1Q7YQ

Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 51
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q7yQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q7yQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q7yQ03
1Q86Q 1KD1Q 3CXCO 3CMAP 1K9MQ 3CCMP 1YJNP 3CCSP 3G6EP 3CPWO 1YITP 3CCJP 3CCQP 3CCRP 3CCEP 2QA4P 1VQ8P 1QVFO 1Q7YQ 1S72P 1M1KQ 3I55P 3I56P 1VQPP 3CC2P 3G71P 1YJ9P 1VQNP 3G4SP 1KC8Q 1N8RQ 1VQ9P 1K8AQ 1YIJP 1VQOP 1VQ6P 3OW2O 3CCUP 1Q81Q 1VQ4P 1K73Q 1QVGO 1JJ2O 1YI2P 2OTJP 3CC7P 1Q82Q 1W2BO 3CD6P 1NJIQ 1VQ7P 1VQLP 3CMEP 3CC4P 2OTLP 1YJWP 3CCVP 1VQKP 1YHQP 2QEXP 1VQMP 3CCLP 1M90Q 1KQSO 1VQ5P
chains in the Genus database with same CATH superfamily
2NPSD 3H1JG 3TSIA 3V2QA 1T2KC 1LNQA 4NEOA 3H1JD 2GZJA 1YI2P 1L0LJ 3G1IA 2W6BA 2E43A 3CMEP 3AE1C 1M74A 2VLPA 1NAYA 3CXHE 1EQ7A 3H1KG 4UHPB 1A8OA 4U3FD 3AEBC 3TK1A 1KB9D 3AE8C 5KAIE 1EXJA 5GTHH 3H1KD 5B66H 1SQXJ 1JB0J 1VL2A 1RF1A 2QM8A 2HR3A 3H1LE 5AVZB 1GU5A 2QJKC 4OGQC 4GKGA 1L4AD 2OYIC 4RJTA 2NPSA 2WPRA 2YO3A 1FE6A 1OVUA 1PP9J 1RE3A 3B4QA 3A7OA 2Z45A 4MRTC 1L0LE 3G3ZA 3B5NB 5KP8B 2QJPB 1M6EX 1SLQA 1AYIA 3GHGB 2FACA 2A45H 2M5RA 1FZBA 1FAVA 3V4QA 1PPJG 3IN6A 1BCCE 1PEOA 1IFNA 5KJ7C 1IZNB 2P10A 3LMOA 1PPJD 2FQ2A 4PD4H 3H1HG 3M1MA 1Z56A 5AVVB 1L4AA 1N7SB 2A06E 1GU4A 1WRGA 3N7NA 2LOLA 2PEMA 2D2CB 3SSUA 1S5LX 2N6ZA 1DEBA 5KLVD 3DS3A 3M0DA 1FJPA 3LRYA 1JTHB 2IFMA 1RNIA 1GXHA 3L72J 1FDMA 1LT9A 2ZT9C 1FZGA 3KDPB 3D6YA 3FWLA 5TJHA 2N1TB 2KODA 2IDBA 1M8OB 1PFIA 1JCCA 1DNYA 1AVOA 2QJYB 4OVNF 5H2FE 1NU1J 2Z46A 4GIFA 3RG6C 2C0XA 3HE4B 2YXQB 1MFTA 2K9JB 3CCEP 1GW4A 2KS1A 1VQNP 2JB0A 4HYTB 2GYKA 3L4FA 5BS1A 1RF0A 4A7PA 3L72E 2JJLA 2K0XA 3L73G 2OYHB 2LXBA 5HGLA 2YIUC 1T6AA 1Q86Q 3P8MC 3CI9A 2KNCB 3BRVB 3L73D 1HUCA 1SQXD 4WY4C 1KZUB 5BU8B 4H2YC 1EDIA 1HVVA 1UJZA 3SFEC 2M8NA 3TGUJ 2CWOA 3E1RA 4C7NB 4PV1D 2JBGA 4DOJA 1YTZT 5AW1B 2M3EA 5HGOA 2K0YA 3H25A 2K92A 3MTUE 1GXGA 2WTYA 3Q5PA 1S1CX 1IFMA 5HGNA 2GDYA 1P84E 3OW2O 1Q81Q 2KSJA 1LTJB 3HUSA 3Q3DA 3NTEA 3H6PA 2E42A 3KZIE 2Z4EA 4R0MA 1CI6B 1YTZI 3MD0A 1L2PA 3R4YA 1RO0A 1IC2A 2KWLA 2H88C 1Q7YQ 2PAJA 5KLIB 2A45I 2GUVA 2JWAA 3HE5A 3JCUE 3D6ZA 3TYYA 4CPGA 3HD7C 3G21A 2K9YA 5KP6B 1FJKA 3IR9A 2FADA 4H44C 1LTBC 4JYCA 5BS2A 4PD4I 4QKOA 1EZVI 5DJTB 2E75B 2I1KA 3EJBA 3E7KA 3G4SP 3Q1MA 4EYYQ 1N73B 3G28A 3GZMA 2J58A 1KYOH 2JGPA 1NU1D 1L0NG 3H47A 1WT6A 2BASA 2IPPA 2QE7H 1RO2A 2KG8A 1MZ8A 2V7QH 5B66E 1AQTA 1JNMA 1K9MQ 1L0ND 1NKZB 5AW4B 2JAZA 2M5AB 1KB9H 2PP6A 2QM7A 1FBMA 3FX0A 5KP7B 4IZ6A 4XFXA 1EMVA 1D7MA 1L0IA 2MF4A 2K37A 1URQD 2DGYA 5F2KA 2FYUK 2HODA 4MN4C 2BHVA 2IYOA 4XFZA 4IL6H 1KV4A 3TGUD 4GOFA 4I1LA 1WMKA 1GL2B 2VRSA 1H0TA 3VOPA 5F2NA 2FYUJ 1FZCB 4D6TE 2ONTA 1GTWA 3PHLA 2ZYGA 2AXTH 5KAFH 4H13D 1IFDA 5CBNA 2GZFA 4Y99B 1F80D 1NJIQ 2N50A 3H1IG 3OJAB 1URQA 1HH0A 1VF5B 3DS4A 1NTZG 1HTLC 1AQ5A 1FOSE 4ZMDA 1PIXA 1A02J 3RK2D 3H1ID 2WPSA 1PV3A 2XKMA 2HYNA 2YMYA 1NTZD 2E76C 2L22A 2B88A 1LJ2A 3GG2A 3RBZA 1E79H 1EC5A 3HD7B 1BGYG 1VQMP 2PENA 2A45G 1NTMG 1AA0A 1PZQA 2GZGA 5L8RJ 2B89A 1RY3A 5B5EH 3L75E 1SQVK 2C9LY 2XNXA 1HGVA 4RO0A 2ERHA 3A5TA 2CGQA 3FGAD 4W80A 2WSEJ 2QEXP 3TNUB 2E74D 1SQVJ 2WSFH 1HGZA 2Q1KA 1KYOI 4ASWA 2LF4A 1LP1B 1PGOA 2Q3EA 5K5GB 3K5BA 5E79E 1SFCC 2MJZA 2EHSA 1R5SA 1QRJA 2C9NY 1J1EB 4N78D 4U0DA 1KB9I 1SQQG 2KOSA 2LIWA 1Y8AA 2H8PD 1PEMA 1SQVE 4YTPC 4W7ZA 1R5LA 2G8YA 3H1JJ 1OWAA 3CWBE 5CCHD 1AFOA 2V7QJ 2N5IA 3U1AA 1FZFA 3GLMA 3SWYA 3G26A 3CCRP 1ACPA 4U3FJ 2P1JA 4K35A 1Z6MA 4U0EA 3H1KJ 3O6QB 1RF1C 1OW6A 2FQ1A 3A2AA 3AEAC 2BEZF 2XZ0D 1A43A 1BSNA 2NPSC 1UIXA 1AV1A 2X2BA 2KOGA 1RE3C 3DS0A 2H43A 1N86A 3V2NA 1T3UA 1T8KA 2E76B 4JYBA 5CCHA 1KMIZ 2XZRA 3L35A 5DJUB 5KTBA 2LKMA 1NTKE 2QG4A 4COCA 4U3FE 4IOIH 5AW3B 1IJDB 3H1KE 1VKUA 1X3OA 2W27A 3WUUA 3CC2P 1CEIA 1KC8Q 1HY8A 1SQPE 3L74G 2N9BA 1K8AQ 4BRYA 5KLVK 3EFFK 1L4AC 3CX5E 1FC2C 4LC1A 1M6NA 3HTKA 1PGPA 3RK3C 2JR8A 5KKZB 3H1HJ 2L5GB 2WSCH 3M0DC 3DS5A 4BPFA 1Q2NA 3I56P 1EXIA 3DTJA 2BCCD 1LT9C 4UB8H 2P9XA 4L74A 4NPFX 3V4WA 1JMMA 4GT1A 5APVA 3AE2C 1USDA 2L9FA 1PGJA 3EQ2A 1N7LA 1FZEA 4U0AA 2ZAEB 3L70G 1XTGB 3VP9A 1M1KQ 1KILD 1UIIA 1KYOD 2IZ0A 3BCCE 4WVZA 3L70D 4QNBA 3GJNA 1MV8A 2AEFA 5CHXA 4DJGA 1M1JA 3P8CD 2IBZE 2I8DA 5KLVE 3CCVP 3SFDC 3AECC 4JBZA 1RF0C 3D70A 1DV5A 1SQXK 2JWDA 3KHUA 3VP8A 1ZR2A 4DG9A 1KN7A 3B5ND 2LL8A 2QIWA 1YYCA 3WBHA 1CSBA 3L73J 2WSSH 1J1DB 2JO1A 1RE4A 2PRRA 1VQLP 2R5BA 1BAJA 2PEQA 1JEKA 2PEKA 1Y9BA 5JPAA 3RK3D 1KILA 2NPSB 2FFDB 3L71G 1M57D 3RL0C 2OTKE 3P7KA 1T3JA 1N7SD 3CLQA 2HPCB 1IK9A 5AVUB 2D2CD 3T97B 4U0CA 3HUSC 1BDCA 5I4TG 2JDIH 3B5NA 5CZDB 3L73E 1JY2P 1SQXE 1SVFA 1S5LH 5APXA 3NY7B 3LW5J 4L73A 4AYCA 1FZAA 3ZDMA 1LWUB 1OVRA 2PEOA 4C46A 2N1TD 2B9BA 4U0BA 3CL3D 1IFPA 1PP9E 4PV1C 2Y0CA 1L4AB 3H1HD 1OW8A 2PGDA 1LTIC 2KLVA 2VLQA 1N7SA 2KI7B 2K94A 2PEIA 4H0LB 4EIJA 1NU1K 3F89A 3ABVC 4LLHA 2R3SA 2WT7A 1GPJA 2R5DA 3HRNA 4EOTA 3H32A 3LIDA 3DS1A 1L0NK 2AEJA 2CNRA 4R4MA 2MR7A 5HGMA 2AFEA 2N1TA 3MHVA 1S72P 3H1LG 2ZFCA 5F2OA 3TDKA 2P67A 3RL0D 2KB7P 1L0NJ 4IFDK 5GTIE 5CCGD 1M56D 2JKVA 1CZQA 3H1LD 3HE4A 2FVAA 2GZIA 1S9KD 1H8AA 2P2UA 5HV8A 2QRXA 2K3RA 4HJGH 4GR6A 5AVRB 2OYHA 1JY3P 1NU1E 2KNCA 1BCCG 2QJKB 4OGQB 2OYIB 5CJ4A 2XXMA 1L0NE 4ZKUA 3AE3C 2A06G 5CCGA 2PFXA 4C7NA 3MZWB 1DIPA 1GK4A 2W83C 4XROA 2A06D 4UB6E 1ZMEC 2EHTA 1FS0E 1URQC 2E75D 1NTZK 1JM0A 1LTJA 3TGUE 4PH1A 2O1KA 1LTSC 3EJDA 1CI6A 2WVRA 3H1IJ 3Q5RA 2XV6A 1NTZJ 3HE5B 4PV1B 3KPEA 3A0HH 2JQ4A 2HFED 4XFJA 2Z5HA 1E5WA 2KLUA 2ROQA 3I5CA 4QMAA 1E0HA 3G1GA 3CE7A 1BXIA 4H13C 2IFNA 2POHA 2FYNC 3WUVA 2E1MA 1U57A 2RMZA 2ZT9B 3L72G 3L36A 2Y9ZA 2G3AA 2YO2A 2K2QA 3V5BA 4R4LA 2FKWB 3RGUA 3WU2H 3M91A 3M9HA 1ZW0A 5GTHE 4IFMA 1DD4A 2LR2A 3H1IE 1N73A 3RK2C 3CPWO 4PJ0H 2YKOA 2W6AA 4DZOA 4N6JA 2HLOA 1NH4A 1GL2D 1NO4A 3DPHA 1DEEG 2FQ0A 1SS1A 2ZYAA 1LTTC 1NVOA 2EG5A 3B4SA 3RG2A 2XZ1C 2YIUB 2XU6A 3QWOC 2W6JH 3BASA 4WY4B 1X9VA 3H4EA 1K73Q 5AVSB 1RQVA 1EDJA 2GDXA 4XRQA 2E74C 2WPTA 1H0TB 2VLNA 1VF5D 5APWA 5AVXB 3MIWA 4PD4E 1GD2E 1EZVE 1HBWA 3C9IA 2KZJA 1GL2A 2YMKA 3A0BH 2BQ1E 3GW6A 1D1DA 5TISH 3GF7A 3CD6P 3JSVC 2BUOA 4N78E 2N9YB 5BVZA 3BRTB 1OMIA 2ZXEB 2PNGA 1URQB 1E6JP 1OZHA 3II6A 5AVWB 2FYUE 3PTZA 3F5HA 4EI2A 4AQRD 5APSA 3WMM0 5CCHC 3AE5C 1ZRTE 2JU1A 1RH5B 4H44B 1JY2O 4L75A 3P32A 3L37A 2K0DX 3CCJP 1BGYD 3CXHH 1BE3G 2FYNB 3HZQA 1NTMD 2M8PA 5KAIH 2RH0A 1OX3A 5AW8B 3C8VA 1BE3D 1JOCA 3O8ZA 5AW2B 1USEA 4KJMA 1UNKA 2HG5D 4WBAA 2FAEA 4JF7A 3L74J 3M0AA 2OGUA 3CCSP 3RK2B 4HKGA 1H88A 3U43A 1YQ4C 3AEGC 1HF9A 4RESB 2WWWA 4D6TG 3TNUA 1SP4A 2BCCJ 2O1JA 2MVVA 4JQ0D 4ASVA 2XDJA 1KD1Q 3V2PA 3KQGA 3VMAA 3CCMP 4ZKPA 1YITP 1HJ0A 1YJ9P 1YIJP 1SQQD 1M1JC 3L70J 1T8ZA 4KT0J 3AE6C 3EJEA 1AF8A 2BCCE 1GZLA 2P58A 1EIAA 3W68A 1PL5A 3AEEC 1U7JA 4AUWA 1QLED 2LPKA 1JY3O 2MVUA 4N3YB 2B87A 1NGMB 1HWTC 1RE4C 2FVEA 4I6MC 2R32A 3V6IA 1XTCC 1PGQA 1IUQA 3B5IA 5AVTB 4M0IA 3L75G 1IFIA 3G6EP 1KILE 2IYPA 1KYOE 1KILC 3GF3A 5H2FH 3H1JE 2K5XA 1MFZA 3L75D 3P8CE 1IFJA 3JC22 5DCKA 3UIAA 1RQUA 1G2CB 4OH8B 1GW3A 1FOSF 4PJ0E 3L71J 3U1CA 1NKNA 1SQBG 1KB9E 3B5NC 1YJNP 4HH2A 2JYLA 2NZ2A 4XFYA 5BU5A 3OA7A 2QJPC 4F37A 1SQBD 3MGNA 3GHGC 1NYHA 1AVYA 3L74D 5AW9B 4BRYB 4IL6E 2M8LA 3CXHI 3RK3E 1DH3A 4TT3H 3IAOA 1KFNA 3S1KA 3HTKB 1IMPA 3G71P 1A02F 1N7SC 2BEQD 5CBOA 2ZJSE 3CWBG 1JCDA 2D2CC 2H7HA 2AXTE 5KAFE 1OR5A 1P84H 2Y9YA 4Z1MH 3CWBD 1SFCB 2H89C 2JEEA 2LKIA 2KOOA 3KZIH 2AVAA 1PPJE 3FXDA 4DCKA 2KGCA 1VQPP 2J59M 5C39A 1GK6A 2AFDA 1LT1A 1ZXGA 2N1TC 3CC7P 2C0WA 4ZNCA 3H1HE 3MUDA 2QJYC 3M9BA 2CPSA 2NRGA 3AE7C 1M90Q 1MKMA 1KQSO 3H1LJ 2WSFJ 3JCUH 2AEMA 3C1LA 1KORA 2KUBA 2JO0A 3VYIA 4IPYA 1IK7A 1NTKG 1TU3F 4U3FG 2OYHC 2FHSC 1YBKA 3CC4P 2MD9A 1RF1B 5B5EE 1NTKD 2MKVA 2KGAA 3CMAP 1SQPG 2MR8A 3KYQA 1ZN5A 4HKZH 1NWQA 1VQ8P 1BSHA 2YKPA 1KILB 2ITAA 2Q3IA 1BCCJ 4B86A 1SQPD 5CCGC 2E5TA 4BPHA 2OTJP 3L71D 2FXPA 2Q7CA 1NOHA 1ZR4A 1S9KE 4PH0A 3CX5D 2FFDA 4I7ZC 3CCQP 2HPCA 2QA4P 2ZXXA 3T97A 2WITA 4H0LD 1LTJC 3GHGA 3QH9A 2W8ZA 2CG5B 5AW0B 1G1JA 3IFMA 2KXPB 1FDIA 2PY8A 3HYBA 3DS2A 1LWUA 3Q20A 3RK3B 3BCCG 4NPDA 5KLIC 2YXRB 1T2KD 2GA1A 3RL0g 2IBZG 4K3AA 5KLVG 3BCCD 1LT9B 2EIAA 2AXCA 2Z5IA 4NPEA 1JTHA 2IBZD 4TLFA 2MY5A 2J5UA 2WT7B 2O3JA 2JU2A 3CXHD 2E75C 2O01H 3H32B 1AUMA 2L6EA 1N73C 3V2RA 3G0VA 1P84I 3H0DA 3EWKA 1AJYA 1J2JB 1X22A 2KS1B 1NQ4A 3M06A 4LGDE 4OGQD 2M3BA 5AVQB 1L0LG 2K9JA 4PWVB 1PEUA 3NXSA 3VMXA 2FYZA 2WSCJ 1JUNA 1PEQA 1L0LD 2N5HA 3PH0A 3CCUP 4I2LC 4KHXA 3G29A 1VQ7P 3AEDC 1YJWP 1OVVA 1SQXG 1W2EA 3NFQA 2IX7C 5KJ7D 1BCCD 2AF8A 1PP9G 4PXHB 2L91A 3SWKA 3AEFC 4BWNA 1GL2C 3RL0B 1FZCC 2OYIA 1NAFA 2UWJE 1PP9D 3VMYA 5APUA 1U7MA 2JYGA 2R44A 3HUSB 3AE9C 2PEJA 4UB8E 5E79H 2M0BA 5AW7B 4M3LA 2EFJA 4I7ZB 2WPVB 1IMQA 2ZT9D 4Y99C 4CA3A 4C7RA 3PJSK 7CEIA 1QVGO 2FBWC 1QL2A 1X79B 2WSEH 1VF5C 3TF5A 5KJ7A 3S4RA 3E1IA 4GOEA 2ZVOB 2LMLA 3M9QA 1NTMK 4DT0A 2NO8A 3MP7B 1LTGC 4H2WC 1M7LA 1VQ4P 1BGYJ 3AE4C 1BDDA 4H2XC 5AW6B 1IO4A 4U7JA 3RBXA 4GODA 3E2DA 1NTMJ 1QEXA 3L72D 2GM4A 1BE3J 4YPCA 2XV5A 4OWFA 2KK7A 4WY4D 1S3JA 2KP8A 1NTZE 1JO5A 1NU1G 1YQ3C 2RN0A 2YNYA 1VDFA 1ZOYC 3VRLC 2FXMA 2DW3A 1VPCA 2R3CA 3IF4A 3KXDA 1G1IA 1OIPA 2L4BA 1KFMA 1BGYE 4O9BA 4D6TJ 2M5AA 5HVCA 1X0TA 2ZYDA 1N8RQ 1NTME 1SQQK 2HODB 1BE3E 1P84D 3Q5SA 3PRJA 1FDOA 1S5LE 1J1EC 1QX8A 3TGUG 1H89A 1SQQJ 3ITKA 2CQ8A 2O01J 3GKLC 4WY4A 1L0HA 3CX5H 2Q6QA 2KW2A 3SWFA 1FR2A 1MZ9A 3A3YB 3VTPC 2N98A 1FZCA 2GUSA 2WZ7A 1ZV8A 3S9OA 3HD7D 4IL6X 2LXCB 4H44D 1EDKA 2KGDA 3Q2YA 1QGKB 3R2PA 1ZLLA 4L76A 1QVFO 4JPZB 3FXEA 1SQQE 3BATA 2DNWA 2O01N 1W5CE 3L75J 2RKLA 2FY8A 1MUUA 1HJBA 5AVYB 1R8EA 4GR2A 1SQBK 2QSIA 2OYOA 1KQGB 1ZMBA 4H13B 1EDLA 3HD7A 2KYVA 2FXOA 2K93A 4GDOA 2Y0DA 1ZP0C 1SQBJ 3CCLP 2I1JA 3VN0A 3GMAA 2IZ1A 2KOPA 3NMDA 1OXZA 1JY2N 5APTA 5AW5B 3D71A 2VLOA 5EJDA 1EZVG 3LIEA 4IFFA 2Y0EA 1EOQA 1KQLA 5KKZC 4HB1A 4D6TD 1VQ5P 4PD4D 3G9RA 3OAKA 2KORA 1DX7A 1EZVD 3CWBJ 2KZIA 2V4HA 3VMZA 1LP1A 2XT1A 1SQBE 1VQOP 2GZEA 1NHLA 1W2BO 3L74E 5EFWB 1CW5A 2OTLP 4Y28J 3EFGA 3PP5A 1S2EA 3MUDC 1K30A 2E74B 2FYUG 3WUTA 2N6YA 2W90A 3PLNA 2GDWA 4W7YA 2P7JA 2Q9IA 2FYUD 3A0HE 3GZLA 1GMJA 1Q90D 3FWNA 2E76D 4COPA 4YXWH 2KGEA 5APQA 1NTKK 3CX5I 1LGHB 4BXLA 2QVAA 1K05A 2E5YA 3W67A 2B87B 1RHZB 1ZRTD 2KG9A 3CXCO 3LW5H 1SQPK 2WPQA 1NTKJ 2M8RA 3WU2E 2L0QA 2Q5UA 2KR5A 1J1DC 3O6QA 2WQYC 3L70E 1JMBA 1QL1A 3B71A 4XE5B 2VSQA 2KSEA 2KOQA 1KQFB 1SQPJ 1FU1A 4RKUJ 5GTIH 2YKQA 2FFDC 1JY3N 4U0FA 5CMZA 1LTAC 1DD3A 1G2CA 1KTMA 2K1AA 1Y47A 3MGEA 1ZNVA 2IBZI 2XNDH 1SFCD 1VQKP 2KIKA 2OQQA 2Z44A 4WYMA 1N2DC 2OARA 2LIUA 2WMMA 3BVHA 1LWUC 2SPZA 1SQVG 3B8EB 2FVFA 5APYA 1OW7A 2CK3H 3L71E 2CPBA 4WWIA 1GDTA 1Q82Q 3N4XA 1SQVD 3U59A 5CJ0A 3BCCJ 5EW5E 1VHNA 1HQBA 3A0BE 1OFCX 2BCCG 1S4XA 5M1BA 4UB6H 2K88A 5KLVJ 3NTNA 5TISE 4BPGA 3I55P 4YXDC 2QNWA 4H0LC 3USSA 1VQ9P 1X8YA 2ZVNB 1VQ6P 1SFCA 1JJ2O 4WB4A 1K04A 4XA4A 4EDFA 2LTEA 1YHQP 2JP3A 2KG6A 3P05A 1KLPA 1M1JB 1L0LK
chains in the Genus database with same CATH topology
1RO0A 3CXCO 3CMAP 4U0DA 1YJNP 3CCSP 3DS5A 4GR2A 1VQ8P 1PEQA 1Q7YQ 2JYLA 3I56P 1ZMBA 4XFYA 3DTJA 2PEOA 3H4EA 1PEMA 3CCUP 2P9XA 4U0BA 1K73Q 2OTJP 3VRLC 1YI2P 3G1IA 2KODA 4XROA 3G29A 1NJIQ 1VQ7P 3CMEP 3G21A 4PH0A 1YJWP 4XRQA 1M74A 3CCLP 2M8LA 5BS2A 3DS4A 1KD1Q 1A8OA 2Z46A 4U0AA 3RG6C 3CCMP 4U0FA 3G26A 1YITP 3CCQP 3CCRP 3CCEP 2QA4P 1M1KQ 4PH1A 3G71P 1YJ9P 1VQNP 3G4SP 2BQ1E 2PEIA 1N8RQ 1YIJP 3G28A 4U0EA 4QNBA 1D1DA 3CD6P 3MGEA 2XV6A 5BS1A 2BUOA 3H47A 3CCVP 1VQKP 1EOQA 3DS1A 1VQMP 2JYGA 1RO2A 2PY8A 2Z44A 3HYBA 5HGLA 1VQ5P 3DS2A 1A43A 4WYMA 1Q86Q 2PEJA 3G1GA 2OARA 2Z45A 2PENA 3Q20A 1K9MQ 5HGMA 1E6JP 2EFJA 3DS0A 2XT1A 1S72P 1EIAA 1VQPP 5F2OA 3WBHA 2E1MA 1VQOP 2M8NA 2EIAA 1QVGO 3CC7P 1Q82Q 1W2BO 2CWOA 1M6EX 1VQLP 2OTLP 1BAJA 2PEQA 2QEXP 4COCA 1M90Q 1KQSO 2PEKA 4XFXA 1K30A 1IUQA 5HGOA 3B5IA 5JPAA 4M0IA 2DGYA 5F2KA 1PEOA 3G6EP 2BHVA 3CPWO 3CCJP 1QVFO 1AUMA 4XFZA 3CC2P 4GR6A 3I55P 2L6EA 3G0VA 1KC8Q 3M1MA 5HGNA 2JO0A 1VQ9P 1K8AQ 3HZQA 2LF4A 4IPYA 3OW2O 3H0DA 1Q81Q 1VQ4P 1VQ6P 1JJ2O 2M8PA 3DPHA 5DCKA 4COPA 3NTEA 4U0CA 5F2NA 2PEMA 3CC4P 2ONTA 3E2DA 1YHQP 1M6NA 1QRJA 5I4TG 2EG5A 3DS3A 3P05A 1PEUA 3LRYA 2XXMA 1RNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 Q;  1KD1 Q;  3CXC O;  3CMA P;  1K9M Q;  3CCM P;  1YJN P;  3CCS P;  3G6E P;  3CPW O;  1YIT P;  3CCJ P;  3CCQ P;  3CCR P;  3CCE P;  2QA4 P;  1VQ8 P;  1QVF O;  1Q7Y Q;  1S72 P;  1M1K Q;  3I55 P;  3I56 P;  1VQP P;  3CC2 P;  3G71 P;  1YJ9 P;  1VQN P;  3G4S P;  1KC8 Q;  1N8R Q;  1VQ9 P;  1K8A Q;  1YIJ P;  1VQO P;  1VQ6 P;  3OW2 O;  3CCU P;  1Q81 Q;  1VQ4 P;  1K73 Q;  1QVG O;  1JJ2 O;  1YI2 P;  2OTJ P;  3CC7 P;  1Q82 Q;  1W2B O;  3CD6 P;  1NJI Q;  1VQ7 P;  1VQL P;  3CME P;  3CC4 P;  2OTL P;  1YJW P;  3CCV P;  1VQK P;  1YHQ P;  2QEX P;  1VQM P;  3CCL P;  1M90 Q;  1KQS O;  1VQ5 P; 
#chains in the Genus database with same CATH topology
 2NPS D;  3H1J G;  3TSI A;  3V2Q A;  1T2K C;  1LNQ A;  4NEO A;  3H1J D;  2GZJ A;  1YI2 P;  1L0L J;  3G1I A;  2W6B A;  2E43 A;  3CME P;  3AE1 C;  1M74 A;  2VLP A;  1NAY A;  3CXH E;  1EQ7 A;  3H1K G;  4UHP B;  1A8O A;  4U3F D;  3AEB C;  3TK1 A;  1KB9 D;  3AE8 C;  5KAI E;  1EXJ A;  5GTH H;  3H1K D;  5B66 H;  1SQX J;  1JB0 J;  1VL2 A;  1RF1 A;  2QM8 A;  2HR3 A;  3H1L E;  5AVZ B;  1GU5 A;  2QJK C;  4OGQ C;  4GKG A;  1L4A D;  2OYI C;  4RJT A;  2NPS A;  2WPR A;  2YO3 A;  1FE6 A;  1OVU A;  1PP9 J;  1RE3 A;  3B4Q A;  3A7O A;  2Z45 A;  4MRT C;  1L0L E;  3G3Z A;  3B5N B;  5KP8 B;  2QJP B;  1M6E X;  1SLQ A;  1AYI A;  3GHG B;  2FAC A;  2A45 H;  2M5R A;  1FZB A;  1FAV A;  3V4Q A;  1PPJ G;  3IN6 A;  1BCC E;  1PEO A;  1IFN A;  5KJ7 C;  1IZN B;  2P10 A;  3LMO A;  1PPJ D;  2FQ2 A;  4PD4 H;  3H1H G;  3M1M A;  1Z56 A;  5AVV B;  1L4A A;  1N7S B;  2A06 E;  1GU4 A;  1WRG A;  3N7N A;  2LOL A;  2PEM A;  2D2C B;  3SSU A;  1S5L X;  2N6Z A;  1DEB A;  5KLV D;  3DS3 A;  3M0D A;  1FJP A;  3LRY A;  1JTH B;  2IFM A;  1RNI A;  1GXH A;  3L72 J;  1FDM A;  1LT9 A;  2ZT9 C;  1FZG A;  3KDP B;  3D6Y A;  3FWL A;  5TJH A;  2N1T B;  2KOD A;  2IDB A;  1M8O B;  1PFI A;  1JCC A;  1DNY A;  1AVO A;  2QJY B;  4OVN F;  5H2F E;  1NU1 J;  2Z46 A;  4GIF A;  3RG6 C;  2C0X A;  3HE4 B;  2YXQ B;  1MFT A;  2K9J B;  3CCE P;  1GW4 A;  2KS1 A;  1VQN P;  2JB0 A;  4HYT B;  2GYK A;  3L4F A;  5BS1 A;  1RF0 A;  4A7P A;  3L72 E;  2JJL A;  2K0X A;  3L73 G;  2OYH B;  2LXB A;  5HGL A;  2YIU C;  1T6A A;  1Q86 Q;  3P8M C;  3CI9 A;  2KNC B;  3BRV B;  3L73 D;  1HUC A;  1SQX D;  4WY4 C;  1KZU B;  5BU8 B;  4H2Y C;  1EDI A;  1HVV A;  1UJZ A;  3SFE C;  2M8N A;  3TGU J;  2CWO A;  3E1R A;  4C7N B;  4PV1 D;  2JBG A;  4DOJ A;  1YTZ T;  5AW1 B;  2M3E A;  5HGO A;  2K0Y A;  3H25 A;  2K92 A;  3MTU E;  1GXG A;  2WTY A;  3Q5P A;  1S1C X;  1IFM A;  5HGN A;  2GDY A;  1P84 E;  3OW2 O;  1Q81 Q;  2KSJ A;  1LTJ B;  3HUS A;  3Q3D A;  3NTE A;  3H6P A;  2E42 A;  3KZI E;  2Z4E A;  4R0M A;  1CI6 B;  1YTZ I;  3MD0 A;  1L2P A;  3R4Y A;  1RO0 A;  1IC2 A;  2KWL A;  2H88 C;  1Q7Y Q;  2PAJ A;  5KLI B;  2A45 I;  2GUV A;  2JWA A;  3HE5 A;  3JCU E;  3D6Z A;  3TYY A;  4CPG A;  3HD7 C;  3G21 A;  2K9Y A;  5KP6 B;  1FJK A;  3IR9 A;  2FAD A;  4H44 C;  1LTB C;  4JYC A;  5BS2 A;  4PD4 I;  4QKO A;  1EZV I;  5DJT B;  2E75 B;  2I1K A;  3EJB A;  3E7K A;  3G4S P;  3Q1M A;  4EYY Q;  1N73 B;  3G28 A;  3GZM A;  2J58 A;  1KYO H;  2JGP A;  1NU1 D;  1L0N G;  3H47 A;  1WT6 A;  2BAS A;  2IPP A;  2QE7 H;  1RO2 A;  2KG8 A;  1MZ8 A;  2V7Q H;  5B66 E;  1AQT A;  1JNM A;  1K9M Q;  1L0N D;  1NKZ B;  5AW4 B;  2JAZ A;  2M5A B;  1KB9 H;  2PP6 A;  2QM7 A;  1FBM A;  3FX0 A;  5KP7 B;  4IZ6 A;  4XFX A;  1EMV A;  1D7M A;  1L0I A;  2MF4 A;  2K37 A;  1URQ D;  2DGY A;  5F2K A;  2FYU K;  2HOD A;  4MN4 C;  2BHV A;  2IYO A;  4XFZ A;  4IL6 H;  1KV4 A;  3TGU D;  4GOF A;  4I1L A;  1WMK A;  1GL2 B;  2VRS A;  1H0T A;  3VOP A;  5F2N A;  2FYU J;  1FZC B;  4D6T E;  2ONT A;  1GTW A;  3PHL A;  2ZYG A;  2AXT H;  5KAF H;  4H13 D;  1IFD A;  5CBN A;  2GZF A;  4Y99 B;  1F80 D;  1NJI Q;  2N50 A;  3H1I G;  3OJA B;  1URQ A;  1HH0 A;  1VF5 B;  3DS4 A;  1NTZ G;  1HTL C;  1AQ5 A;  1FOS E;  4ZMD A;  1PIX A;  1A02 J;  3RK2 D;  3H1I D;  2WPS A;  1PV3 A;  2XKM A;  2HYN A;  2YMY A;  1NTZ D;  2E76 C;  2L22 A;  2B88 A;  1LJ2 A;  3GG2 A;  3RBZ A;  1E79 H;  1EC5 A;  3HD7 B;  1BGY G;  1VQM P;  2PEN A;  2A45 G;  1NTM G;  1AA0 A;  1PZQ A;  2GZG A;  5L8R J;  2B89 A;  1RY3 A;  5B5E H;  3L75 E;  1SQV K;  2C9L Y;  2XNX A;  1HGV A;  4RO0 A;  2ERH A;  3A5T A;  2CGQ A;  3FGA D;  4W80 A;  2WSE J;  2QEX P;  3TNU B;  2E74 D;  1SQV J;  2WSF H;  1HGZ A;  2Q1K A;  1KYO I;  4ASW A;  2LF4 A;  1LP1 B;  1PGO A;  2Q3E A;  5K5G B;  3K5B A;  5E79 E;  1SFC C;  2MJZ A;  2EHS A;  1R5S A;  1QRJ A;  2C9N Y;  1J1E B;  4N78 D;  4U0D A;  1KB9 I;  1SQQ G;  2KOS A;  2LIW A;  1Y8A A;  2H8P D;  1PEM A;  1SQV E;  4YTP C;  4W7Z A;  1R5L A;  2G8Y A;  3H1J J;  1OWA A;  3CWB E;  5CCH D;  1AFO A;  2V7Q J;  2N5I A;  3U1A A;  1FZF A;  3GLM A;  3SWY A;  3G26 A;  3CCR P;  1ACP A;  4U3F J;  2P1J A;  4K35 A;  1Z6M A;  4U0E A;  3H1K J;  3O6Q B;  1RF1 C;  1OW6 A;  2FQ1 A;  3A2A A;  3AEA C;  2BEZ F;  2XZ0 D;  1A43 A;  1BSN A;  2NPS C;  1UIX A;  1AV1 A;  2X2B A;  2KOG A;  1RE3 C;  3DS0 A;  2H43 A;  1N86 A;  3V2N A;  1T3U A;  1T8K A;  2E76 B;  4JYB A;  5CCH A;  1KMI Z;  2XZR A;  3L35 A;  5DJU B;  5KTB A;  2LKM A;  1NTK E;  2QG4 A;  4COC A;  4U3F E;  4IOI H;  5AW3 B;  1IJD B;  3H1K E;  1VKU A;  1X3O A;  2W27 A;  3WUU A;  3CC2 P;  1CEI A;  1KC8 Q;  1HY8 A;  1SQP E;  3L74 G;  2N9B A;  1K8A Q;  4BRY A;  5KLV K;  3EFF K;  1L4A C;  3CX5 E;  1FC2 C;  4LC1 A;  1M6N A;  3HTK A;  1PGP A;  3RK3 C;  2JR8 A;  5KKZ B;  3H1H J;  2L5G B;  2WSC H;  3M0D C;  3DS5 A;  4BPF A;  1Q2N A;  3I56 P;  1EXI A;  3DTJ A;  2BCC D;  1LT9 C;  4UB8 H;  2P9X A;  4L74 A;  4NPF X;  3V4W A;  1JMM A;  4GT1 A;  5APV A;  3AE2 C;  1USD A;  2L9F A;  1PGJ A;  3EQ2 A;  1N7L A;  1FZE A;  4U0A A;  2ZAE B;  3L70 G;  1XTG B;  3VP9 A;  1M1K Q;  1KIL D;  1UII A;  1KYO D;  2IZ0 A;  3BCC E;  4WVZ A;  3L70 D;  4QNB A;  3GJN A;  1MV8 A;  2AEF A;  5CHX A;  4DJG A;  1M1J A;  3P8C D;  2IBZ E;  2I8D A;  5KLV E;  3CCV P;  3SFD C;  3AEC C;  4JBZ A;  1RF0 C;  3D70 A;  1DV5 A;  1SQX K;  2JWD A;  3KHU A;  3VP8 A;  1ZR2 A;  4DG9 A;  1KN7 A;  3B5N D;  2LL8 A;  2QIW A;  1YYC A;  3WBH A;  1CSB A;  3L73 J;  2WSS H;  1J1D B;  2JO1 A;  1RE4 A;  2PRR A;  1VQL P;  2R5B A;  1BAJ A;  2PEQ A;  1JEK A;  2PEK A;  1Y9B A;  5JPA A;  3RK3 D;  1KIL A;  2NPS B;  2FFD B;  3L71 G;  1M57 D;  3RL0 C;  2OTK E;  3P7K A;  1T3J A;  1N7S D;  3CLQ A;  2HPC B;  1IK9 A;  5AVU B;  2D2C D;  3T97 B;  4U0C A;  3HUS C;  1BDC A;  5I4T G;  2JDI H;  3B5N A;  5CZD B;  3L73 E;  1JY2 P;  1SQX E;  1SVF A;  1S5L H;  5APX A;  3NY7 B;  3LW5 J;  4L73 A;  4AYC A;  1FZA A;  3ZDM A;  1LWU B;  1OVR A;  2PEO A;  4C46 A;  2N1T D;  2B9B A;  4U0B A;  3CL3 D;  1IFP A;  1PP9 E;  4PV1 C;  2Y0C A;  1L4A B;  3H1H D;  1OW8 A;  2PGD A;  1LTI C;  2KLV A;  2VLQ A;  1N7S A;  2KI7 B;  2K94 A;  2PEI A;  4H0L B;  4EIJ A;  1NU1 K;  3F89 A;  3ABV C;  4LLH A;  2R3S A;  2WT7 A;  1GPJ A;  2R5D A;  3HRN A;  4EOT A;  3H32 A;  3LID A;  3DS1 A;  1L0N K;  2AEJ A;  2CNR A;  4R4M A;  2MR7 A;  5HGM A;  2AFE A;  2N1T A;  3MHV A;  1S72 P;  3H1L G;  2ZFC A;  5F2O A;  3TDK A;  2P67 A;  3RL0 D;  2KB7 P;  1L0N J;  4IFD K;  5GTI E;  5CCG D;  1M56 D;  2JKV A;  1CZQ A;  3H1L D;  3HE4 A;  2FVA A;  2GZI A;  1S9K D;  1H8A A;  2P2U A;  5HV8 A;  2QRX A;  2K3R A;  4HJG H;  4GR6 A;  5AVR B;  2OYH A;  1JY3 P;  1NU1 E;  2KNC A;  1BCC G;  2QJK B;  4OGQ B;  2OYI B;  5CJ4 A;  2XXM A;  1L0N E;  4ZKU A;  3AE3 C;  2A06 G;  5CCG A;  2PFX A;  4C7N A;  3MZW B;  1DIP A;  1GK4 A;  2W83 C;  4XRO A;  2A06 D;  4UB6 E;  1ZME C;  2EHT A;  1FS0 E;  1URQ C;  2E75 D;  1NTZ K;  1JM0 A;  1LTJ A;  3TGU E;  4PH1 A;  2O1K A;  1LTS C;  3EJD A;  1CI6 A;  2WVR A;  3H1I J;  3Q5R A;  2XV6 A;  1NTZ J;  3HE5 B;  4PV1 B;  3KPE A;  3A0H H;  2JQ4 A;  2HFE D;  4XFJ A;  2Z5H A;  1E5W A;  2KLU A;  2ROQ A;  3I5C A;  4QMA A;  1E0H A;  3G1G A;  3CE7 A;  1BXI A;  4H13 C;  2IFN A;  2POH A;  2FYN C;  3WUV A;  2E1M A;  1U57 A;  2RMZ A;  2ZT9 B;  3L72 G;  3L36 A;  2Y9Z A;  2G3A A;  2YO2 A;  2K2Q A;  3V5B A;  4R4L A;  2FKW B;  3RGU A;  3WU2 H;  3M91 A;  3M9H A;  1ZW0 A;  5GTH E;  4IFM A;  1DD4 A;  2LR2 A;  3H1I E;  1N73 A;  3RK2 C;  3CPW O;  4PJ0 H;  2YKO A;  2W6A A;  4DZO A;  4N6J A;  2HLO A;  1NH4 A;  1GL2 D;  1NO4 A;  3DPH A;  1DEE G;  2FQ0 A;  1SS1 A;  2ZYA A;  1LTT C;  1NVO A;  2EG5 A;  3B4S A;  3RG2 A;  2XZ1 C;  2YIU B;  2XU6 A;  3QWO C;  2W6J H;  3BAS A;  4WY4 B;  1X9V A;  3H4E A;  1K73 Q;  5AVS B;  1RQV A;  1EDJ A;  2GDX A;  4XRQ A;  2E74 C;  2WPT A;  1H0T B;  2VLN A;  1VF5 D;  5APW A;  5AVX B;  3MIW A;  4PD4 E;  1GD2 E;  1EZV E;  1HBW A;  3C9I A;  2KZJ A;  1GL2 A;  2YMK A;  3A0B H;  2BQ1 E;  3GW6 A;  1D1D A;  5TIS H;  3GF7 A;  3CD6 P;  3JSV C;  2BUO A;  4N78 E;  2N9Y B;  5BVZ A;  3BRT B;  1OMI A;  2ZXE B;  2PNG A;  1URQ B;  1E6J P;  1OZH A;  3II6 A;  5AVW B;  2FYU E;  3PTZ A;  3F5H A;  4EI2 A;  4AQR D;  5APS A;  3WMM 0;  5CCH C;  3AE5 C;  1ZRT E;  2JU1 A;  1RH5 B;  4H44 B;  1JY2 O;  4L75 A;  3P32 A;  3L37 A;  2K0D X;  3CCJ P;  1BGY D;  3CXH H;  1BE3 G;  2FYN B;  3HZQ A;  1NTM D;  2M8P A;  5KAI H;  2RH0 A;  1OX3 A;  5AW8 B;  3C8V A;  1BE3 D;  1JOC A;  3O8Z A;  5AW2 B;  1USE A;  4KJM A;  1UNK A;  2HG5 D;  4WBA A;  2FAE A;  4JF7 A;  3L74 J;  3M0A A;  2OGU A;  3CCS P;  3RK2 B;  4HKG A;  1H88 A;  3U43 A;  1YQ4 C;  3AEG C;  1HF9 A;  4RES B;  2WWW A;  4D6T G;  3TNU A;  1SP4 A;  2BCC J;  2O1J A;  2MVV A;  4JQ0 D;  4ASV A;  2XDJ A;  1KD1 Q;  3V2P A;  3KQG A;  3VMA A;  3CCM P;  4ZKP A;  1YIT P;  1HJ0 A;  1YJ9 P;  1YIJ P;  1SQQ D;  1M1J C;  3L70 J;  1T8Z A;  4KT0 J;  3AE6 C;  3EJE A;  1AF8 A;  2BCC E;  1GZL A;  2P58 A;  1EIA A;  3W68 A;  1PL5 A;  3AEE C;  1U7J A;  4AUW A;  1QLE D;  2LPK A;  1JY3 O;  2MVU A;  4N3Y B;  2B87 A;  1NGM B;  1HWT C;  1RE4 C;  2FVE A;  4I6M C;  2R32 A;  3V6I A;  1XTC C;  1PGQ A;  1IUQ A;  3B5I A;  5AVT B;  4M0I A;  3L75 G;  1IFI A;  3G6E P;  1KIL E;  2IYP A;  1KYO E;  1KIL C;  3GF3 A;  5H2F H;  3H1J E;  2K5X A;  1MFZ A;  3L75 D;  3P8C E;  1IFJ A;  3JC2 2;  5DCK A;  3UIA A;  1RQU A;  1G2C B;  4OH8 B;  1GW3 A;  1FOS F;  4PJ0 E;  3L71 J;  3U1C A;  1NKN A;  1SQB G;  1KB9 E;  3B5N C;  1YJN P;  4HH2 A;  2JYL A;  2NZ2 A;  4XFY A;  5BU5 A;  3OA7 A;  2QJP C;  4F37 A;  1SQB D;  3MGN A;  3GHG C;  1NYH A;  1AVY A;  3L74 D;  5AW9 B;  4BRY B;  4IL6 E;  2M8L A;  3CXH I;  3RK3 E;  1DH3 A;  4TT3 H;  3IAO A;  1KFN A;  3S1K A;  3HTK B;  1IMP A;  3G71 P;  1A02 F;  1N7S C;  2BEQ D;  5CBO A;  2ZJS E;  3CWB G;  1JCD A;  2D2C C;  2H7H A;  2AXT E;  5KAF E;  1OR5 A;  1P84 H;  2Y9Y A;  4Z1M H;  3CWB D;  1SFC B;  2H89 C;  2JEE A;  2LKI A;  2KOO A;  3KZI H;  2AVA A;  1PPJ E;  3FXD A;  4DCK A;  2KGC A;  1VQP P;  2J59 M;  5C39 A;  1GK6 A;  2AFD A;  1LT1 A;  1ZXG A;  2N1T C;  3CC7 P;  2C0W A;  4ZNC A;  3H1H E;  3MUD A;  2QJY C;  3M9B A;  2CPS A;  2NRG A;  3AE7 C;  1M90 Q;  1MKM A;  1KQS O;  3H1L J;  2WSF J;  3JCU H;  2AEM A;  3C1L A;  1KOR A;  2KUB A;  2JO0 A;  3VYI A;  4IPY A;  1IK7 A;  1NTK G;  1TU3 F;  4U3F G;  2OYH C;  2FHS C;  1YBK A;  3CC4 P;  2MD9 A;  1RF1 B;  5B5E E;  1NTK D;  2MKV A;  2KGA A;  3CMA P;  1SQP G;  2MR8 A;  3KYQ A;  1ZN5 A;  4HKZ H;  1NWQ A;  1VQ8 P;  1BSH A;  2YKP A;  1KIL B;  2ITA A;  2Q3I A;  1BCC J;  4B86 A;  1SQP D;  5CCG C;  2E5T A;  4BPH A;  2OTJ P;  3L71 D;  2FXP A;  2Q7C A;  1NOH A;  1ZR4 A;  1S9K E;  4PH0 A;  3CX5 D;  2FFD A;  4I7Z C;  3CCQ P;  2HPC A;  2QA4 P;  2ZXX A;  3T97 A;  2WIT A;  4H0L D;  1LTJ C;  3GHG A;  3QH9 A;  2W8Z A;  2CG5 B;  5AW0 B;  1G1J A;  3IFM A;  2KXP B;  1FDI A;  2PY8 A;  3HYB A;  3DS2 A;  1LWU A;  3Q20 A;  3RK3 B;  3BCC G;  4NPD A;  5KLI C;  2YXR B;  1T2K D;  2GA1 A;  3RL0 g;  2IBZ G;  4K3A A;  5KLV G;  3BCC D;  1LT9 B;  2EIA A;  2AXC A;  2Z5I A;  4NPE A;  1JTH A;  2IBZ D;  4TLF A;  2MY5 A;  2J5U A;  2WT7 B;  2O3J A;  2JU2 A;  3CXH D;  2E75 C;  2O01 H;  3H32 B;  1AUM A;  2L6E A;  1N73 C;  3V2R A;  3G0V A;  1P84 I;  3H0D A;  3EWK A;  1AJY A;  1J2J B;  1X22 A;  2KS1 B;  1NQ4 A;  3M06 A;  4LGD E;  4OGQ D;  2M3B A;  5AVQ B;  1L0L G;  2K9J A;  4PWV B;  1PEU A;  3NXS A;  3VMX A;  2FYZ A;  2WSC J;  1JUN A;  1PEQ A;  1L0L D;  2N5H A;  3PH0 A;  3CCU P;  4I2L C;  4KHX A;  3G29 A;  1VQ7 P;  3AED C;  1YJW P;  1OVV A;  1SQX G;  1W2E A;  3NFQ A;  2IX7 C;  5KJ7 D;  1BCC D;  2AF8 A;  1PP9 G;  4PXH B;  2L91 A;  3SWK A;  3AEF C;  4BWN A;  1GL2 C;  3RL0 B;  1FZC C;  2OYI A;  1NAF A;  2UWJ E;  1PP9 D;  3VMY A;  5APU A;  1U7M A;  2JYG A;  2R44 A;  3HUS B;  3AE9 C;  2PEJ A;  4UB8 E;  5E79 H;  2M0B A;  5AW7 B;  4M3L A;  2EFJ A;  4I7Z B;  2WPV B;  1IMQ A;  2ZT9 D;  4Y99 C;  4CA3 A;  4C7R A;  3PJS K;  7CEI A;  1QVG O;  2FBW C;  1QL2 A;  1X79 B;  2WSE H;  1VF5 C;  3TF5 A;  5KJ7 A;  3S4R A;  3E1I A;  4GOE A;  2ZVO B;  2LML A;  3M9Q A;  1NTM K;  4DT0 A;  2NO8 A;  3MP7 B;  1LTG C;  4H2W C;  1M7L A;  1VQ4 P;  1BGY J;  3AE4 C;  1BDD A;  4H2X C;  5AW6 B;  1IO4 A;  4U7J A;  3RBX A;  4GOD A;  3E2D A;  1NTM J;  1QEX A;  3L72 D;  2GM4 A;  1BE3 J;  4YPC A;  2XV5 A;  4OWF A;  2KK7 A;  4WY4 D;  1S3J A;  2KP8 A;  1NTZ E;  1JO5 A;  1NU1 G;  1YQ3 C;  2RN0 A;  2YNY A;  1VDF A;  1ZOY C;  3VRL C;  2FXM A;  2DW3 A;  1VPC A;  2R3C A;  3IF4 A;  3KXD A;  1G1I A;  1OIP A;  2L4B A;  1KFM A;  1BGY E;  4O9B A;  4D6T J;  2M5A A;  5HVC A;  1X0T A;  2ZYD A;  1N8R Q;  1NTM E;  1SQQ K;  2HOD B;  1BE3 E;  1P84 D;  3Q5S A;  3PRJ A;  1FDO A;  1S5L E;  1J1E C;  1QX8 A;  3TGU G;  1H89 A;  1SQQ J;  3ITK A;  2CQ8 A;  2O01 J;  3GKL C;  4WY4 A;  1L0H A;  3CX5 H;  2Q6Q A;  2KW2 A;  3SWF A;  1FR2 A;  1MZ9 A;  3A3Y B;  3VTP C;  2N98 A;  1FZC A;  2GUS A;  2WZ7 A;  1ZV8 A;  3S9O A;  3HD7 D;  4IL6 X;  2LXC B;  4H44 D;  1EDK A;  2KGD A;  3Q2Y A;  1QGK B;  3R2P A;  1ZLL A;  4L76 A;  1QVF O;  4JPZ B;  3FXE A;  1SQQ E;  3BAT A;  2DNW A;  2O01 N;  1W5C E;  3L75 J;  2RKL A;  2FY8 A;  1MUU A;  1HJB A;  5AVY B;  1R8E A;  4GR2 A;  1SQB K;  2QSI A;  2OYO A;  1KQG B;  1ZMB A;  4H13 B;  1EDL A;  3HD7 A;  2KYV A;  2FXO A;  2K93 A;  4GDO A;  2Y0D A;  1ZP0 C;  1SQB J;  3CCL P;  2I1J A;  3VN0 A;  3GMA A;  2IZ1 A;  2KOP A;  3NMD A;  1OXZ A;  1JY2 N;  5APT A;  5AW5 B;  3D71 A;  2VLO A;  5EJD A;  1EZV G;  3LIE A;  4IFF A;  2Y0E A;  1EOQ A;  1KQL A;  5KKZ C;  4HB1 A;  4D6T D;  1VQ5 P;  4PD4 D;  3G9R A;  3OAK A;  2KOR A;  1DX7 A;  1EZV D;  3CWB J;  2KZI A;  2V4H A;  3VMZ A;  1LP1 A;  2XT1 A;  1SQB E;  1VQO P;  2GZE A;  1NHL A;  1W2B O;  3L74 E;  5EFW B;  1CW5 A;  2OTL P;  4Y28 J;  3EFG A;  3PP5 A;  1S2E A;  3MUD C;  1K30 A;  2E74 B;  2FYU G;  3WUT A;  2N6Y A;  2W90 A;  3PLN A;  2GDW A;  4W7Y A;  2P7J A;  2Q9I A;  2FYU D;  3A0H E;  3GZL A;  1GMJ A;  1Q90 D;  3FWN A;  2E76 D;  4COP A;  4YXW H;  2KGE A;  5APQ A;  1NTK K;  3CX5 I;  1LGH B;  4BXL A;  2QVA A;  1K05 A;  2E5Y A;  3W67 A;  2B87 B;  1RHZ B;  1ZRT D;  2KG9 A;  3CXC O;  3LW5 H;  1SQP K;  2WPQ A;  1NTK J;  2M8R A;  3WU2 E;  2L0Q A;  2Q5U A;  2KR5 A;  1J1D C;  3O6Q A;  2WQY C;  3L70 E;  1JMB A;  1QL1 A;  3B71 A;  4XE5 B;  2VSQ A;  2KSE A;  2KOQ A;  1KQF B;  1SQP J;  1FU1 A;  4RKU J;  5GTI H;  2YKQ A;  2FFD C;  1JY3 N;  4U0F A;  5CMZ A;  1LTA C;  1DD3 A;  1G2C A;  1KTM A;  2K1A A;  1Y47 A;  3MGE A;  1ZNV A;  2IBZ I;  2XND H;  1SFC D;  1VQK P;  2KIK A;  2OQQ A;  2Z44 A;  4WYM A;  1N2D C;  2OAR A;  2LIU A;  2WMM A;  3BVH A;  1LWU C;  2SPZ A;  1SQV G;  3B8E B;  2FVF A;  5APY A;  1OW7 A;  2CK3 H;  3L71 E;  2CPB A;  4WWI A;  1GDT A;  1Q82 Q;  3N4X A;  1SQV D;  3U59 A;  5CJ0 A;  3BCC J;  5EW5 E;  1VHN A;  1HQB A;  3A0B E;  1OFC X;  2BCC G;  1S4X A;  5M1B A;  4UB6 H;  2K88 A;  5KLV J;  3NTN A;  5TIS E;  4BPG A;  3I55 P;  4YXD C;  2QNW A;  4H0L C;  3USS A;  1VQ9 P;  1X8Y A;  2ZVN B;  1VQ6 P;  1SFC A;  1JJ2 O;  4WB4 A;  1K04 A;  4XA4 A;  4EDF A;  2LTE A;  1YHQ P;  2JP3 A;  2KG6 A;  3P05 A;  1KLP A;  1M1J B;  1L0L K; 
#chains in the Genus database with same CATH homology
 1RO0 A;  3CXC O;  3CMA P;  4U0D A;  1YJN P;  3CCS P;  3DS5 A;  4GR2 A;  1VQ8 P;  1PEQ A;  1Q7Y Q;  2JYL A;  3I56 P;  1ZMB A;  4XFY A;  3DTJ A;  2PEO A;  3H4E A;  1PEM A;  3CCU P;  2P9X A;  4U0B A;  1K73 Q;  2OTJ P;  3VRL C;  1YI2 P;  3G1I A;  2KOD A;  4XRO A;  3G29 A;  1NJI Q;  1VQ7 P;  3CME P;  3G21 A;  4PH0 A;  1YJW P;  4XRQ A;  1M74 A;  3CCL P;  2M8L A;  5BS2 A;  3DS4 A;  1KD1 Q;  1A8O A;  2Z46 A;  4U0A A;  3RG6 C;  3CCM P;  4U0F A;  3G26 A;  1YIT P;  3CCQ P;  3CCR P;  3CCE P;  2QA4 P;  1M1K Q;  4PH1 A;  3G71 P;  1YJ9 P;  1VQN P;  3G4S P;  2BQ1 E;  2PEI A;  1N8R Q;  1YIJ P;  3G28 A;  4U0E A;  4QNB A;  1D1D A;  3CD6 P;  3MGE A;  2XV6 A;  5BS1 A;  2BUO A;  3H47 A;  3CCV P;  1VQK P;  1EOQ A;  3DS1 A;  1VQM P;  2JYG A;  1RO2 A;  2PY8 A;  2Z44 A;  3HYB A;  5HGL A;  1VQ5 P;  3DS2 A;  1A43 A;  4WYM A;  1Q86 Q;  2PEJ A;  3G1G A;  2OAR A;  2Z45 A;  2PEN A;  3Q20 A;  1K9M Q;  5HGM A;  1E6J P;  2EFJ A;  3DS0 A;  2XT1 A;  1S72 P;  1EIA A;  1VQP P;  5F2O A;  3WBH A;  2E1M A;  1VQO P;  2M8N A;  2EIA A;  1QVG O;  3CC7 P;  1Q82 Q;  1W2B O;  2CWO A;  1M6E X;  1VQL P;  2OTL P;  1BAJ A;  2PEQ A;  2QEX P;  4COC A;  1M90 Q;  1KQS O;  2PEK A;  4XFX A;  1K30 A;  1IUQ A;  5HGO A;  3B5I A;  5JPA A;  4M0I A;  2DGY A;  5F2K A;  1PEO A;  3G6E P;  2BHV A;  3CPW O;  3CCJ P;  1QVF O;  1AUM A;  4XFZ A;  3CC2 P;  4GR6 A;  3I55 P;  2L6E A;  3G0V A;  1KC8 Q;  3M1M A;  5HGN A;  2JO0 A;  1VQ9 P;  1K8A Q;  3HZQ A;  2LF4 A;  4IPY A;  3OW2 O;  3H0D A;  1Q81 Q;  1VQ4 P;  1VQ6 P;  1JJ2 O;  2M8P A;  3DPH A;  5DCK A;  4COP A;  3NTE A;  4U0C A;  5F2N A;  2PEM A;  3CC4 P;  2ONT A;  3E2D A;  1YHQ P;  1M6N A;  1QRJ A;  5I4T G;  2EG5 A;  3DS3 A;  3P05 A;  1PEU A;  3LRY A;  2XXM A;  1RNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...