1Q7YQ

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 51
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q7yQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q7yQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q7yQ03
1KD1Q 2OTLP 3CCSP 1YITP 1NJIQ 3CCEP 1YJWP 3CCVP 1KQSO 3I56P 1VQMP 1M90Q 1S72P 3CD6P 3CCUP 1Q7YQ 1VQKP 2QA4P 3CC4P 3CC2P 1KC8Q 3G71P 1VQ5P 1M1KQ 1YJNP 3CCRP 1VQ6P 1VQPP 1K73Q 1VQ7P 3CPWO 1VQOP 2OTJP 1YIJP 3CMAP 3CCJP 1W2BO 1VQ4P 1YHQP 1VQ8P 3CCLP 1YI2P 1VQNP 1VQLP 3G6EP 3CCQP 1K9MQ 1Q86Q 1K8AQ 3I55P 3CCMP 1Q81Q 1YJ9P 3OW2O 3CXCO 1Q82Q 1N8RQ 1VQ9P 3CMEP 1QVGO 3CC7P 3G4SP 1JJ2O 1QVFO 2QEXP
chains in the Genus database with same CATH superfamily
1NTZD 5DJTB 1GK4A 3DS3A 1WMKA 1L0LE 3DPHA 5CBOA 1R5SA 1J1EB 1IZNB 5APVA 5KLVE 5B5EE 2VLOA 1K9MQ 5TISH 3Q20A 1YJ9P 2B89A 1M7LA 3RL0B 3AE6C 3MGEA 3V2PA 1S72P 1ZRTD 1DH3A 1EDLA 2N9BA 1SQPJ 5KLVJ 4LC1A 1BCCG 2Z45A 1YBKA 1KORA 3CCRP 4JQ0D 4C7NA 4I2LC 2Q6QA 3C1LA 1S5LH 1GMJA 2D2CD 2QE7H 2O01H 2FYUD 2XZRA 1U7MA 1SQVE 3T97A 2WTYA 2EG5A 3EWKA 2KGAA 1BE3D 2BEZF 3D6ZA 4U0AA 4DCKA 2MD9A 2FVEA 1S5LX 3Q5PA 2Y9YA 3P32A 2RMZA 3GMAA 1RHZB 2CK3H 2ITAA 3HTKB 2K9JA 3RK2C 4U0EA 4EDFA 3MUDC 1VPCA 1SS1A 2YO2A 3IAOA 1A02F 1Q2NA 5AVXB 2B9BA 2W83C 2BCCG 3QWOC 2PENA 1UIIA 1URQA 3M1MA 1YI2P 1L0LG 1E0HA 1QL1A 1KTMA 1ZLLA 2WZ7A 3SFDC 1RF0C 2E75C 2JDIH 1S1CX 1OVVA 1EZVG 1NOHA 1DNYA 1SQXG 5KP7B 3RL0g 3AE4C 5KJ7D 4B86A 2BHVA 3DS2A 4HYTB 5DCKA 2BUOA 2B88A 1ZMEC 2JGPA 1NTZG 3H1HD 3L73D 2P9XA 3QH9A 1L0HA 4U7JA 1FZEA 4U0FA 4AYCA 4RESB 2JYGA 1KILD 3PJSK 1QRJA 4WB4A 3M9QA 3TGUE 4WY4B 1RF1C 3RBXA 5KJ7C 3CLQA 3H47A 3GJNA 4H13B 1HBWA 1T8ZA 1OXZA 2PFXA 1Q86Q 1K8AQ 3MIWA 5AW0B 1S4XA 2L4BA 3M0DA 4YXWH 1NKZB 2O1JA 4XFZA 4K3AA 2PEQA 4IFMA 1KYOI 1VQKP 2HYNA 4H0LB 1OIPA 2PEJA 1M56D 4H44D 4IL6H 2PEMA 4HH2A 2IBZG 1NTZJ 4PV1D 3RG6C 2FYUE 2AXTH 2J58A 5AVRB 3TSIA 3BVHA 2VLNA 3AE7C 1NTMG 1FDMA 4PH0A 4PD4E 3L74G 2V7QH 2LXCB 1L0NG 2LKIA 1A43A 1KQGB 3E7KA 4WY4D 5HV8A 1KB9E 3BCCG 4BRYB 2KK7A 4CPGA 2LOLA 2QG4A 1IFIA 2DNWA 5KLVD 5BU5A 3FGAD 1SQPE 4UB8E 2K93A 4YXDC 1SFCC 4DJGA 2KS1B 3M9HA 1SQQK 5AVZB 3TYYA 1J1DB 3KXDA 1QVGO 1HJ0A 1DX7A 3RK3B 1Q7YQ 1SQPD 3DS5A 3DS1A 3IFMA 1IMQA 1FOSF 4OWFA 4KT0J 4IL6E 3L74E 2GM4A 4MN4C 1LWUA 2E75D 2LF4A 1LP1A 2QJKB 2ZT9C 3L71E 2WPRA 4NEOA 3H4EA 3GLMA 1LT1A 2HODA 2M5RA 1N2DC 1SFCA 1DEEG 3USSA 3H1JG 1PV3A 2A45I 2MVVA 1ZXGA 4R0MA 3KYQA 1X79B 3H1JD 1EZVI 3PTZA 1OVUA 1E79H 2KIKA 1Q82Q 3V2NA 2GZJA 3I56P 3CXHE 4PH1A 3R4YA 4GKGA 3RK2B 4QKOA 3MP7B 2FADA 2EIAA 5I4TG 3H1IJ 2HODB 2P58A 2ZYAA 5CCGA 2WSSH 3FX0A 1MZ9A 3FXEA 2K1AA 3CE7A 4XE5B 1HY8A 3HZQA 5KAIE 2KYVA 3CCVP 3VP8A 5KJ7A 1A02J 1JY2P 1M90Q 2JAZA 3VN0A 2OTKE 1KLPA 4UB6H 1KB9H 3H1LJ 5AW9B 1NTZE 1U57A 2AEJA 2L0QA 1VQNP 3L72J 3RL0C 4PV1C 5AVYB 1CSBA 2EFJA 1GDTA 1IJDB 3G0VA 3H1JE 3AEEC 5BU8B 4I7ZC 2J59M 2LR2A 2JR8A 2P10A 2QJYC 2Q3EA 2FFDA 1J1EC 3KQGA 1FZGA 4UB6E 3GHGC 2FYZA 2BEQD 3CL3D 1H89A 1SQVK 1FJPA 2M5AA 1ZMBA 2R44A 2ZYDA 2QVAA 1FAVA 4K35A 3G3ZA 5GTIE 4H13C 2ZXXA 4L75A 2GZEA 3G6EP 3G26A 3CWBD 1L0NE 1LWUC 1NTZK 1NVOA 2IYOA 2NPSA 3N7NA 3KPEA 4NPEA 2R3CA 1EXIA 1FZBA 5AVTB 3KZIH 1Z6MA 1AQTA 2FACA 2IBZE 3BCCD 1W2EA 1NTKG 2Z44A 1BCCE 1MZ8A 5AW4B 1G1JA 2JQ4A 2XZ1C 1RQUA 1KFMA 2E5YA 1JNMA 3VTPC 2N6YA 1RF1B 3O6QB 3R2PA 5EJDA 2W8ZA 2FKWB 5B66E 1JCDA 4U0DA 4BXLA 5CCHA 2VLQA 3U1AA 4GODA 2IZ1A 2GZIA 1BGYE 4ASVA 3L73J 5KAFH 3U1CA 2JYLA 4C46A 4OGQC 3WUTA 3F5HA 3U59A 4QNBA 4BPFA 5CHXA 3JC22 2E74B 2QJPC 2K3RA 1IFNA 2IBZI 2P1JA 5KKZC 3O8ZA 3PH0A 3HE5A 3MZWB 2L9FA 2D2CB 3GKLC 4KHXA 1IK7A 4ASWA 1GL2D 1DV5A 1FBMA 1P84E 2DW3A 2JU2A 3H0DA 3D6YA 4M3LA 2XV6A 1VL2A 3FXDA 1NAYA 3EJDA 3WUUA 2H7HA 1BXIA 3G1IA 2N50A 1NU1K 2QJKC 2ZT9B 1VQOP 3P7KA 3II6A 5KP6B 2YMKA 5CJ4A 3CXCO 3D70A 2A45G 1UNKA 1GL2A 1PGQA 4W80A 4GR6A 1LTTC 5F2OA 2P2UA 3EFGA 3V4WA 1P84D 2B87B 3CC2P 2PAJA 1EDJA 1AF8A 1L4AC 2VLPA 5JPAA 1FJKA 1RF0A 1PP9J 5AVVB 4DZOA 1M74A 2YKQA 2JWDA 2FFDC 3TDKA 4O9BA 3L71J 2W27A 2BCCD 2V7QJ 2FYNB 4TLFA 1SQVG 1SQBJ 3L72G 2N1TC 3OA7A 4BPGA 2KR5A 2XZ0D 2O3JA 1PP9D 3C8VA 3E1RA 4DOJA 1BE3E 1GL2C 5M1BA 5AW5B 1YITP 3B5NB 1YTZI 3NXSA 1KQSO 1D7MA 1JTHB 1RO0A 2WPSA 3CD6P 3CCUP 3BRTB 2A06E 4HJGH 3G71P 5CZDB 1T6AA 2KGDA 2FY8A 2N1TB 1M1JC 1AV1A 1UIXA 2P67A 2A45H 3RK2D 1EMVA 2LPKA 1PPJE 1KYOD 2I1KA 2IYPA 4XFXA 1LT9B 1SQVJ 1XTCC 2KNCB 2WSEH 2YMYA 1JB0J 1JY3O 1NU1J 2KODA 2CG5B 2QJYB 1N7SD 3DTJA 1GXHA 2R3SA 5KLVG 3H32B 1KN7A 1NKNA 2YIUC 1K04A 2MR8A 2M8PA 2GDWA 4GT1A 1IC2A 1S3JA 1URQD 3L75J 3S1KA 2JB0A 2Y9ZA 1SFCD 2PEKA 1N73C 3VMXA 1PIXA 1BSNA 3TGUJ 3AE3C 5BS1A 1NU1E 2XNDH 1QEXA 2K0YA 1L2PA 1SQXD 4F37A 5APYA 2FFDB 3AE2C 2N98A 2VSQA 2OYHB 2V4HA 2KLUA 1OR5A 1AYIA 1JMBA 1KYOH 7CEIA 1IFJA 2FVAA 1VDFA 3M0AA 2KLVA 1H0TA 1ZV8A 2C0XA 3B4SA 3PP5A 5B5EH 2M8LA 2WVRA 1VQMP 1SQVD 3SWFA 3MHVA 4W7YA 1PEMA 5KAIH 1SQPK 5BS2A 5CMZA 5AW1B 1G2CB 3G28A 1OMIA 4XFYA 4U3FJ 1T2KD 5C39A 3CPWO 4HKGA 2GUVA 3H1JJ 1AVOA 4XFJA 1USEA 2FXMA 1KB9I 3CMEP 4ZMDA 3L36A 2AFDA 2KWLA 1SQBE 3CX5I 4BRYA 2JJLA 1NTKE 1S9KE 1HF9A 1QL2A 1NU1D 2WPTA 1JO5A 3C9IA 1KFNA 4WWIA 1LT9C 2IBZD 1OWAA 2W6AA 1RE3C 5F2NA 3CWBJ 3M9BA 3VP9A 2YKOA 4LGDE 4HKZH 2KS1A 2WITA 2MVUA 5CJ0A 1PZQA 1FZAA 1LTSC 2FYUJ 1E6JP 4OGQD 3L71D 1DD3A 3CX5D 1OW6A 1VF5B 1MFZA 4R4LA 4UB8H 2ZFCA 3L72D 3VMZA 2PRRA 2CQ8A 2KUBA 3L75E 3TNUA 3H1HJ 4I7ZB 2L5GB 1LTAC 1LTJB 1KC8Q 1SQBD 2WSFH 2HPCA 2L6EA 2AEFA 2R5DA 1FZCC 1FDIA 3TGUD 2FYNC 2W6JH 1PL5A 3VMAA 3MD0A 2AVAA 4D6TE 2FAEA 3U43A 3AEAC 1X0TA 3H1LE 2ZT9D 4WVZA 1NWQA 1QLED 2E75B 2C9NY 3EJBA 1JY3N 2G3AA 4ZNCA 2WT7A 2Q9IA 1BDDA 1GW4A 1PGJA 4EI2A 1EDKA 1ZRTE 4U0CA 3OAKA 2K94A 3AE9C 3H6PA 1XTGB 3H1IE 1VF5D 5AVWB 3RK3D 5GTHH 2KXPB 2GDXA 3GHGB 4LLHA 2W6BA 4COCA 1M1KQ 1EOQA 1OVRA 1K73Q 1X22A 1W2BO 2OQQA 1SQQD 4COPA 3HYBA 2KG8A 1JOCA 3HUSB 2WT7B 1SQQG 5APQA 4H2WC 4D6TJ 2Q1KA 5H2FH 3FWNA 3L37A 1TU3F 2PY8A 1P84H 2RN0A 1FU1A 2QIWA 3GHGA 1LTIC 2OTJP 3P8CE 3SFEC 1Y47A 2GZGA 1PP9E 4C7NB 2WSCJ 1SQXJ 1ZW0A 4EIJA 2N9YB 1FE6A 3GZMA 1EIAA 5APSA 2ONTA 1RH5B 2JEEA 2WPVB 2A06D 3AEBC 2OYOA 3L70G 2AEMA 3T97B 3Q5RA 1KQLA 1VQ6P 3IN6A 2KP8A 5APWA 1F80D 2KG9A 2E76B 1YIJP 1VQ4P 3H1LG 1HH0A 1VQ8P 1SQQJ 1Z56A 3KZIE 5AW6B 4GIFA 1HGVA 2R32A 1KD1Q 3M06A 4PV1B 2K9JB 4PD4H 1J1DC 4U3FD 1OZHA 1KILA 2O01N 4GOEA 1LTJC 1HWTC 2K5XA 2NPSB 2X2BA 3L73G 4N78E 5B66H 2WSFJ 3L75G 2N5HA 4RKUJ 4XRQA 2OGUA 1URQB 3P05A 3V2RA 4CA3A 2HR3A 1HGZA 4R4MA 1BE3J 1LTGC 3H1KJ 1MV8A 3H1HE 2RKLA 2W90A 1VQ5P 2ZYGA 4U3FE 2N1TD 1WT6A 1ZOYC 1KILB 3CCJP 3CX5E 1OW8A 4PD4I 2JP3A 3SWYA 3DS0A 3GW6A 2J5UA 3Q1MA 2K88A 5EFWB 2WSEJ 2CPSA 2PEOA 3RGUA 2QSIA 4HB1A 2N5IA 1NTMK 3LMOA 2KW2A 2YO3A 3LIEA 3A0BH 3LW5J 1SQBG 2PGDA 4YPCA 1N7LA 2WWWA 5AVQB 3WUVA 3CCSP 1OFCX 1DEBA 3V5BA 3GG2A 2K0XA 4Y28J 1X3OA 3AE8C 1L4AD 3HTKA 3L35A 1CZQA 3HE4A 3L75D 3L74J 1AVYA 2E42A 3V4QA 1ZR2A 3BASA 1PGPA 3MUDA 1N73A 1N7SB 2H8PD 5KKZB 1IO4A 3VYIA 1G1IA 5HGOA 5TJHA 2C0WA 3H1KG 2KSJA 3B5NC 1L0LJ 1L0NJ 1M57D 1PFIA 3IF4A 5HGLA 2YXQB 4M0IA 1SVFA 4WY4C 1HJBA 5AW7B 4OVNF 3CCMP 2K2QA 2KOSA 5APTA 1NTKK 3RG2A 1PEUA 3AEFC 1FOSE 1N73B 1FZCA 1NGMB 3HUSC 2WQYC 3VOPA 3S4RA 2EHTA 1T3UA 3I55P 1VQ9P 1PPJD 3HD7D 3OW2O 2XKMA 1SQXE 1LTJA 1Q90D 4WY4A 2ROQA 3M91A 4QMAA 3L70J 4JYCA 3B8EB 3B5NA 1VKUA 3EFFK 2IX7C 3Q3DA 2BCCE 2Y0CA 2N6ZA 1JJ2O 2K9YA 3RK3C 1ZNVA 1JM0A 2MY5A 2L91A 3KHUA 4IZ6A 1AA0A 3H1KD 3HRNA 1OX3A 2A06G 1RE4C 2AXCA 2FVFA 3CXHI 2LIUA 5AW3B 3WU2H 2IPPA 1RNIA 4TT3H 5KLIC 1LGHB 2YNYA 1H8AA 3B5IA 4H44B 3UIAA 1EQ7A 1HQBA 2POHA 2KOQA 1LTBC 1T8KA 4JYBA 4DT0A 5CCHD 4JBZA 2Q5UA 4U0BA 3K5BA 1ZR4A 3W67A 4JPZB 1BE3G 1J2JB 1YYCA 2CNRA 2IFMA 2NPSD 1KQFB 2KOGA 1URQC 1GW3A 1RE4A 1X8YA 3WMM0 4EYYQ 3NFQA 2DGYA 2Y0DA 2XXMA 3NMDA 1BDCA 3A7OA 3BCCJ 1WRGA 1GPJA 4XA4A 4BWNA 1IFDA 2E76D 2ZAEB 2WPQA 3G1GA 1EXJA 1NH4A 1VQPP 1VQ7P 2FXPA 3EQ2A 1GXGA 3CMAP 2GDYA 3NTNA 1GK6A 4D6TD 1LP1B 1BGYD 2KZJA 4I1LA 2AFEA 5CCGD 1JCCA 5E79H 4IOIH 2CPBA 2IFNA 2PP6A 2Y0EA 3CX5H 2M5AB 3VMYA 3ABVC 2RH0A 1EDIA 1S2EA 3SWKA 1KMIZ 3A3YB 2H88C 1KB9D 2OYHC 1N8RQ 3CC7P 3MGNA 1M6EX 3NY7B 4C7RA 3ZDMA 2FBWC 4EOTA 1W5CE 1BCCD 1LNQA 5K5GB 2KOOA 1QX8A 3PLNA 3A0HE 2E74C 2OARA 4PWVB 3JCUH 2MR7A 2CWOA 2JO0A 1KILE 2ZXEB 1IUQA 4H2XC 1YJWP 1PPJG 5CCGC 3TNUB 1BCCJ 2H43A 1NO4A 1HVVA 1FR2A 2Z46A 5GTIH 1RF1A 1KV4A 5EW5E 3RL0D 3TF5A 1HTLC 1YHQP 2KGEA 3P8CD 3HD7B 3F89A 3CWBG 3A0HH 1L4AB 2KZIA 4JF7A 2KB7P 3JCUE 3HE4B 1PEOA 2QA4P 3ITKA 1JUNA 1NTMJ 1T2KC 3H1LD 5CCHC 2E5TA 2E43A 2EHSA 2QM8A 1N7SA 5GTHE 1RQVA 3G4SP 3HE5B 2Z4EA 4ZKPA 2UWJE 2XV5A 4XROA 3AECC 3IR9A 3GF7A 2K0DX 4PD4D 1L4AA 3H25A 3H1ID 3LW5H 1AQ5A 3MTUE 5AVUB 2BQ1E 1AJYA 2D2CC 3BATA 5KP8B 2E74D 1IFMA 2R5BA 2ERHA 1R5LA 2BASA 3L70E 2IDBA 1Y8AA 2QJPB 1FZCB 3H1KE 1BGYJ 3A5TA 1ACPA 2PNGA 5KTBA 5KAFE 1GL2B 2M3EA 4N3YB 1L0LK 1L0NK 3P8MC 1RE3A 1PP9G 2KORA 2B87A 2I1JA 4NPDA 3AE1C 3N4XA 4PJ0E 2YIUB 3PHLA 2OYIA 1UJZA 1M6NA 5HVCA 4RO0A 1FZFA 4RJTA 4L76A 3CCQP 2K37A 2FYUK 1BGYG 4AQRD 3Q5SA 2GUSA 1DD4A 1USDA 1N86A 3I5CA 2OYIB 1K05A 1EZVD 1JTHA 1M8OB 2G8YA 3L71G 3G29A 4Z1MH 2M8RA 1VQLP 3AEDC 4GDOA 1SLQA 1N7SC 3HD7C 2YXRB 2N1TA 3S9OA 1YQ4C 1PGOA 2IZ0A 3H1HG 4PXHB 2WSCH 3B5ND 4MRTC 4L74A 1LT9A 4IFFA 3L70D 5CBNA 1GU4A 1CI6A 3EJEA 2YKPA 1BAJA 2CGQA 2FXOA 2ZVOB 1HUCA 2JO1A 3E1IA 4YTPC 2FQ2A 2KI7B 2KSEA 1ZN5A 4GOFA 4U3FG 1EC5A 3H32A 1SQPG 2LMLA 4H44C 1VHNA 4GR2A 2E1MA 1IK9A 1CI6B 1YTZT 2FHSC 1Q81Q 3L73E 4L73A 1QGKB 4H2YC 2LXBA 5E79E 5APUA 2JBGA 2I8DA 1KILC 1T3JA 3D71A 1RY3A 5HGMA 2QRXA 1FC2C 1S5LE 2HLOA 4OGQB 2XT1A 2WMMA 5BVZA 3GZLA 1NTMD 1JY2O 3Q2YA 2OYHA 3G9RA 3A0BE 2Z5HA 3CCEP 2GZFA 3BCCE 2XNXA 2K92A 3NTEA 3CC4P 4BPHA 5H2FE 1L0LD 1SQQE 1NTME 1IFPA 1SQBK 3CCLP 1OW7A 4N6JA 3V2QA 4I6MC 2KNCA 3AEGC 1MUUA 1SQXK 2OTLP 1SFCB 1MFTA 1X9VA 4IPYA 2AF8A 2VRSA 2KG6A 4WBAA 1CW5A 1GZLA 2M3BA 1KYOE 1FDOA 3H1IG 2JU1A 3L74D 3CI9A 3PRJA 3DS4A 2KGCA 1GU5A 2KOPA 1NQ4A 3RBZA 1DIPA 1JY2N 1D1DA 2NPSC 1NTKJ 5KLVK 1Y9BA 3HD7A 1AFOA 5APXA 3TGUG 5F2KA 2M0BA 1NYHA 2LL8A 2AXTE 3B4QA 3KDPB 4ZKUA 3FWLA 1CEIA 2Z5IA 1NJIQ 4Y99B 5AVSB 1FS0E 2BCCJ 1L0IA 1GD2E 1A8OA 1U7JA 2HFED 1E5WA 1EZVE 1H0TB 4D6TG 4H0LC 3VRLC 2QNWA 2XDJA 2SPZA 1G2CA 2FQ0A 1L0ND 4A7PA 2H89C 1MKMA 2FQ1A 3RK3E 2C9LY 1R8EA 1NHLA 3LRYA 4AUWA 2GYKA 4NPFX 4H0LD 2OYIC 3WU2E 1P84I 1NAFA 1JMMA 1VF5C 3A2AA 5AW8B 5DJUB 2E76C 3LIDA 2LKMA 1GTWA 3CWBE 2P7JA 3G21A 1AUMA 2LTEA 2Q3IA 5L8RJ 2O01J 5KLIB 2LIWA 1RO2A 5HGNA 3OJAB 1JEKA 2MJZA 3L72E 1QVFO 3M0DC 2QEXP 2PEIA 4WYMA 1ZP0C 2FYUG 2ZVNB 3HUSA 2NRGA 3WBHA 3TK1A 4IL6X 1LJ2A 3CXHD 4H13D 4UHPB 4W7ZA 4Y99C 1S9KD 2QM7A 4DG9A 2MKVA 3CXHH 3O6QA 1M1JB 2MF4A 4OH8B 2HPCB 1K30A 3W68A 4KJMA 3B71A 2JKVA 2L22A 3BRVB 1NU1G 2XU6A 1SP4A 2Q7CA 1H88A 4IFDK 1IMPA 1YQ3C 2HG5D 1BSHA 1JY3P 4N78D 2NZ2A 3JSVC 4PJ0H 1KZUB 1NTKD 3SSUA 3L4FA 2NO8A 3V6IA 1LWUB 2GA1A 1M1JA 2O1KA 1YJNP 5AW2B 5TISE 3AE5C 3GF3A 1PEQA 2JWAA 2M8NA 2ZJSE 3E2DA
chains in the Genus database with same CATH topology
2OTLP 3CCSP 3HZQA 1EIAA 3CCVP 4XROA 2ONTA 4IPYA 1M90Q 3DS3A 1KC8Q 3G21A 1AUMA 3DPHA 1VQ6P 2BHVA 3DS2A 2BQ1E 2L6EA 1RO2A 5HGNA 5DCKA 2BUOA 1YIJP 4U0DA 1VQ4P 1VQNP 1BAJA 1VQ8P 3DS4A 1K9MQ 3Q20A 1RNIA 1YJ9P 1N8RQ 3CC7P 1QVFO 2EFJA 1QVGO 2P9XA 1M6EX 2QEXP 2PEIA 1KD1Q 4WYMA 1YITP 4U0FA 3B5IA 3G0VA 3MGEA 2M8LA 1KQSO 1JJ2O 2JYGA 1RO0A 2JYLA 1VQMP 1S72P 3CD6P 1D1DA 3CCUP 1Q7YQ 1PEMA 1QRJA 3WBHA 4QNBA 3DS5A 5BS2A 3DS1A 5HGOA 3G71P 2Z45A 3CCRP 3H47A 3G28A 4XFYA 5F2KA 3CPWO 4GR2A 2E1MA 5HGLA 4U0CA 4M0IA 1Q86Q 1K8AQ 4U0BA 2OARA 4XRQA 3CCMP 1Q81Q 3CMEP 3P05A 2CWOA 2JO0A 1NJIQ 1IUQA 2EG5A 4XFXA 1YJWP 2LF4A 3H0DA 1M6NA 2XV6A 1PEUA 4XFZA 1K30A 2PEQA 3H4EA 1ZMBA 1VQKP 5HGMA 4U0AA 1VQ5P 2XT1A 2Z46A 4COCA 1A8OA 1EOQA 3G1IA 1M1KQ 2PEJA 1K73Q 2DGYA 2PEMA 1VQOP 2XXMA 2KODA 3CCJP 1W2BO 1YHQP 4COPA 5F2NA 3HYBA 3G26A 3G6EP 3CCQP 3VRLC 3DTJA 3I55P 1VQ9P 3RG6C 3CXCO 4U0EA 3OW2O 1Q82Q 3DS0A 4GR6A 3CCEP 1E6JP 3I56P 3G1GA 5F2OA 4PH1A 2M8PA 3NTEA 1PEOA 2PY8A 2QA4P 3CC4P 2PEOA 3CC2P 4PH0A 1YJNP 2PEKA 5JPAA 2EIAA 5I4TG 1VQPP 1VQ7P 3G29A 2PENA 2OTJP 1A43A 3M1MA 3CMAP 3CCLP 1M74A 1YI2P 1VQLP 3LRYA 1PEQA 2M8NA 5BS1A 3E2DA 3G4SP 2Z44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 Q;  2OTL P;  3CCS P;  1YIT P;  1NJI Q;  3CCE P;  1YJW P;  3CCV P;  1KQS O;  3I56 P;  1VQM P;  1M90 Q;  1S72 P;  3CD6 P;  3CCU P;  1Q7Y Q;  1VQK P;  2QA4 P;  3CC4 P;  3CC2 P;  1KC8 Q;  3G71 P;  1VQ5 P;  1M1K Q;  1YJN P;  3CCR P;  1VQ6 P;  1VQP P;  1K73 Q;  1VQ7 P;  3CPW O;  1VQO P;  2OTJ P;  1YIJ P;  3CMA P;  3CCJ P;  1W2B O;  1VQ4 P;  1YHQ P;  1VQ8 P;  3CCL P;  1YI2 P;  1VQN P;  1VQL P;  3G6E P;  3CCQ P;  1K9M Q;  1Q86 Q;  1K8A Q;  3I55 P;  3CCM P;  1Q81 Q;  1YJ9 P;  3OW2 O;  3CXC O;  1Q82 Q;  1N8R Q;  1VQ9 P;  3CME P;  1QVG O;  3CC7 P;  3G4S P;  1JJ2 O;  1QVF O;  2QEX P; 
#chains in the Genus database with same CATH topology
 1NTZ D;  5DJT B;  1GK4 A;  3DS3 A;  1WMK A;  1L0L E;  3DPH A;  5CBO A;  1R5S A;  1J1E B;  1IZN B;  5APV A;  5KLV E;  5B5E E;  2VLO A;  1K9M Q;  5TIS H;  3Q20 A;  1YJ9 P;  2B89 A;  1M7L A;  3RL0 B;  3AE6 C;  3MGE A;  3V2P A;  1S72 P;  1ZRT D;  1DH3 A;  1EDL A;  2N9B A;  1SQP J;  5KLV J;  4LC1 A;  1BCC G;  2Z45 A;  1YBK A;  1KOR A;  3CCR P;  4JQ0 D;  4C7N A;  4I2L C;  2Q6Q A;  3C1L A;  1S5L H;  1GMJ A;  2D2C D;  2QE7 H;  2O01 H;  2FYU D;  2XZR A;  1U7M A;  1SQV E;  3T97 A;  2WTY A;  2EG5 A;  3EWK A;  2KGA A;  1BE3 D;  2BEZ F;  3D6Z A;  4U0A A;  4DCK A;  2MD9 A;  2FVE A;  1S5L X;  3Q5P A;  2Y9Y A;  3P32 A;  2RMZ A;  3GMA A;  1RHZ B;  2CK3 H;  2ITA A;  3HTK B;  2K9J A;  3RK2 C;  4U0E A;  4EDF A;  3MUD C;  1VPC A;  1SS1 A;  2YO2 A;  3IAO A;  1A02 F;  1Q2N A;  5AVX B;  2B9B A;  2W83 C;  2BCC G;  3QWO C;  2PEN A;  1UII A;  1URQ A;  3M1M A;  1YI2 P;  1L0L G;  1E0H A;  1QL1 A;  1KTM A;  1ZLL A;  2WZ7 A;  3SFD C;  1RF0 C;  2E75 C;  2JDI H;  1S1C X;  1OVV A;  1EZV G;  1NOH A;  1DNY A;  1SQX G;  5KP7 B;  3RL0 g;  3AE4 C;  5KJ7 D;  4B86 A;  2BHV A;  3DS2 A;  4HYT B;  5DCK A;  2BUO A;  2B88 A;  1ZME C;  2JGP A;  1NTZ G;  3H1H D;  3L73 D;  2P9X A;  3QH9 A;  1L0H A;  4U7J A;  1FZE A;  4U0F A;  4AYC A;  4RES B;  2JYG A;  1KIL D;  3PJS K;  1QRJ A;  4WB4 A;  3M9Q A;  3TGU E;  4WY4 B;  1RF1 C;  3RBX A;  5KJ7 C;  3CLQ A;  3H47 A;  3GJN A;  4H13 B;  1HBW A;  1T8Z A;  1OXZ A;  2PFX A;  1Q86 Q;  1K8A Q;  3MIW A;  5AW0 B;  1S4X A;  2L4B A;  3M0D A;  4YXW H;  1NKZ B;  2O1J A;  4XFZ A;  4K3A A;  2PEQ A;  4IFM A;  1KYO I;  1VQK P;  2HYN A;  4H0L B;  1OIP A;  2PEJ A;  1M56 D;  4H44 D;  4IL6 H;  2PEM A;  4HH2 A;  2IBZ G;  1NTZ J;  4PV1 D;  3RG6 C;  2FYU E;  2AXT H;  2J58 A;  5AVR B;  3TSI A;  3BVH A;  2VLN A;  3AE7 C;  1NTM G;  1FDM A;  4PH0 A;  4PD4 E;  3L74 G;  2V7Q H;  2LXC B;  1L0N G;  2LKI A;  1A43 A;  1KQG B;  3E7K A;  4WY4 D;  5HV8 A;  1KB9 E;  3BCC G;  4BRY B;  2KK7 A;  4CPG A;  2LOL A;  2QG4 A;  1IFI A;  2DNW A;  5KLV D;  5BU5 A;  3FGA D;  1SQP E;  4UB8 E;  2K93 A;  4YXD C;  1SFC C;  4DJG A;  2KS1 B;  3M9H A;  1SQQ K;  5AVZ B;  3TYY A;  1J1D B;  3KXD A;  1QVG O;  1HJ0 A;  1DX7 A;  3RK3 B;  1Q7Y Q;  1SQP D;  3DS5 A;  3DS1 A;  3IFM A;  1IMQ A;  1FOS F;  4OWF A;  4KT0 J;  4IL6 E;  3L74 E;  2GM4 A;  4MN4 C;  1LWU A;  2E75 D;  2LF4 A;  1LP1 A;  2QJK B;  2ZT9 C;  3L71 E;  2WPR A;  4NEO A;  3H4E A;  3GLM A;  1LT1 A;  2HOD A;  2M5R A;  1N2D C;  1SFC A;  1DEE G;  3USS A;  3H1J G;  1PV3 A;  2A45 I;  2MVV A;  1ZXG A;  4R0M A;  3KYQ A;  1X79 B;  3H1J D;  1EZV I;  3PTZ A;  1OVU A;  1E79 H;  2KIK A;  1Q82 Q;  3V2N A;  2GZJ A;  3I56 P;  3CXH E;  4PH1 A;  3R4Y A;  4GKG A;  3RK2 B;  4QKO A;  3MP7 B;  2FAD A;  2EIA A;  5I4T G;  3H1I J;  2HOD B;  2P58 A;  2ZYA A;  5CCG A;  2WSS H;  3FX0 A;  1MZ9 A;  3FXE A;  2K1A A;  3CE7 A;  4XE5 B;  1HY8 A;  3HZQ A;  5KAI E;  2KYV A;  3CCV P;  3VP8 A;  5KJ7 A;  1A02 J;  1JY2 P;  1M90 Q;  2JAZ A;  3VN0 A;  2OTK E;  1KLP A;  4UB6 H;  1KB9 H;  3H1L J;  5AW9 B;  1NTZ E;  1U57 A;  2AEJ A;  2L0Q A;  1VQN P;  3L72 J;  3RL0 C;  4PV1 C;  5AVY B;  1CSB A;  2EFJ A;  1GDT A;  1IJD B;  3G0V A;  3H1J E;  3AEE C;  5BU8 B;  4I7Z C;  2J59 M;  2LR2 A;  2JR8 A;  2P10 A;  2QJY C;  2Q3E A;  2FFD A;  1J1E C;  3KQG A;  1FZG A;  4UB6 E;  3GHG C;  2FYZ A;  2BEQ D;  3CL3 D;  1H89 A;  1SQV K;  1FJP A;  2M5A A;  1ZMB A;  2R44 A;  2ZYD A;  2QVA A;  1FAV A;  4K35 A;  3G3Z A;  5GTI E;  4H13 C;  2ZXX A;  4L75 A;  2GZE A;  3G6E P;  3G26 A;  3CWB D;  1L0N E;  1LWU C;  1NTZ K;  1NVO A;  2IYO A;  2NPS A;  3N7N A;  3KPE A;  4NPE A;  2R3C A;  1EXI A;  1FZB A;  5AVT B;  3KZI H;  1Z6M A;  1AQT A;  2FAC A;  2IBZ E;  3BCC D;  1W2E A;  1NTK G;  2Z44 A;  1BCC E;  1MZ8 A;  5AW4 B;  1G1J A;  2JQ4 A;  2XZ1 C;  1RQU A;  1KFM A;  2E5Y A;  1JNM A;  3VTP C;  2N6Y A;  1RF1 B;  3O6Q B;  3R2P A;  5EJD A;  2W8Z A;  2FKW B;  5B66 E;  1JCD A;  4U0D A;  4BXL A;  5CCH A;  2VLQ A;  3U1A A;  4GOD A;  2IZ1 A;  2GZI A;  1BGY E;  4ASV A;  3L73 J;  5KAF H;  3U1C A;  2JYL A;  4C46 A;  4OGQ C;  3WUT A;  3F5H A;  3U59 A;  4QNB A;  4BPF A;  5CHX A;  3JC2 2;  2E74 B;  2QJP C;  2K3R A;  1IFN A;  2IBZ I;  2P1J A;  5KKZ C;  3O8Z A;  3PH0 A;  3HE5 A;  3MZW B;  2L9F A;  2D2C B;  3GKL C;  4KHX A;  1IK7 A;  4ASW A;  1GL2 D;  1DV5 A;  1FBM A;  1P84 E;  2DW3 A;  2JU2 A;  3H0D A;  3D6Y A;  4M3L A;  2XV6 A;  1VL2 A;  3FXD A;  1NAY A;  3EJD A;  3WUU A;  2H7H A;  1BXI A;  3G1I A;  2N50 A;  1NU1 K;  2QJK C;  2ZT9 B;  1VQO P;  3P7K A;  3II6 A;  5KP6 B;  2YMK A;  5CJ4 A;  3CXC O;  3D70 A;  2A45 G;  1UNK A;  1GL2 A;  1PGQ A;  4W80 A;  4GR6 A;  1LTT C;  5F2O A;  2P2U A;  3EFG A;  3V4W A;  1P84 D;  2B87 B;  3CC2 P;  2PAJ A;  1EDJ A;  1AF8 A;  1L4A C;  2VLP A;  5JPA A;  1FJK A;  1RF0 A;  1PP9 J;  5AVV B;  4DZO A;  1M74 A;  2YKQ A;  2JWD A;  2FFD C;  3TDK A;  4O9B A;  3L71 J;  2W27 A;  2BCC D;  2V7Q J;  2FYN B;  4TLF A;  1SQV G;  1SQB J;  3L72 G;  2N1T C;  3OA7 A;  4BPG A;  2KR5 A;  2XZ0 D;  2O3J A;  1PP9 D;  3C8V A;  3E1R A;  4DOJ A;  1BE3 E;  1GL2 C;  5M1B A;  5AW5 B;  1YIT P;  3B5N B;  1YTZ I;  3NXS A;  1KQS O;  1D7M A;  1JTH B;  1RO0 A;  2WPS A;  3CD6 P;  3CCU P;  3BRT B;  2A06 E;  4HJG H;  3G71 P;  5CZD B;  1T6A A;  2KGD A;  2FY8 A;  2N1T B;  1M1J C;  1AV1 A;  1UIX A;  2P67 A;  2A45 H;  3RK2 D;  1EMV A;  2LPK A;  1PPJ E;  1KYO D;  2I1K A;  2IYP A;  4XFX A;  1LT9 B;  1SQV J;  1XTC C;  2KNC B;  2WSE H;  2YMY A;  1JB0 J;  1JY3 O;  1NU1 J;  2KOD A;  2CG5 B;  2QJY B;  1N7S D;  3DTJ A;  1GXH A;  2R3S A;  5KLV G;  3H32 B;  1KN7 A;  1NKN A;  2YIU C;  1K04 A;  2MR8 A;  2M8P A;  2GDW A;  4GT1 A;  1IC2 A;  1S3J A;  1URQ D;  3L75 J;  3S1K A;  2JB0 A;  2Y9Z A;  1SFC D;  2PEK A;  1N73 C;  3VMX A;  1PIX A;  1BSN A;  3TGU J;  3AE3 C;  5BS1 A;  1NU1 E;  2XND H;  1QEX A;  2K0Y A;  1L2P A;  1SQX D;  4F37 A;  5APY A;  2FFD B;  3AE2 C;  2N98 A;  2VSQ A;  2OYH B;  2V4H A;  2KLU A;  1OR5 A;  1AYI A;  1JMB A;  1KYO H;  7CEI A;  1IFJ A;  2FVA A;  1VDF A;  3M0A A;  2KLV A;  1H0T A;  1ZV8 A;  2C0X A;  3B4S A;  3PP5 A;  5B5E H;  2M8L A;  2WVR A;  1VQM P;  1SQV D;  3SWF A;  3MHV A;  4W7Y A;  1PEM A;  5KAI H;  1SQP K;  5BS2 A;  5CMZ A;  5AW1 B;  1G2C B;  3G28 A;  1OMI A;  4XFY A;  4U3F J;  1T2K D;  5C39 A;  3CPW O;  4HKG A;  2GUV A;  3H1J J;  1AVO A;  4XFJ A;  1USE A;  2FXM A;  1KB9 I;  3CME P;  4ZMD A;  3L36 A;  2AFD A;  2KWL A;  1SQB E;  3CX5 I;  4BRY A;  2JJL A;  1NTK E;  1S9K E;  1HF9 A;  1QL2 A;  1NU1 D;  2WPT A;  1JO5 A;  3C9I A;  1KFN A;  4WWI A;  1LT9 C;  2IBZ D;  1OWA A;  2W6A A;  1RE3 C;  5F2N A;  3CWB J;  3M9B A;  3VP9 A;  2YKO A;  4LGD E;  4HKZ H;  2KS1 A;  2WIT A;  2MVU A;  5CJ0 A;  1PZQ A;  1FZA A;  1LTS C;  2FYU J;  1E6J P;  4OGQ D;  3L71 D;  1DD3 A;  3CX5 D;  1OW6 A;  1VF5 B;  1MFZ A;  4R4L A;  4UB8 H;  2ZFC A;  3L72 D;  3VMZ A;  2PRR A;  2CQ8 A;  2KUB A;  3L75 E;  3TNU A;  3H1H J;  4I7Z B;  2L5G B;  1LTA C;  1LTJ B;  1KC8 Q;  1SQB D;  2WSF H;  2HPC A;  2L6E A;  2AEF A;  2R5D A;  1FZC C;  1FDI A;  3TGU D;  2FYN C;  2W6J H;  1PL5 A;  3VMA A;  3MD0 A;  2AVA A;  4D6T E;  2FAE A;  3U43 A;  3AEA C;  1X0T A;  3H1L E;  2ZT9 D;  4WVZ A;  1NWQ A;  1QLE D;  2E75 B;  2C9N Y;  3EJB A;  1JY3 N;  2G3A A;  4ZNC A;  2WT7 A;  2Q9I A;  1BDD A;  1GW4 A;  1PGJ A;  4EI2 A;  1EDK A;  1ZRT E;  4U0C A;  3OAK A;  2K94 A;  3AE9 C;  3H6P A;  1XTG B;  3H1I E;  1VF5 D;  5AVW B;  3RK3 D;  5GTH H;  2KXP B;  2GDX A;  3GHG B;  4LLH A;  2W6B A;  4COC A;  1M1K Q;  1EOQ A;  1OVR A;  1K73 Q;  1X22 A;  1W2B O;  2OQQ A;  1SQQ D;  4COP A;  3HYB A;  2KG8 A;  1JOC A;  3HUS B;  2WT7 B;  1SQQ G;  5APQ A;  4H2W C;  4D6T J;  2Q1K A;  5H2F H;  3FWN A;  3L37 A;  1TU3 F;  2PY8 A;  1P84 H;  2RN0 A;  1FU1 A;  2QIW A;  3GHG A;  1LTI C;  2OTJ P;  3P8C E;  3SFE C;  1Y47 A;  2GZG A;  1PP9 E;  4C7N B;  2WSC J;  1SQX J;  1ZW0 A;  4EIJ A;  2N9Y B;  1FE6 A;  3GZM A;  1EIA A;  5APS A;  2ONT A;  1RH5 B;  2JEE A;  2WPV B;  2A06 D;  3AEB C;  2OYO A;  3L70 G;  2AEM A;  3T97 B;  3Q5R A;  1KQL A;  1VQ6 P;  3IN6 A;  2KP8 A;  5APW A;  1F80 D;  2KG9 A;  2E76 B;  1YIJ P;  1VQ4 P;  3H1L G;  1HH0 A;  1VQ8 P;  1SQQ J;  1Z56 A;  3KZI E;  5AW6 B;  4GIF A;  1HGV A;  2R32 A;  1KD1 Q;  3M06 A;  4PV1 B;  2K9J B;  4PD4 H;  1J1D C;  4U3F D;  1OZH A;  1KIL A;  2O01 N;  4GOE A;  1LTJ C;  1HWT C;  2K5X A;  2NPS B;  2X2B A;  3L73 G;  4N78 E;  5B66 H;  2WSF J;  3L75 G;  2N5H A;  4RKU J;  4XRQ A;  2OGU A;  1URQ B;  3P05 A;  3V2R A;  4CA3 A;  2HR3 A;  1HGZ A;  4R4M A;  1BE3 J;  1LTG C;  3H1K J;  1MV8 A;  3H1H E;  2RKL A;  2W90 A;  1VQ5 P;  2ZYG A;  4U3F E;  2N1T D;  1WT6 A;  1ZOY C;  1KIL B;  3CCJ P;  3CX5 E;  1OW8 A;  4PD4 I;  2JP3 A;  3SWY A;  3DS0 A;  3GW6 A;  2J5U A;  3Q1M A;  2K88 A;  5EFW B;  2WSE J;  2CPS A;  2PEO A;  3RGU A;  2QSI A;  4HB1 A;  2N5I A;  1NTM K;  3LMO A;  2KW2 A;  2YO3 A;  3LIE A;  3A0B H;  3LW5 J;  1SQB G;  2PGD A;  4YPC A;  1N7L A;  2WWW A;  5AVQ B;  3WUV A;  3CCS P;  1OFC X;  1DEB A;  3V5B A;  3GG2 A;  2K0X A;  4Y28 J;  1X3O A;  3AE8 C;  1L4A D;  3HTK A;  3L35 A;  1CZQ A;  3HE4 A;  3L75 D;  3L74 J;  1AVY A;  2E42 A;  3V4Q A;  1ZR2 A;  3BAS A;  1PGP A;  3MUD A;  1N73 A;  1N7S B;  2H8P D;  5KKZ B;  1IO4 A;  3VYI A;  1G1I A;  5HGO A;  5TJH A;  2C0W A;  3H1K G;  2KSJ A;  3B5N C;  1L0L J;  1L0N J;  1M57 D;  1PFI A;  3IF4 A;  5HGL A;  2YXQ B;  4M0I A;  1SVF A;  4WY4 C;  1HJB A;  5AW7 B;  4OVN F;  3CCM P;  2K2Q A;  2KOS A;  5APT A;  1NTK K;  3RG2 A;  1PEU A;  3AEF C;  1FOS E;  1N73 B;  1FZC A;  1NGM B;  3HUS C;  2WQY C;  3VOP A;  3S4R A;  2EHT A;  1T3U A;  3I55 P;  1VQ9 P;  1PPJ D;  3HD7 D;  3OW2 O;  2XKM A;  1SQX E;  1LTJ A;  1Q90 D;  4WY4 A;  2ROQ A;  3M91 A;  4QMA A;  3L70 J;  4JYC A;  3B8E B;  3B5N A;  1VKU A;  3EFF K;  2IX7 C;  3Q3D A;  2BCC E;  2Y0C A;  2N6Z A;  1JJ2 O;  2K9Y A;  3RK3 C;  1ZNV A;  1JM0 A;  2MY5 A;  2L91 A;  3KHU A;  4IZ6 A;  1AA0 A;  3H1K D;  3HRN A;  1OX3 A;  2A06 G;  1RE4 C;  2AXC A;  2FVF A;  3CXH I;  2LIU A;  5AW3 B;  3WU2 H;  2IPP A;  1RNI A;  4TT3 H;  5KLI C;  1LGH B;  2YNY A;  1H8A A;  3B5I A;  4H44 B;  3UIA A;  1EQ7 A;  1HQB A;  2POH A;  2KOQ A;  1LTB C;  1T8K A;  4JYB A;  4DT0 A;  5CCH D;  4JBZ A;  2Q5U A;  4U0B A;  3K5B A;  1ZR4 A;  3W67 A;  4JPZ B;  1BE3 G;  1J2J B;  1YYC A;  2CNR A;  2IFM A;  2NPS D;  1KQF B;  2KOG A;  1URQ C;  1GW3 A;  1RE4 A;  1X8Y A;  3WMM 0;  4EYY Q;  3NFQ A;  2DGY A;  2Y0D A;  2XXM A;  3NMD A;  1BDC A;  3A7O A;  3BCC J;  1WRG A;  1GPJ A;  4XA4 A;  4BWN A;  1IFD A;  2E76 D;  2ZAE B;  2WPQ A;  3G1G A;  1EXJ A;  1NH4 A;  1VQP P;  1VQ7 P;  2FXP A;  3EQ2 A;  1GXG A;  3CMA P;  2GDY A;  3NTN A;  1GK6 A;  4D6T D;  1LP1 B;  1BGY D;  2KZJ A;  4I1L A;  2AFE A;  5CCG D;  1JCC A;  5E79 H;  4IOI H;  2CPB A;  2IFN A;  2PP6 A;  2Y0E A;  3CX5 H;  2M5A B;  3VMY A;  3ABV C;  2RH0 A;  1EDI A;  1S2E A;  3SWK A;  1KMI Z;  3A3Y B;  2H88 C;  1KB9 D;  2OYH C;  1N8R Q;  3CC7 P;  3MGN A;  1M6E X;  3NY7 B;  4C7R A;  3ZDM A;  2FBW C;  4EOT A;  1W5C E;  1BCC D;  1LNQ A;  5K5G B;  2KOO A;  1QX8 A;  3PLN A;  3A0H E;  2E74 C;  2OAR A;  4PWV B;  3JCU H;  2MR7 A;  2CWO A;  2JO0 A;  1KIL E;  2ZXE B;  1IUQ A;  4H2X C;  1YJW P;  1PPJ G;  5CCG C;  3TNU B;  1BCC J;  2H43 A;  1NO4 A;  1HVV A;  1FR2 A;  2Z46 A;  5GTI H;  1RF1 A;  1KV4 A;  5EW5 E;  3RL0 D;  3TF5 A;  1HTL C;  1YHQ P;  2KGE A;  3P8C D;  3HD7 B;  3F89 A;  3CWB G;  3A0H H;  1L4A B;  2KZI A;  4JF7 A;  2KB7 P;  3JCU E;  3HE4 B;  1PEO A;  2QA4 P;  3ITK A;  1JUN A;  1NTM J;  1T2K C;  3H1L D;  5CCH C;  2E5T A;  2E43 A;  2EHS A;  2QM8 A;  1N7S A;  5GTH E;  1RQV A;  3G4S P;  3HE5 B;  2Z4E A;  4ZKP A;  2UWJ E;  2XV5 A;  4XRO A;  3AEC C;  3IR9 A;  3GF7 A;  2K0D X;  4PD4 D;  1L4A A;  3H25 A;  3H1I D;  3LW5 H;  1AQ5 A;  3MTU E;  5AVU B;  2BQ1 E;  1AJY A;  2D2C C;  3BAT A;  5KP8 B;  2E74 D;  1IFM A;  2R5B A;  2ERH A;  1R5L A;  2BAS A;  3L70 E;  2IDB A;  1Y8A A;  2QJP B;  1FZC B;  3H1K E;  1BGY J;  3A5T A;  1ACP A;  2PNG A;  5KTB A;  5KAF E;  1GL2 B;  2M3E A;  4N3Y B;  1L0L K;  1L0N K;  3P8M C;  1RE3 A;  1PP9 G;  2KOR A;  2B87 A;  2I1J A;  4NPD A;  3AE1 C;  3N4X A;  4PJ0 E;  2YIU B;  3PHL A;  2OYI A;  1UJZ A;  1M6N A;  5HVC A;  4RO0 A;  1FZF A;  4RJT A;  4L76 A;  3CCQ P;  2K37 A;  2FYU K;  1BGY G;  4AQR D;  3Q5S A;  2GUS A;  1DD4 A;  1USD A;  1N86 A;  3I5C A;  2OYI B;  1K05 A;  1EZV D;  1JTH A;  1M8O B;  2G8Y A;  3L71 G;  3G29 A;  4Z1M H;  2M8R A;  1VQL P;  3AED C;  4GDO A;  1SLQ A;  1N7S C;  3HD7 C;  2YXR B;  2N1T A;  3S9O A;  1YQ4 C;  1PGO A;  2IZ0 A;  3H1H G;  4PXH B;  2WSC H;  3B5N D;  4MRT C;  4L74 A;  1LT9 A;  4IFF A;  3L70 D;  5CBN A;  1GU4 A;  1CI6 A;  3EJE A;  2YKP A;  1BAJ A;  2CGQ A;  2FXO A;  2ZVO B;  1HUC A;  2JO1 A;  3E1I A;  4YTP C;  2FQ2 A;  2KI7 B;  2KSE A;  1ZN5 A;  4GOF A;  4U3F G;  1EC5 A;  3H32 A;  1SQP G;  2LML A;  4H44 C;  1VHN A;  4GR2 A;  2E1M A;  1IK9 A;  1CI6 B;  1YTZ T;  2FHS C;  1Q81 Q;  3L73 E;  4L73 A;  1QGK B;  4H2Y C;  2LXB A;  5E79 E;  5APU A;  2JBG A;  2I8D A;  1KIL C;  1T3J A;  3D71 A;  1RY3 A;  5HGM A;  2QRX A;  1FC2 C;  1S5L E;  2HLO A;  4OGQ B;  2XT1 A;  2WMM A;  5BVZ A;  3GZL A;  1NTM D;  1JY2 O;  3Q2Y A;  2OYH A;  3G9R A;  3A0B E;  2Z5H A;  3CCE P;  2GZF A;  3BCC E;  2XNX A;  2K92 A;  3NTE A;  3CC4 P;  4BPH A;  5H2F E;  1L0L D;  1SQQ E;  1NTM E;  1IFP A;  1SQB K;  3CCL P;  1OW7 A;  4N6J A;  3V2Q A;  4I6M C;  2KNC A;  3AEG C;  1MUU A;  1SQX K;  2OTL P;  1SFC B;  1MFT A;  1X9V A;  4IPY A;  2AF8 A;  2VRS A;  2KG6 A;  4WBA A;  1CW5 A;  1GZL A;  2M3B A;  1KYO E;  1FDO A;  3H1I G;  2JU1 A;  3L74 D;  3CI9 A;  3PRJ A;  3DS4 A;  2KGC A;  1GU5 A;  2KOP A;  1NQ4 A;  3RBZ A;  1DIP A;  1JY2 N;  1D1D A;  2NPS C;  1NTK J;  5KLV K;  1Y9B A;  3HD7 A;  1AFO A;  5APX A;  3TGU G;  5F2K A;  2M0B A;  1NYH A;  2LL8 A;  2AXT E;  3B4Q A;  3KDP B;  4ZKU A;  3FWL A;  1CEI A;  2Z5I A;  1NJI Q;  4Y99 B;  5AVS B;  1FS0 E;  2BCC J;  1L0I A;  1GD2 E;  1A8O A;  1U7J A;  2HFE D;  1E5W A;  1EZV E;  1H0T B;  4D6T G;  4H0L C;  3VRL C;  2QNW A;  2XDJ A;  2SPZ A;  1G2C A;  2FQ0 A;  1L0N D;  4A7P A;  2H89 C;  1MKM A;  2FQ1 A;  3RK3 E;  2C9L Y;  1R8E A;  1NHL A;  3LRY A;  4AUW A;  2GYK A;  4NPF X;  4H0L D;  2OYI C;  3WU2 E;  1P84 I;  1NAF A;  1JMM A;  1VF5 C;  3A2A A;  5AW8 B;  5DJU B;  2E76 C;  3LID A;  2LKM A;  1GTW A;  3CWB E;  2P7J A;  3G21 A;  1AUM A;  2LTE A;  2Q3I A;  5L8R J;  2O01 J;  5KLI B;  2LIW A;  1RO2 A;  5HGN A;  3OJA B;  1JEK A;  2MJZ A;  3L72 E;  1QVF O;  3M0D C;  2QEX P;  2PEI A;  4WYM A;  1ZP0 C;  2FYU G;  2ZVN B;  3HUS A;  2NRG A;  3WBH A;  3TK1 A;  4IL6 X;  1LJ2 A;  3CXH D;  4H13 D;  4UHP B;  4W7Z A;  4Y99 C;  1S9K D;  2QM7 A;  4DG9 A;  2MKV A;  3CXH H;  3O6Q A;  1M1J B;  2MF4 A;  4OH8 B;  2HPC B;  1K30 A;  3W68 A;  4KJM A;  3B71 A;  2JKV A;  2L22 A;  3BRV B;  1NU1 G;  2XU6 A;  1SP4 A;  2Q7C A;  1H88 A;  4IFD K;  1IMP A;  1YQ3 C;  2HG5 D;  1BSH A;  1JY3 P;  4N78 D;  2NZ2 A;  3JSV C;  4PJ0 H;  1KZU B;  1NTK D;  3SSU A;  3L4F A;  2NO8 A;  3V6I A;  1LWU B;  2GA1 A;  1M1J A;  2O1K A;  1YJN P;  5AW2 B;  5TIS E;  3AE5 C;  3GF3 A;  1PEQ A;  2JWA A;  2M8N A;  2ZJS E;  3E2D A; 
#chains in the Genus database with same CATH homology
 2OTL P;  3CCS P;  3HZQ A;  1EIA A;  3CCV P;  4XRO A;  2ONT A;  4IPY A;  1M90 Q;  3DS3 A;  1KC8 Q;  3G21 A;  1AUM A;  3DPH A;  1VQ6 P;  2BHV A;  3DS2 A;  2BQ1 E;  2L6E A;  1RO2 A;  5HGN A;  5DCK A;  2BUO A;  1YIJ P;  4U0D A;  1VQ4 P;  1VQN P;  1BAJ A;  1VQ8 P;  3DS4 A;  1K9M Q;  3Q20 A;  1RNI A;  1YJ9 P;  1N8R Q;  3CC7 P;  1QVF O;  2EFJ A;  1QVG O;  2P9X A;  1M6E X;  2QEX P;  2PEI A;  1KD1 Q;  4WYM A;  1YIT P;  4U0F A;  3B5I A;  3G0V A;  3MGE A;  2M8L A;  1KQS O;  1JJ2 O;  2JYG A;  1RO0 A;  2JYL A;  1VQM P;  1S72 P;  3CD6 P;  1D1D A;  3CCU P;  1Q7Y Q;  1PEM A;  1QRJ A;  3WBH A;  4QNB A;  3DS5 A;  5BS2 A;  3DS1 A;  5HGO A;  3G71 P;  2Z45 A;  3CCR P;  3H47 A;  3G28 A;  4XFY A;  5F2K A;  3CPW O;  4GR2 A;  2E1M A;  5HGL A;  4U0C A;  4M0I A;  1Q86 Q;  1K8A Q;  4U0B A;  2OAR A;  4XRQ A;  3CCM P;  1Q81 Q;  3CME P;  3P05 A;  2CWO A;  2JO0 A;  1NJI Q;  1IUQ A;  2EG5 A;  4XFX A;  1YJW P;  2LF4 A;  3H0D A;  1M6N A;  2XV6 A;  1PEU A;  4XFZ A;  1K30 A;  2PEQ A;  3H4E A;  1ZMB A;  1VQK P;  5HGM A;  4U0A A;  1VQ5 P;  2XT1 A;  2Z46 A;  4COC A;  1A8O A;  1EOQ A;  3G1I A;  1M1K Q;  2PEJ A;  1K73 Q;  2DGY A;  2PEM A;  1VQO P;  2XXM A;  2KOD A;  3CCJ P;  1W2B O;  1YHQ P;  4COP A;  5F2N A;  3HYB A;  3G26 A;  3G6E P;  3CCQ P;  3VRL C;  3DTJ A;  3I55 P;  1VQ9 P;  3RG6 C;  3CXC O;  4U0E A;  3OW2 O;  1Q82 Q;  3DS0 A;  4GR6 A;  3CCE P;  1E6J P;  3I56 P;  3G1G A;  5F2O A;  4PH1 A;  2M8P A;  3NTE A;  1PEO A;  2PY8 A;  2QA4 P;  3CC4 P;  2PEO A;  3CC2 P;  4PH0 A;  1YJN P;  2PEK A;  5JPA A;  2EIA A;  5I4T G;  1VQP P;  1VQ7 P;  3G29 A;  2PEN A;  2OTJ P;  1A43 A;  3M1M A;  3CMA P;  3CCL P;  1M74 A;  1YI2 P;  1VQL P;  3LRY A;  1PEQ A;  2M8N A;  5BS1 A;  3E2D A;  3G4S P;  2Z44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...