;  3BCC D;  1U7J A;  2GM4 A;  1YI2 P;  3CXH D;  2LOL A;  1BXI A;  3HD7 C;  1L0L K;  2WPV B;  3VMX A;  3P05 A;  3HE4 B;  4KJM A;  5CBN A;  1NTM E;  2OTL P;  5KJ7 A;  3EQ2 A;  5GTI E;  1NTK K;  3BAT A;  3KQG A;  2GZF A;  1GU4 A;  1A02 J;  2OYO A;  3M91 A;  2IBZ I;  4BPF A;  2QIW A;  3A7O A;  3TDK A;  1SQX D;  3W68 A;  1AV1 A;  1P84 H;  3L71 E;  3M9Q A;  3CCV P;  3SWK A;  3N7N A;  1PP9 J;  2K3R A;  1EIA A;  3A2A A;  1BE3 D;  2HOD B;  4K3A A;  2K94 A;  2FYZ A;  2IDB A;  1PGO A;  1FJP A;  1IFM A;  1EDK A;  2K37 A;  4OGQ B;  1BDD A;  1D1D A;  2KP8 A;  5B66 H;  4O9B A;  4UB8 H;  4L76 A;  2JB0 A;  1J1E B;  1LWU C;  4EIJ A;  4A7P A;  5AVX B;  3H1J G;  5C39 A;  1GPJ A;  1GD2 E;  4LC1 A;  2KZJ A;  4H44 C;  2JDI H;  5EW5 E;  1PGP A;  3AE4 C;  3MHV A;  3H1L J;  1E5W A;  3AEB C;  1JMM A;  5BS1 A;  1UNK A;  4HKG A;  5F2O A;  2DW3 A;  1PP9 D;  2E75 C;  3Q3D A;  1H89 A;  1JB0 J;  2WSE H;  3OW2 O;  3TGU G;  2HG5 D;  1OR5 A;  4IFF A;  4XFJ A;  2PY8 A;  3LW5 J;  1PEM A;  4XA4 A;  1OXZ A;  1OZH A;  2K0Y A;  1FJK A;  1M1J C;  2FFD C;  4L74 A;  5AW5 B;  4BWN A;  2W8Z A;  1KYO H;  2JWA A;  3ABV C;  2E1M A;  3RG6 C;  3P8C D;  2CPS A;  3H1J E;  1U7M A;  2WIT A;  3CC4 P;  2KG6 A;  1YTZ I;  3H1L D;  1D7M A;  2GDX A;  1JCC A;  3KZI E;  1RF1 C;  2YXR B;  5AW2 B;  5GTH E;  1SFC B;  3TGU E;  3Q20 A;  1ZN5 A;  2FYU K;  4M3L A;  5AW9 B;  5APU A;  4AUW A;  2Q5U A;  1MFT A;  1SQQ K;  2JQ4 A;  1LT9 A;  2XDJ A;  3RL0 D;  5M1B A;  3B5I A;  3A5T A;  1IK7 A;  3L35 A;  2IFN A;  2IZ0 A;  1AVY A;  2Q3E A;  4N6J A;  2ZJS E;  2KGA A;  3GG2 A;  3B5N C;  2IFM A;  1SVF A;  2PAJ A;  3L74 J;  5AVQ B;  2AF8 A;  1QX8 A;  5AVU B;  3RK3 E;  1GL2 D;  2C0X A;  1T2K D;  4WWI A;  1KD1 Q;  4BRY A;  5L8R J;  2JAZ A; 
#chains in the Genus database with same CATH homology
 3CD6 P;  1KC8 Q;  1RNI A;  2PEK A;  1YJW P;  1KQS O;  4U0F A;  3DS2 A;  2PEO A;  4PH1 A;  5BS1 A;  2JO0 A;  5F2O A;  1E6J P;  2Z44 A;  3MGE A;  3H0D A;  4GR6 A;  1Q81 Q;  1VQK P;  3DS0 A;  3DS1 A;  3G26 A;  5JPA A;  3OW2 O;  3G21 A;  2PY8 A;  2BHV A;  2EFJ A;  4U0B A;  1JJ2 O;  1PEM A;  1YIJ P;  3CCE P;  1PEU A;  5HGM A;  2P9X A;  1ZMB A;  5HGN A;  1QVF O;  4GR2 A;  1M1K Q;  3G6E P;  1VQ7 P;  2OAR A;  4XFY A;  3HZQ A;  5I4T G;  3DS5 A;  1EOQ A;  2Z46 A;  1Q82 Q;  1VQP P;  1YHQ P;  1PEO A;  1N8R Q;  2BQ1 E;  3CXC O;  1YI2 P;  4COC A;  1YJ9 P;  1K8A Q;  1K30 A;  2E1M A;  3RG6 C;  3CCL P;  3G28 A;  4QNB A;  1BAJ A;  1VQ9 P;  5HGO A;  2PEI A;  3P05 A;  3CCS P;  1VQ5 P;  1Q86 Q;  4XRQ A;  2EG5 A;  3CC4 P;  2OTL P;  3I56 P;  2OTJ P;  2KOD A;  1VQM P;  3CCM P;  1S72 P;  1Q7Y Q;  5DCK A;  2M8N A;  4U0E A;  1K9M Q;  2XT1 A;  1W2B O;  3NTE A;  5HGL A;  2JYL A;  2LF4 A;  3CPW O;  3I55 P;  3G4S P;  3CC2 P;  1QVG O;  5F2N A;  2DGY A;  3Q20 A;  4IPY A;  3CCR P;  1PEQ A;  5BS2 A;  3CCV P;  1QRJ A;  2XXM A;  3E2D A;  3CCQ P;  1M6N A;  1EIA A;  3G29 A;  1YJN P;  3G0V A;  1VQ6 P;  1A8O A;  4COP A;  2BUO A;  4U0D A;  1VQN P;  2JYG A;  1K73 Q;  3CME P;  4U0C A;  1YIT P;  5F2K A;  4XRO A;  2PEQ A;  1RO2 A;  3G1G A;  3H4E A;  3DS3 A;  2QEX P;  2PEJ A;  1M6E X;  2QA4 P;  3B5I A;  3CMA P;  3G71 P;  1VQ8 P;  3DPH A;  1M74 A;  2PEM A;  2PEN A;  3WBH A;  3DTJ A;  3VRL C;  1D1D A;  1VQ4 P;  2XV6 A;  3CCJ P;  2EIA A;  1M90 Q;  1A43 A;  1VQO P;  3HYB A;  4PH0 A;  4U0A A;  1RO0 A;  2M8P A;  2L6E A;  3CCU P;  3CC7 P;  2M8L A;  2Z45 A;  3DS4 A;  3M1M A;  4WYM A;  2CWO A;  2ONT A;  1NJI Q;  1IUQ A;  4M0I A;  1KD1 Q;  1AUM A;  3G1I A;  4XFX A;  1VQL P;  3LRY A;  3H47 A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...