3EJDA

Crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejdA00
2FVAA 2X2BA 2FVEA 2MR8A 4DG9A 5KP6B 2N50A 2FVFA 2GDXA 3EJDA 2EHSA 4NEOA 2K92A 2VSQA 1X3OA 2KGDA 3CE7A 2K2QA 2FACA 2CQ8A 2KGEA 2MVUA 3GZMA 4HKGA 3LMOA 2K0XA 4BPFA 2PNGA 5EJDA 2LIWA 2KWLA 2AVAA 2FHSC 2KG9A 2JGPA 2L9FA 2N6YA 2AFDA 2M5RA 2N6ZA 5CZDB 2KOPA 3RG2A 2LPKA 2MD9A 2MF4A 2FQ0A 2K93A 2N5IA 2AFEA 1AF8A 2GDWA 1ACPA 2CG5B 2L4BA 1HQBA 2KOSA 2MY5A 2KGAA 5HV8A 1KLPA 1T8KA 1VKUA 5HVCA 1NQ4A 1DNYA 2L22A 2LTEA 2JQ4A 2LIUA 2LOLA 2XZ1C 2KG8A 2LKIA 4MRTC 2KG6A 1OR5A 2KOQA 4IZ6A 5KP8B 2EHTA 2AF8A 2KGCA 4R0MA 2MVVA 2FQ1A 3EJEA 4H2XC 2FAEA 4PXHB 2K0YA 2L0QA 1L0HA 2LL8A 3GZLA 4BPGA 4PWVB 2KR5A 2JU1A 2N5HA 4BPHA 1DV5A 2MR7A 2KOOA 2KW2A 1HY8A 2FADA 3EJBA 2QNWA 2XZ0D 2K94A 5KP7B 2CNRA 3NY7B 2JU2A 1L0IA 1F80D 4H2WC 2DNWA 2LMLA 2ROQA 2KORA 2FQ2A 2GDYA 4CA3A 2N98A 4H2YC 2CGQA
chains in the Genus database with same CATH superfamily
2JB0A 2JYLA 2GDXA 4PH0A 3EJDA 2EHSA 1VQ7P 2K0DX 2KGDA 2K2QA 2MVUA 2L6EA 3GZMA 4GR6A 2K0XA 3DPHA 5JPAA 2PNGA 2JYGA 2KG9A 1K73Q 2L9FA 2N6YA 2M5RA 2Z45A 1QRJA 2K93A 1VQ8P 1A43A 2AFEA 2EFJA 1ACPA 3G4SP 1YI2P 2L4BA 1HQBA 2KOSA 3CCEP 1YJNP 5HVCA 1M90Q 3P05A 1RO0A 4COPA 5HGLA 2L22A 2LTEA 2JQ4A 2EG5A 2KG8A 2LKIA 1EMVA 2KODA 4IZ6A 2Z46A 5BS1A 4R0MA 2ERHA 1Q7YQ 1UJZA 2K0YA 1L0HA 3DS1A 3DTJA 4BPGA 1MZ8A 2GZIA 2KR5A 4GR2A 2JU1A 1A8OA 3G21A 2N5HA 1YJWP 2XT1A 2QNWA 2K94A 1L0IA 1VHNA 1IMPA 1BAJA 2LMLA 3CCLP 2KORA 2FQ2A 2GDYA 3MGEA 2K5XA 4CA3A 2QA4P 1RO2A 3CCQP 2N98A 1W2BO 1UNKA 2OTLP 3HZQA 5KP6B 2FVFA 2JO0A 3CXCO 4XFZA 3CCSP 1Z6MA 1X3OA 4U0CA 2M8LA 2KGEA 2M8PA 4BPFA 1YIJP 3G71P 1VQ4P 2KWLA 3LRYA 2E1MA 4F37A 3CCUP 2JAZA 2MD9A 1M6NA 2WPTA 2GZEA 2GDWA 1KD1Q 1ZMBA 2PEMA 2DGYA 2VLOA 3GKLC 5HV8A 1ZNVA 1NQ4A 3CMEP 3CD6P 1JJ2O 1AYIA 2QEXP 2XZ1C 2KG6A 5KP8B 1NJIQ 4U0BA 3DS2A 1K9MQ 2FQ1A 2GZFA 2FAEA 1VQOP 2L0QA 2PEKA 1YJ9P 2CWOA 3DS0A 4XROA 5HGNA 1CEIA 2GZGA 1YITP 2Z44A 1Q81Q 1VQLP 2P9XA 2FADA 1EOQA 3CMAP 3EJBA 3DS3A 5KP7B 2EIAA 2VLNA 1IUQA 1F80D 1K8AQ 2DNWA 2XV6A 1VQ9P 4U0FA 2FVAA 4XRQA 2FVEA 2MR8A 4DG9A 2VSQA 3OW2O 3M1MA 1M74A 3HYBA 2VLQA 1IMQA 5EW5E 4HKGA 3LMOA 3NTEA 2AVAA 2FHSC 1E6JP 2JGPA 2PEJA 3CC2P 2AFDA 5CZDB 2MF4A 3H4EA 1VQPP 1VQNP 2CG5B 7CEIA 2MY5A 2PEOA 1T8KA 1DNYA 3CC4P 2LOLA 4COCA 2LF4A 2VLPA 1Q82Q 4MRTC 3G6EP 1OR5A 2KOQA 3WBHA 4U0AA 3B5IA 4H2XC 4UHPB 2NO8A 4PXHB 2LL8A 3GZLA 4PWVB 4PH1A 1GPJA 3VRLC 3Q20A 1DV5A 2MR7A 2KW2A 4QNBA 1QVFO 3I56P 3U43A 1EIAA 2JU2A 1QVGO 2XXMA 4H2WC 2ROQA 3CCRP 2PENA 2BUOA 2PEQA 2JBGA 3E2DA 3I55P 2PEIA 4H2YC 2CGQA 4IPYA 1Q86Q 2PY8A 2X2BA 5HGMA 1BXIA 1KC8Q 2N50A 3GJNA 1VQMP 5DCKA 1GXGA 4NEOA 2K92A 3CE7A 2FACA 2CQ8A 4QKOA 1N8RQ 5F2KA 2M8NA 2OTJP 2OARA 4U0DA 3CC7P 4M0IA 5EJDA 2LIWA 3G26A 5HGOA 3G1GA 2N6ZA 2KOPA 3RG2A 2LPKA 2FQ0A 2N5IA 1AF8A 3G29A 1D1DA 1YHQP 3B4QA 1FR2A 1VQ5P 2KGAA 4XFYA 1KLPA 1VKUA 2LIUA 3G1IA 5F2OA 2GYKA 2EHTA 5F2NA 2AF8A 1GXHA 2KGCA 3CCMP 2MVVA 1E0HA 3EJEA 4XFXA 1VQKP 4U0EA 4WYMA 3G0VA 3CCVP 2ONTA 3G28A 1KQSO 2GZJA 4BPHA 2KOOA 3RG6C 1HY8A 3DS4A 1RNIA 5I4TG 3CPWO 1S72P 2XZ0D 2CNRA 1M6EX 1K30A 3H47A 3NY7B 1VQ6P 5BS2A 1AUMA 3CCJP 3DS5A 1M1KQ 3H0DA 2BHVA
chains in the Genus database with same CATH topology
2FVAA 2X2BA 2FVEA 2MR8A 4DG9A 5KP6B 2N50A 2FVFA 2GDXA 3EJDA 2EHSA 4NEOA 2K92A 2VSQA 1X3OA 2KGDA 3CE7A 2K2QA 2FACA 2CQ8A 2KGEA 2MVUA 3GZMA 4HKGA 3LMOA 2K0XA 4BPFA 2PNGA 5EJDA 2LIWA 2KWLA 2AVAA 2FHSC 2KG9A 2JGPA 2L9FA 2N6YA 2AFDA 2M5RA 2N6ZA 5CZDB 2KOPA 3RG2A 2LPKA 2MD9A 2MF4A 2FQ0A 2K93A 2N5IA 2AFEA 1AF8A 2GDWA 1ACPA 2CG5B 2L4BA 1HQBA 2KOSA 2MY5A 2KGAA 5HV8A 1KLPA 1T8KA 1VKUA 5HVCA 1NQ4A 1DNYA 2L22A 2LTEA 2JQ4A 2LIUA 2LOLA 2XZ1C 2KG8A 2LKIA 4MRTC 2KG6A 1OR5A 2KOQA 4IZ6A 5KP8B 2EHTA 2AF8A 2KGCA 4R0MA 2MVVA 2FQ1A 3EJEA 4H2XC 2FAEA 4PXHB 2K0YA 2L0QA 1L0HA 2LL8A 3GZLA 4BPGA 4PWVB 2KR5A 2JU1A 2N5HA 4BPHA 1DV5A 2MR7A 2KOOA 2KW2A 1HY8A 2FADA 3EJBA 2QNWA 2XZ0D 2K94A 5KP7B 2CNRA 3NY7B 2JU2A 1L0IA 1F80D 4H2WC 2DNWA 2LMLA 2ROQA 2KORA 2FQ2A 2GDYA 4CA3A 2N98A 4H2YC 2CGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVA A;  2X2B A;  2FVE A;  2MR8 A;  4DG9 A;  5KP6 B;  2N50 A;  2FVF A;  2GDX A;  3EJD A;  2EHS A;  4NEO A;  2K92 A;  2VSQ A;  1X3O A;  2KGD A;  3CE7 A;  2K2Q A;  2FAC A;  2CQ8 A;  2KGE A;  2MVU A;  3GZM A;  4HKG A;  3LMO A;  2K0X A;  4BPF A;  2PNG A;  5EJD A;  2LIW A;  2KWL A;  2AVA A;  2FHS C;  2KG9 A;  2JGP A;  2L9F A;  2N6Y A;  2AFD A;  2M5R A;  2N6Z A;  5CZD B;  2KOP A;  3RG2 A;  2LPK A;  2MD9 A;  2MF4 A;  2FQ0 A;  2K93 A;  2N5I A;  2AFE A;  1AF8 A;  2GDW A;  1ACP A;  2CG5 B;  2L4B A;  1HQB A;  2KOS A;  2MY5 A;  2KGA A;  5HV8 A;  1KLP A;  1T8K A;  1VKU A;  5HVC A;  1NQ4 A;  1DNY A;  2L22 A;  2LTE A;  2JQ4 A;  2LIU A;  2LOL A;  2XZ1 C;  2KG8 A;  2LKI A;  4MRT C;  2KG6 A;  1OR5 A;  2KOQ A;  4IZ6 A;  5KP8 B;  2EHT A;  2AF8 A;  2KGC A;  4R0M A;  2MVV A;  2FQ1 A;  3EJE A;  4H2X C;  2FAE A;  4PXH B;  2K0Y A;  2L0Q A;  1L0H A;  2LL8 A;  3GZL A;  4BPG A;  4PWV B;  2KR5 A;  2JU1 A;  2N5H A;  4BPH A;  1DV5 A;  2MR7 A;  2KOO A;  2KW2 A;  1HY8 A;  2FAD A;  3EJB A;  2QNW A;  2XZ0 D;  2K94 A;  5KP7 B;  2CNR A;  3NY7 B;  2JU2 A;  1L0I A;  1F80 D;  4H2W C;  2DNW A;  2LML A;  2ROQ A;  2KOR A;  2FQ2 A;  2GDY A;  4CA3 A;  2N98 A;  4H2Y C;  2CGQ A; 
#chains in the Genus database with same CATH topology
 2JB0 A;  2JYL A;  2GDX A;  4PH0 A;  3EJD A;  2EHS A;  1VQ7 P;  2K0D X;  2KGD A;  2K2Q A;  2MVU A;  2L6E A;  3GZM A;  4GR6 A;  2K0X A;  3DPH A;  5JPA A;  2PNG A;  2JYG A;  2KG9 A;  1K73 Q;  2L9F A;  2N6Y A;  2M5R A;  2Z45 A;  1QRJ A;  2K93 A;  1VQ8 P;  1A43 A;  2AFE A;  2EFJ A;  1ACP A;  3G4S P;  1YI2 P;  2L4B A;  1HQB A;  2KOS A;  3CCE P;  1YJN P;  5HVC A;  1M90 Q;  3P05 A;  1RO0 A;  4COP A;  5HGL A;  2L22 A;  2LTE A;  2JQ4 A;  2EG5 A;  2KG8 A;  2LKI A;  1EMV A;  2KOD A;  4IZ6 A;  2Z46 A;  5BS1 A;  4R0M A;  2ERH A;  1Q7Y Q;  1UJZ A;  2K0Y A;  1L0H A;  3DS1 A;  3DTJ A;  4BPG A;  1MZ8 A;  2GZI A;  2KR5 A;  4GR2 A;  2JU1 A;  1A8O A;  3G21 A;  2N5H A;  1YJW P;  2XT1 A;  2QNW A;  2K94 A;  1L0I A;  1VHN A;  1IMP A;  1BAJ A;  2LML A;  3CCL P;  2KOR A;  2FQ2 A;  2GDY A;  3MGE A;  2K5X A;  4CA3 A;  2QA4 P;  1RO2 A;  3CCQ P;  2N98 A;  1W2B O;  1UNK A;  2OTL P;  3HZQ A;  5KP6 B;  2FVF A;  2JO0 A;  3CXC O;  4XFZ A;  3CCS P;  1Z6M A;  1X3O A;  4U0C A;  2M8L A;  2KGE A;  2M8P A;  4BPF A;  1YIJ P;  3G71 P;  1VQ4 P;  2KWL A;  3LRY A;  2E1M A;  4F37 A;  3CCU P;  2JAZ A;  2MD9 A;  1M6N A;  2WPT A;  2GZE A;  2GDW A;  1KD1 Q;  1ZMB A;  2PEM A;  2DGY A;  2VLO A;  3GKL C;  5HV8 A;  1ZNV A;  1NQ4 A;  3CME P;  3CD6 P;  1JJ2 O;  1AYI A;  2QEX P;  2XZ1 C;  2KG6 A;  5KP8 B;  1NJI Q;  4U0B A;  3DS2 A;  1K9M Q;  2FQ1 A;  2GZF A;  2FAE A;  1VQO P;  2L0Q A;  2PEK A;  1YJ9 P;  2CWO A;  3DS0 A;  4XRO A;  5HGN A;  1CEI A;  2GZG A;  1YIT P;  2Z44 A;  1Q81 Q;  1VQL P;  2P9X A;  2FAD A;  1EOQ A;  3CMA P;  3EJB A;  3DS3 A;  5KP7 B;  2EIA A;  2VLN A;  1IUQ A;  1F80 D;  1K8A Q;  2DNW A;  2XV6 A;  1VQ9 P;  4U0F A;  2FVA A;  4XRQ A;  2FVE A;  2MR8 A;  4DG9 A;  2VSQ A;  3OW2 O;  3M1M A;  1M74 A;  3HYB A;  2VLQ A;  1IMQ A;  5EW5 E;  4HKG A;  3LMO A;  3NTE A;  2AVA A;  2FHS C;  1E6J P;  2JGP A;  2PEJ A;  3CC2 P;  2AFD A;  5CZD B;  2MF4 A;  3H4E A;  1VQP P;  1VQN P;  2CG5 B;  7CEI A;  2MY5 A;  2PEO A;  1T8K A;  1DNY A;  3CC4 P;  2LOL A;  4COC A;  2LF4 A;  2VLP A;  1Q82 Q;  4MRT C;  3G6E P;  1OR5 A;  2KOQ A;  3WBH A;  4U0A A;  3B5I A;  4H2X C;  4UHP B;  2NO8 A;  4PXH B;  2LL8 A;  3GZL A;  4PWV B;  4PH1 A;  1GPJ A;  3VRL C;  3Q20 A;  1DV5 A;  2MR7 A;  2KW2 A;  4QNB A;  1QVF O;  3I56 P;  3U43 A;  1EIA A;  2JU2 A;  1QVG O;  2XXM A;  4H2W C;  2ROQ A;  3CCR P;  2PEN A;  2BUO A;  2PEQ A;  2JBG A;  3E2D A;  3I55 P;  2PEI A;  4H2Y C;  2CGQ A;  4IPY A;  1Q86 Q;  2PY8 A;  2X2B A;  5HGM A;  1BXI A;  1KC8 Q;  2N50 A;  3GJN A;  1VQM P;  5DCK A;  1GXG A;  4NEO A;  2K92 A;  3CE7 A;  2FAC A;  2CQ8 A;  4QKO A;  1N8R Q;  5F2K A;  2M8N A;  2OTJ P;  2OAR A;  4U0D A;  3CC7 P;  4M0I A;  5EJD A;  2LIW A;  3G26 A;  5HGO A;  3G1G A;  2N6Z A;  2KOP A;  3RG2 A;  2LPK A;  2FQ0 A;  2N5I A;  1AF8 A;  3G29 A;  1D1D A;  1YHQ P;  3B4Q A;  1FR2 A;  1VQ5 P;  2KGA A;  4XFY A;  1KLP A;  1VKU A;  2LIU A;  3G1I A;  5F2O A;  2GYK A;  2EHT A;  5F2N A;  2AF8 A;  1GXH A;  2KGC A;  3CCM P;  2MVV A;  1E0H A;  3EJE A;  4XFX A;  1VQK P;  4U0E A;  4WYM A;  3G0V A;  3CCV P;  2ONT A;  3G28 A;  1KQS O;  2GZJ A;  4BPH A;  2KOO A;  3RG6 C;  1HY8 A;  3DS4 A;  1RNI A;  5I4T G;  3CPW O;  1S72 P;  2XZ0 D;  2CNR A;  1M6E X;  1K30 A;  3H47 A;  3NY7 B;  1VQ6 P;  5BS2 A;  1AUM A;  3CCJ P;  3DS5 A;  1M1K Q;  3H0D A;  2BHV A; 
#chains in the Genus database with same CATH homology
 2FVA A;  2X2B A;  2FVE A;  2MR8 A;  4DG9 A;  5KP6 B;  2N50 A;  2FVF A;  2GDX A;  3EJD A;  2EHS A;  4NEO A;  2K92 A;  2VSQ A;  1X3O A;  2KGD A;  3CE7 A;  2K2Q A;  2FAC A;  2CQ8 A;  2KGE A;  2MVU A;  3GZM A;  4HKG A;  3LMO A;  2K0X A;  4BPF A;  2PNG A;  5EJD A;  2LIW A;  2KWL A;  2AVA A;  2FHS C;  2KG9 A;  2JGP A;  2L9F A;  2N6Y A;  2AFD A;  2M5R A;  2N6Z A;  5CZD B;  2KOP A;  3RG2 A;  2LPK A;  2MD9 A;  2MF4 A;  2FQ0 A;  2K93 A;  2N5I A;  2AFE A;  1AF8 A;  2GDW A;  1ACP A;  2CG5 B;  2L4B A;  1HQB A;  2KOS A;  2MY5 A;  2KGA A;  5HV8 A;  1KLP A;  1T8K A;  1VKU A;  5HVC A;  1NQ4 A;  1DNY A;  2L22 A;  2LTE A;  2JQ4 A;  2LIU A;  2LOL A;  2XZ1 C;  2KG8 A;  2LKI A;  4MRT C;  2KG6 A;  1OR5 A;  2KOQ A;  4IZ6 A;  5KP8 B;  2EHT A;  2AF8 A;  2KGC A;  4R0M A;  2MVV A;  2FQ1 A;  3EJE A;  4H2X C;  2FAE A;  4PXH B;  2K0Y A;  2L0Q A;  1L0H A;  2LL8 A;  3GZL A;  4BPG A;  4PWV B;  2KR5 A;  2JU1 A;  2N5H A;  4BPH A;  1DV5 A;  2MR7 A;  2KOO A;  2KW2 A;  1HY8 A;  2FAD A;  3EJB A;  2QNW A;  2XZ0 D;  2K94 A;  5KP7 B;  2CNR A;  3NY7 B;  2JU2 A;  1L0I A;  1F80 D;  4H2W C;  2DNW A;  2LML A;  2ROQ A;  2KOR A;  2FQ2 A;  2GDY A;  4CA3 A;  2N98 A;  4H2Y C;  2CGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...