3EJDA

Crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejdA00
2KOOA 2KORA 2N5IA 2LIUA 2MY5A 2KGEA 2FQ0A 4CA3A 1L0IA 2FADA 2N50A 2QNWA 2CGQA 2LMLA 2N6YA 1VKUA 2DNWA 2VSQA 2FQ2A 2KG8A 4BPHA 1OR5A 2CNRA 2JGPA 4BPGA 2K2QA 2GDYA 2LOLA 1AF8A 2FQ1A 2K0XA 3LMOA 2KOPA 2MR7A 2AF8A 2LIWA 4PWVB 4H2XC 2FVFA 2KOSA 2LL8A 2JQ4A 2MF4A 2L9FA 2KOQA 2KGDA 2L4BA 2MVUA 2AVAA 1L0HA 5KP8B 4PXHB 2PNGA 5HV8A 4H2YC 2K94A 3GZLA 4H2WC 2KW2A 2EHTA 2K93A 2ROQA 5EJDA 2X2BA 3NY7B 3RG2A 2FVEA 2KG6A 2AFDA 2KGAA 4IZ6A 2XZ1C 4R0MA 2N98A 2K0YA 2K92A 2GDXA 4DG9A 1DNYA 2MD9A 2JU1A 2MR8A 2KR5A 3GZMA 2FVAA 2FACA 3EJBA 2CG5B 1NQ4A 1T8KA 2FAEA 5HVCA 1HQBA 3EJDA 2XZ0D 2KG9A 2GDWA 2EHSA 2LKIA 1ACPA 2AFEA 1X3OA 2LTEA 1F80D 2N5HA 2L0QA 1HY8A 4MRTC 2CQ8A 4NEOA 2L22A 5KP7B 2LPKA 4BPFA 2KGCA 5KP6B 2M5RA 4HKGA 2N6ZA 2KWLA 1KLPA 1DV5A 2FHSC 3CE7A 5CZDB 2JU2A 3EJEA 2MVVA
chains in the Genus database with same CATH superfamily
3CCVP 2N5IA 2LIUA 2FQ0A 3CXCO 3B5IA 3I55P 1L0IA 3CCJP 2CGQA 2LMLA 1KD1Q 1KC8Q 2DNWA 2KG8A 2CNRA 1K9MQ 1E6JP 1UJZA 5F2OA 1GXGA 1AF8A 3LMOA 2KOPA 4PH1A 2AF8A 4H2XC 3H0DA 2FVFA 4COCA 2L9FA 2L4BA 2AVAA 5KP8B 4PXHB 1A43A 4H2YC 2K94A 3GZLA 2M8PA 2KW2A 2EHTA 5EJDA 3RG2A 4UHPB 3CMEP 2PEMA 4M0IA 1DNYA 4U0CA 5BS2A 2FVAA 2FACA 1M74A 2Z44A 2VLOA 3G21A 1W2BO 2PENA 2CG5B 3G26A 1EIAA 3CCRP 1IUQA 3Q20A 2GZIA 3DS0A 2JAZA 1Z6MA 1VQ9P 2N5HA 1K73Q 3DS2A 4GR2A 1VQ8P 2GZEA 2GZJA 3DS3A 3VRLC 4F37A 3CC7P 2N6ZA 2E1MA 2K5XA 1VHNA 1M90Q 2FHSC 3GKLC 1VQPP 2L6EA 1RNIA 3CMAP 1YHQP 2FADA 1M6EX 2QNWA 1VQMP 5JPAA 2JGPA 1EMVA 3MGEA 2JBGA 2LOLA 2FQ1A 4U0AA 4U0FA 1M6NA 2K0XA 3G29A 2LIWA 3LRYA 2LL8A 1YJNP 2JQ4A 2KOQA 2MVUA 1L0HA 2ERHA 2PEOA 1E0HA 2K93A 2Z46A 2CWOA 3NY7B 2KG6A 1K8AQ 5HGNA 2XZ1C 1VQ5P 4R0MA 4U0DA 2K92A 2GDXA 2EIAA 2MD9A 2JU1A 2K0DX 1FR2A 2VLPA 2PEJA 1RO2A 1N8RQ 2JYLA 3DPHA 1QVGO 2XZ0D 3G0VA 2GDWA 2LF4A 1VQ7P 3CC4P 1ACPA 1X3OA 4MRTC 2CQ8A 4NEOA 1NJIQ 2JB0A 3E2DA 4XFXA 5KP6B 3CPWO 1VQKP 2PEKA 1KLPA 2M8NA 3CE7A 3G4SP 4GR6A 2KODA 2KOOA 1M1KQ 4XRQA 2KGEA 1IMQA 2NO8A 1YITP 2FQ2A 4BPHA 2GYKA 2ONTA 1EOQA 1ZMBA 3DS5A 2EFJA 2GDYA 2MR7A 4PWVB 2KOSA 1Q81Q 2KGDA 3CCEP 4IPYA 4XFYA 4WYMA 1A8OA 2Z45A 1BAJA 2XXMA 5EW5E 2ROQA 1VQLP 3CD6P 2X2BA 2VLNA 1K30A 2OTJP 4XROA 2BHVA 2AFDA 3RG6C 4IZ6A 5F2KA 1S72P 5DCKA 2GZGA 1CEIA 3EJBA 4U0EA 4QKOA 5BS1A 3CC2P 2OTLP 2FAEA 3G71P 5HVCA 1HQBA 3M1MA 3H4EA 2KG9A 1YJ9P 4QNBA 2EHSA 2PEQA 1YI2P 2LKIA 2AFEA 1VQNP 2L0QA 3NTEA 2PY8A 2LPKA 4BPFA 2KGCA 3HZQA 1GXHA 2XV6A 2WPTA 3CCUP 3G1GA 3GJNA 3G28A 2JYGA 2JU2A 3EJEA 2MVVA 2JO0A 3I56P 2KORA 5HGLA 1AYIA 1KQSO 2MY5A 7CEIA 4CA3A 2N50A 1VQ4P 3P05A 2N6YA 1VKUA 3CCQP 2VSQA 1VQ6P 3OW2O 1IMPA 1OR5A 1YJWP 4BPGA 2K2QA 2OARA 1RO0A 1YIJP 1ZNVA 3DTJA 1GPJA 1Q86Q 2MF4A 3DS4A 1VQOP 1AUMA 3G6EP 2PNGA 5HV8A 3WBHA 1UNKA 2GZFA 3G1IA 4H2WC 3CCLP 2BUOA 2FVEA 3H47A 1QVFO 2KGAA 2N98A 2PEIA 3CCSP 2K0YA 1Q82Q 4PH0A 4DG9A 2P9XA 5HGOA 4U0BA 2MR8A 2KR5A 2QEXP 3GZMA 3HYBA 2DGYA 1JJ2O 1NQ4A 1T8KA 3EJDA 1QRJA 3CCMP 1Q7YQ 3U43A 2XT1A 1MZ8A 1F80D 2LTEA 5F2NA 5I4TG 3B4QA 1HY8A 4XFZA 5KP7B 2L22A 1D1DA 3DS1A 2M5RA 5HGMA 4HKGA 1BXIA 2VLQA 2KWLA 2QA4P 1DV5A 2M8LA 2EG5A 5CZDB 4COPA
chains in the Genus database with same CATH topology
2KOOA 2KORA 2N5IA 2LIUA 2MY5A 2KGEA 2FQ0A 4CA3A 1L0IA 2FADA 2N50A 2QNWA 2CGQA 2LMLA 2N6YA 1VKUA 2DNWA 2VSQA 2FQ2A 2KG8A 4BPHA 1OR5A 2CNRA 2JGPA 4BPGA 2K2QA 2GDYA 2LOLA 1AF8A 2FQ1A 2K0XA 3LMOA 2KOPA 2MR7A 2AF8A 2LIWA 4PWVB 4H2XC 2FVFA 2KOSA 2LL8A 2JQ4A 2MF4A 2L9FA 2KOQA 2KGDA 2L4BA 2MVUA 2AVAA 1L0HA 5KP8B 4PXHB 2PNGA 5HV8A 4H2YC 2K94A 3GZLA 4H2WC 2KW2A 2EHTA 2K93A 2ROQA 5EJDA 2X2BA 3NY7B 3RG2A 2FVEA 2KG6A 2AFDA 2KGAA 4IZ6A 2XZ1C 4R0MA 2N98A 2K0YA 2K92A 2GDXA 4DG9A 1DNYA 2MD9A 2JU1A 2MR8A 2KR5A 3GZMA 2FVAA 2FACA 3EJBA 2CG5B 1NQ4A 1T8KA 2FAEA 5HVCA 1HQBA 3EJDA 2XZ0D 2KG9A 2GDWA 2EHSA 2LKIA 1ACPA 2AFEA 1X3OA 2LTEA 1F80D 2N5HA 2L0QA 1HY8A 4MRTC 2CQ8A 4NEOA 2L22A 5KP7B 2LPKA 4BPFA 2KGCA 5KP6B 2M5RA 4HKGA 2N6ZA 2KWLA 1KLPA 1DV5A 2FHSC 3CE7A 5CZDB 2JU2A 3EJEA 2MVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOO A;  2KOR A;  2N5I A;  2LIU A;  2MY5 A;  2KGE A;  2FQ0 A;  4CA3 A;  1L0I A;  2FAD A;  2N50 A;  2QNW A;  2CGQ A;  2LML A;  2N6Y A;  1VKU A;  2DNW A;  2VSQ A;  2FQ2 A;  2KG8 A;  4BPH A;  1OR5 A;  2CNR A;  2JGP A;  4BPG A;  2K2Q A;  2GDY A;  2LOL A;  1AF8 A;  2FQ1 A;  2K0X A;  3LMO A;  2KOP A;  2MR7 A;  2AF8 A;  2LIW A;  4PWV B;  4H2X C;  2FVF A;  2KOS A;  2LL8 A;  2JQ4 A;  2MF4 A;  2L9F A;  2KOQ A;  2KGD A;  2L4B A;  2MVU A;  2AVA A;  1L0H A;  5KP8 B;  4PXH B;  2PNG A;  5HV8 A;  4H2Y C;  2K94 A;  3GZL A;  4H2W C;  2KW2 A;  2EHT A;  2K93 A;  2ROQ A;  5EJD A;  2X2B A;  3NY7 B;  3RG2 A;  2FVE A;  2KG6 A;  2AFD A;  2KGA A;  4IZ6 A;  2XZ1 C;  4R0M A;  2N98 A;  2K0Y A;  2K92 A;  2GDX A;  4DG9 A;  1DNY A;  2MD9 A;  2JU1 A;  2MR8 A;  2KR5 A;  3GZM A;  2FVA A;  2FAC A;  3EJB A;  2CG5 B;  1NQ4 A;  1T8K A;  2FAE A;  5HVC A;  1HQB A;  3EJD A;  2XZ0 D;  2KG9 A;  2GDW A;  2EHS A;  2LKI A;  1ACP A;  2AFE A;  1X3O A;  2LTE A;  1F80 D;  2N5H A;  2L0Q A;  1HY8 A;  4MRT C;  2CQ8 A;  4NEO A;  2L22 A;  5KP7 B;  2LPK A;  4BPF A;  2KGC A;  5KP6 B;  2M5R A;  4HKG A;  2N6Z A;  2KWL A;  1KLP A;  1DV5 A;  2FHS C;  3CE7 A;  5CZD B;  2JU2 A;  3EJE A;  2MVV A; 
#chains in the Genus database with same CATH topology
 3CCV P;  2N5I A;  2LIU A;  2FQ0 A;  3CXC O;  3B5I A;  3I55 P;  1L0I A;  3CCJ P;  2CGQ A;  2LML A;  1KD1 Q;  1KC8 Q;  2DNW A;  2KG8 A;  2CNR A;  1K9M Q;  1E6J P;  1UJZ A;  5F2O A;  1GXG A;  1AF8 A;  3LMO A;  2KOP A;  4PH1 A;  2AF8 A;  4H2X C;  3H0D A;  2FVF A;  4COC A;  2L9F A;  2L4B A;  2AVA A;  5KP8 B;  4PXH B;  1A43 A;  4H2Y C;  2K94 A;  3GZL A;  2M8P A;  2KW2 A;  2EHT A;  5EJD A;  3RG2 A;  4UHP B;  3CME P;  2PEM A;  4M0I A;  1DNY A;  4U0C A;  5BS2 A;  2FVA A;  2FAC A;  1M74 A;  2Z44 A;  2VLO A;  3G21 A;  1W2B O;  2PEN A;  2CG5 B;  3G26 A;  1EIA A;  3CCR P;  1IUQ A;  3Q20 A;  2GZI A;  3DS0 A;  2JAZ A;  1Z6M A;  1VQ9 P;  2N5H A;  1K73 Q;  3DS2 A;  4GR2 A;  1VQ8 P;  2GZE A;  2GZJ A;  3DS3 A;  3VRL C;  4F37 A;  3CC7 P;  2N6Z A;  2E1M A;  2K5X A;  1VHN A;  1M90 Q;  2FHS C;  3GKL C;  1VQP P;  2L6E A;  1RNI A;  3CMA P;  1YHQ P;  2FAD A;  1M6E X;  2QNW A;  1VQM P;  5JPA A;  2JGP A;  1EMV A;  3MGE A;  2JBG A;  2LOL A;  2FQ1 A;  4U0A A;  4U0F A;  1M6N A;  2K0X A;  3G29 A;  2LIW A;  3LRY A;  2LL8 A;  1YJN P;  2JQ4 A;  2KOQ A;  2MVU A;  1L0H A;  2ERH A;  2PEO A;  1E0H A;  2K93 A;  2Z46 A;  2CWO A;  3NY7 B;  2KG6 A;  1K8A Q;  5HGN A;  2XZ1 C;  1VQ5 P;  4R0M A;  4U0D A;  2K92 A;  2GDX A;  2EIA A;  2MD9 A;  2JU1 A;  2K0D X;  1FR2 A;  2VLP A;  2PEJ A;  1RO2 A;  1N8R Q;  2JYL A;  3DPH A;  1QVG O;  2XZ0 D;  3G0V A;  2GDW A;  2LF4 A;  1VQ7 P;  3CC4 P;  1ACP A;  1X3O A;  4MRT C;  2CQ8 A;  4NEO A;  1NJI Q;  2JB0 A;  3E2D A;  4XFX A;  5KP6 B;  3CPW O;  1VQK P;  2PEK A;  1KLP A;  2M8N A;  3CE7 A;  3G4S P;  4GR6 A;  2KOD A;  2KOO A;  1M1K Q;  4XRQ A;  2KGE A;  1IMQ A;  2NO8 A;  1YIT P;  2FQ2 A;  4BPH A;  2GYK A;  2ONT A;  1EOQ A;  1ZMB A;  3DS5 A;  2EFJ A;  2GDY A;  2MR7 A;  4PWV B;  2KOS A;  1Q81 Q;  2KGD A;  3CCE P;  4IPY A;  4XFY A;  4WYM A;  1A8O A;  2Z45 A;  1BAJ A;  2XXM A;  5EW5 E;  2ROQ A;  1VQL P;  3CD6 P;  2X2B A;  2VLN A;  1K30 A;  2OTJ P;  4XRO A;  2BHV A;  2AFD A;  3RG6 C;  4IZ6 A;  5F2K A;  1S72 P;  5DCK A;  2GZG A;  1CEI A;  3EJB A;  4U0E A;  4QKO A;  5BS1 A;  3CC2 P;  2OTL P;  2FAE A;  3G71 P;  5HVC A;  1HQB A;  3M1M A;  3H4E A;  2KG9 A;  1YJ9 P;  4QNB A;  2EHS A;  2PEQ A;  1YI2 P;  2LKI A;  2AFE A;  1VQN P;  2L0Q A;  3NTE A;  2PY8 A;  2LPK A;  4BPF A;  2KGC A;  3HZQ A;  1GXH A;  2XV6 A;  2WPT A;  3CCU P;  3G1G A;  3GJN A;  3G28 A;  2JYG A;  2JU2 A;  3EJE A;  2MVV A;  2JO0 A;  3I56 P;  2KOR A;  5HGL A;  1AYI A;  1KQS O;  2MY5 A;  7CEI A;  4CA3 A;  2N50 A;  1VQ4 P;  3P05 A;  2N6Y A;  1VKU A;  3CCQ P;  2VSQ A;  1VQ6 P;  3OW2 O;  1IMP A;  1OR5 A;  1YJW P;  4BPG A;  2K2Q A;  2OAR A;  1RO0 A;  1YIJ P;  1ZNV A;  3DTJ A;  1GPJ A;  1Q86 Q;  2MF4 A;  3DS4 A;  1VQO P;  1AUM A;  3G6E P;  2PNG A;  5HV8 A;  3WBH A;  1UNK A;  2GZF A;  3G1I A;  4H2W C;  3CCL P;  2BUO A;  2FVE A;  3H47 A;  1QVF O;  2KGA A;  2N98 A;  2PEI A;  3CCS P;  2K0Y A;  1Q82 Q;  4PH0 A;  4DG9 A;  2P9X A;  5HGO A;  4U0B A;  2MR8 A;  2KR5 A;  2QEX P;  3GZM A;  3HYB A;  2DGY A;  1JJ2 O;  1NQ4 A;  1T8K A;  3EJD A;  1QRJ A;  3CCM P;  1Q7Y Q;  3U43 A;  2XT1 A;  1MZ8 A;  1F80 D;  2LTE A;  5F2N A;  5I4T G;  3B4Q A;  1HY8 A;  4XFZ A;  5KP7 B;  2L22 A;  1D1D A;  3DS1 A;  2M5R A;  5HGM A;  4HKG A;  1BXI A;  2VLQ A;  2KWL A;  2QA4 P;  1DV5 A;  2M8L A;  2EG5 A;  5CZD B;  4COP A; 
#chains in the Genus database with same CATH homology
 2KOO A;  2KOR A;  2N5I A;  2LIU A;  2MY5 A;  2KGE A;  2FQ0 A;  4CA3 A;  1L0I A;  2FAD A;  2N50 A;  2QNW A;  2CGQ A;  2LML A;  2N6Y A;  1VKU A;  2DNW A;  2VSQ A;  2FQ2 A;  2KG8 A;  4BPH A;  1OR5 A;  2CNR A;  2JGP A;  4BPG A;  2K2Q A;  2GDY A;  2LOL A;  1AF8 A;  2FQ1 A;  2K0X A;  3LMO A;  2KOP A;  2MR7 A;  2AF8 A;  2LIW A;  4PWV B;  4H2X C;  2FVF A;  2KOS A;  2LL8 A;  2JQ4 A;  2MF4 A;  2L9F A;  2KOQ A;  2KGD A;  2L4B A;  2MVU A;  2AVA A;  1L0H A;  5KP8 B;  4PXH B;  2PNG A;  5HV8 A;  4H2Y C;  2K94 A;  3GZL A;  4H2W C;  2KW2 A;  2EHT A;  2K93 A;  2ROQ A;  5EJD A;  2X2B A;  3NY7 B;  3RG2 A;  2FVE A;  2KG6 A;  2AFD A;  2KGA A;  4IZ6 A;  2XZ1 C;  4R0M A;  2N98 A;  2K0Y A;  2K92 A;  2GDX A;  4DG9 A;  1DNY A;  2MD9 A;  2JU1 A;  2MR8 A;  2KR5 A;  3GZM A;  2FVA A;  2FAC A;  3EJB A;  2CG5 B;  1NQ4 A;  1T8K A;  2FAE A;  5HVC A;  1HQB A;  3EJD A;  2XZ0 D;  2KG9 A;  2GDW A;  2EHS A;  2LKI A;  1ACP A;  2AFE A;  1X3O A;  2LTE A;  1F80 D;  2N5H A;  2L0Q A;  1HY8 A;  4MRT C;  2CQ8 A;  4NEO A;  2L22 A;  5KP7 B;  2LPK A;  4BPF A;  2KGC A;  5KP6 B;  2M5R A;  4HKG A;  2N6Z A;  2KWL A;  1KLP A;  1DV5 A;  2FHS C;  3CE7 A;  5CZD B;  2JU2 A;  3EJE A;  2MVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...