3EJDA

Crystal structure of p450bioi in complex with hexadec-9z-enoic acid ligated acyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
SHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/lipid transport
molecule keywords Acyl carrier protein
total genus 22
structure length 78
sequence length 78
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3ejdA00
2MVVA 2KG8A 1X3OA 2CGQA 2LL8A 4R0MA 2K94A 5HV8A 2JQ4A 2L0QA 2L4BA 2FQ2A 4BPGA 2N5IA 2KGAA 2FAEA 2XZ1C 5HVCA 2XZ0D 2FHSC 2KGCA 4H2YC 4IZ6A 1HQBA 2LIWA 2FVFA 2K0XA 4BPHA 2N50A 2LPKA 2GDYA 2CG5B 2JU2A 2K93A 2GDXA 2KG6A 2MR7A 4HKGA 2K2QA 2JU1A 2KGEA 3LMOA 2MY5A 2KR5A 2MF4A 2AF8A 5CZDB 2FQ1A 2N5HA 2LTEA 2LIUA 2PNGA 2AVAA 2EHSA 2KGDA 1L0IA 2LOLA 2VSQA 2KW2A 5EJDA 5KP8B 3EJEA 3GZMA 3GZLA 4BPFA 2GDWA 2N6YA 2KOOA 1DNYA 2L9FA 1NQ4A 2CQ8A 4DG9A 2DNWA 2LMLA 2ROQA 4MRTC 4CA3A 1L0HA 2AFDA 3RG2A 2K92A 2FQ0A 2FACA 3EJBA 1KLPA 2FVAA 4H2XC 4H2WC 1F80D 2CNRA 2FADA 4PWVB 1DV5A 1OR5A 2AFEA 5KP7B 2N6ZA 2KOQA 4NEOA 2N98A 5KP6B 1HY8A 2KOPA 2MD9A 3NY7B 2KORA 2M5RA 2MVUA 4PXHB 1T8KA 2L22A 1VKUA 2EHTA 2FVEA 2KG9A 2JGPA 2K0YA 1ACPA 2MR8A 3CE7A 2QNWA 2KOSA 3EJDA 2KWLA 2X2BA 2LKIA 1AF8A
chains in the Genus database with same CATH superfamily
2Z46A 4IPYA 2MVVA 4U0DA 1UJZA 3I55P 2VLQA 3CMAP 2LL8A 4U0FA 3G71P 2OTJP 4UHPB 4COCA 1BXIA 1RO0A 1IMPA 5HV8A 2FQ2A 2KGAA 2XZ1C 2PEQA 4U0BA 1AYIA 4IZ6A 2M8PA 2XXMA 2N50A 2CG5B 1GXHA 1YHQP 2KG6A 2WPTA 4XROA 4HKGA 2ONTA 3GJNA 1Q81Q 2K2QA 1KQSO 3LRYA 2MF4A 2AF8A 2JYGA 2LTEA 4PH1A 3H0DA 3CPWO 2JO0A 2PNGA 3CCRP 3M1MA 3DS1A 3G21A 2LOLA 2VSQA 2Z44A 5EJDA 5JPAA 3GZMA 4BPFA 2GDWA 3P05A 2LMLA 3DPHA 2ROQA 1VQKP 5HGNA 2AFDA 1NJIQ 2K0DX 2P9XA 5F2NA 4QNBA 3CCMP 4H2XC 1S72P 3OW2O 2FADA 1YJWP 1M1KQ 4WYMA 2KOQA 3CXCO 5F2OA 2VLPA 1M6EX 2M5RA 1AUMA 1K9MQ 3G1GA 2K0YA 1VQ5P 1QVFO 1YJ9P 1QVGO 1ACPA 3G0VA 2KOSA 3G4SP 1VQPP 1AF8A 1N8RQ 3U43A 1K73Q 1W2BO 1IUQA 2OTLP 4QKOA 1ZMBA 2L4BA 2KODA 3DS3A 3G26A 2FAEA 2JYLA 5HVCA 2XV6A 2XZ0D 3CMEP 3CD6P 1YITP 1QRJA 2KGCA 1HQBA 4PH0A 3DS4A 3H47A 2K0XA 2GDYA 2JU2A 2ERHA 2JBGA 2MR7A 4U0EA 7CEIA 2JU1A 5EW5E 1EIAA 2MY5A 2LIUA 3CC4P 3CCEP 2EHSA 2KW2A 5HGOA 3EJEA 3RG6C 2KOOA 1NQ4A 1VQLP 1VHNA 2DNWA 3VRLC 1VQ6P 4MRTC 3CC2P 2PENA 4M0IA 2NO8A 2PEJA 4XRQA 2FQ0A 3DS5A 1YIJP 2FACA 2VLNA 2FVAA 4H2WC 1KC8Q 1VQMP 3G29A 2K5XA 4NEOA 2N98A 3MGEA 1HY8A 3NY7B 2MVUA 4PXHB 1T8KA 2L22A 1CEIA 2FVEA 2KG9A 1IMQA 1BAJA 3CCVP 2EFJA 4U0AA 2QNWA 4F37A 1E6JP 1MZ8A 2JB0A 2CGQA 2GZEA 4R0MA 2K94A 1FR2A 2GZGA 1ZNVA 2JQ4A 2L0QA 2QEXP 4BPGA 1E0HA 2BUOA 2PEKA 1VQ7P 4H2YC 1Q86Q 3CCJP 2LIWA 2FVFA 1GPJA 4BPHA 3WBHA 5BS1A 2LPKA 2K93A 3HYBA 4GR2A 1EOQA 1A43A 2GZIA 4XFYA 2EG5A 3LMOA 1M6NA 5CZDB 2FQ1A 3GKLC 1KD1Q 2KGDA 3H4EA 5KP8B 2GZFA 3GZLA 3G6EP 2LF4A 1DNYA 2XT1A 2OARA 2CQ8A 4COPA 1Q82Q 1VQ8P 3EJBA 3E2DA 3G1IA 3I56P 4U0CA 1DV5A 1OR5A 2GYKA 2N6ZA 2PY8A 2JAZA 5BS2A 5KP6B 1YJNP 5I4TG 2KOPA 2KORA 1VQOP 2L6EA 3G28A 2DGYA 1VKUA 2GZJA 2JGPA 2MR8A 5HGLA 3B4QA 3CE7A 3EJDA 3CCUP 4GR6A 2LKIA 2BHVA 1EMVA 2KG8A 1X3OA 2PEMA 3CCLP 3CCSP 1K30A 1A8OA 2N5IA 2PEOA 4XFXA 3Q20A 1YI2P 3HZQA 3B5IA 2FHSC 1UNKA 2PEIA 1VQ4P 2EIAA 2GDXA 1K8AQ 1JJ2O 2VLOA 2KGEA 2KR5A 3DS2A 1VQNP 2N5HA 5DCKA 1D1DA 2M8LA 2AVAA 1L0IA 2N6YA 2L9FA 4DG9A 4CA3A 1M90Q 1L0HA 1RNIA 2QA4P 3CCQP 3RG2A 2K92A 5F2KA 1M74A 1KLPA 1GXGA 1F80D 2CNRA 3CC7P 4PWVB 2M8NA 5KP7B 2AFEA 3NTEA 1RO2A 2MD9A 4XFZA 5HGMA 3DTJA 2CWOA 2EHTA 3DS0A 1Z6MA 1VQ9P 2E1MA 2KWLA 2X2BA 1Q7YQ 2Z45A
chains in the Genus database with same CATH topology
2MVVA 2KG8A 1X3OA 2CGQA 2LL8A 4R0MA 2K94A 5HV8A 2JQ4A 2L0QA 2L4BA 2FQ2A 4BPGA 2N5IA 2KGAA 2FAEA 2XZ1C 5HVCA 2XZ0D 2FHSC 2KGCA 4H2YC 4IZ6A 1HQBA 2LIWA 2FVFA 2K0XA 4BPHA 2N50A 2LPKA 2GDYA 2CG5B 2JU2A 2K93A 2GDXA 2KG6A 2MR7A 4HKGA 2K2QA 2JU1A 2KGEA 3LMOA 2MY5A 2KR5A 2MF4A 2AF8A 5CZDB 2FQ1A 2N5HA 2LTEA 2LIUA 2PNGA 2AVAA 2EHSA 2KGDA 1L0IA 2LOLA 2VSQA 2KW2A 5EJDA 5KP8B 3EJEA 3GZMA 3GZLA 4BPFA 2GDWA 2N6YA 2KOOA 1DNYA 2L9FA 1NQ4A 2CQ8A 4DG9A 2DNWA 2LMLA 2ROQA 4MRTC 4CA3A 1L0HA 2AFDA 3RG2A 2K92A 2FQ0A 2FACA 3EJBA 1KLPA 2FVAA 4H2XC 4H2WC 1F80D 2CNRA 2FADA 4PWVB 1DV5A 1OR5A 2AFEA 5KP7B 2N6ZA 2KOQA 4NEOA 2N98A 5KP6B 1HY8A 2KOPA 2MD9A 3NY7B 2KORA 2M5RA 2MVUA 4PXHB 1T8KA 2L22A 1VKUA 2EHTA 2FVEA 2KG9A 2JGPA 2K0YA 1ACPA 2MR8A 3CE7A 2QNWA 2KOSA 3EJDA 2KWLA 2X2BA 2LKIA 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVV A;  2KG8 A;  1X3O A;  2CGQ A;  2LL8 A;  4R0M A;  2K94 A;  5HV8 A;  2JQ4 A;  2L0Q A;  2L4B A;  2FQ2 A;  4BPG A;  2N5I A;  2KGA A;  2FAE A;  2XZ1 C;  5HVC A;  2XZ0 D;  2FHS C;  2KGC A;  4H2Y C;  4IZ6 A;  1HQB A;  2LIW A;  2FVF A;  2K0X A;  4BPH A;  2N50 A;  2LPK A;  2GDY A;  2CG5 B;  2JU2 A;  2K93 A;  2GDX A;  2KG6 A;  2MR7 A;  4HKG A;  2K2Q A;  2JU1 A;  2KGE A;  3LMO A;  2MY5 A;  2KR5 A;  2MF4 A;  2AF8 A;  5CZD B;  2FQ1 A;  2N5H A;  2LTE A;  2LIU A;  2PNG A;  2AVA A;  2EHS A;  2KGD A;  1L0I A;  2LOL A;  2VSQ A;  2KW2 A;  5EJD A;  5KP8 B;  3EJE A;  3GZM A;  3GZL A;  4BPF A;  2GDW A;  2N6Y A;  2KOO A;  1DNY A;  2L9F A;  1NQ4 A;  2CQ8 A;  4DG9 A;  2DNW A;  2LML A;  2ROQ A;  4MRT C;  4CA3 A;  1L0H A;  2AFD A;  3RG2 A;  2K92 A;  2FQ0 A;  2FAC A;  3EJB A;  1KLP A;  2FVA A;  4H2X C;  4H2W C;  1F80 D;  2CNR A;  2FAD A;  4PWV B;  1DV5 A;  1OR5 A;  2AFE A;  5KP7 B;  2N6Z A;  2KOQ A;  4NEO A;  2N98 A;  5KP6 B;  1HY8 A;  2KOP A;  2MD9 A;  3NY7 B;  2KOR A;  2M5R A;  2MVU A;  4PXH B;  1T8K A;  2L22 A;  1VKU A;  2EHT A;  2FVE A;  2KG9 A;  2JGP A;  2K0Y A;  1ACP A;  2MR8 A;  3CE7 A;  2QNW A;  2KOS A;  3EJD A;  2KWL A;  2X2B A;  2LKI A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 2Z46 A;  4IPY A;  2MVV A;  4U0D A;  1UJZ A;  3I55 P;  2VLQ A;  3CMA P;  2LL8 A;  4U0F A;  3G71 P;  2OTJ P;  4UHP B;  4COC A;  1BXI A;  1RO0 A;  1IMP A;  5HV8 A;  2FQ2 A;  2KGA A;  2XZ1 C;  2PEQ A;  4U0B A;  1AYI A;  4IZ6 A;  2M8P A;  2XXM A;  2N50 A;  2CG5 B;  1GXH A;  1YHQ P;  2KG6 A;  2WPT A;  4XRO A;  4HKG A;  2ONT A;  3GJN A;  1Q81 Q;  2K2Q A;  1KQS O;  3LRY A;  2MF4 A;  2AF8 A;  2JYG A;  2LTE A;  4PH1 A;  3H0D A;  3CPW O;  2JO0 A;  2PNG A;  3CCR P;  3M1M A;  3DS1 A;  3G21 A;  2LOL A;  2VSQ A;  2Z44 A;  5EJD A;  5JPA A;  3GZM A;  4BPF A;  2GDW A;  3P05 A;  2LML A;  3DPH A;  2ROQ A;  1VQK P;  5HGN A;  2AFD A;  1NJI Q;  2K0D X;  2P9X A;  5F2N A;  4QNB A;  3CCM P;  4H2X C;  1S72 P;  3OW2 O;  2FAD A;  1YJW P;  1M1K Q;  4WYM A;  2KOQ A;  3CXC O;  5F2O A;  2VLP A;  1M6E X;  2M5R A;  1AUM A;  1K9M Q;  3G1G A;  2K0Y A;  1VQ5 P;  1QVF O;  1YJ9 P;  1QVG O;  1ACP A;  3G0V A;  2KOS A;  3G4S P;  1VQP P;  1AF8 A;  1N8R Q;  3U43 A;  1K73 Q;  1W2B O;  1IUQ A;  2OTL P;  4QKO A;  1ZMB A;  2L4B A;  2KOD A;  3DS3 A;  3G26 A;  2FAE A;  2JYL A;  5HVC A;  2XV6 A;  2XZ0 D;  3CME P;  3CD6 P;  1YIT P;  1QRJ A;  2KGC A;  1HQB A;  4PH0 A;  3DS4 A;  3H47 A;  2K0X A;  2GDY A;  2JU2 A;  2ERH A;  2JBG A;  2MR7 A;  4U0E A;  7CEI A;  2JU1 A;  5EW5 E;  1EIA A;  2MY5 A;  2LIU A;  3CC4 P;  3CCE P;  2EHS A;  2KW2 A;  5HGO A;  3EJE A;  3RG6 C;  2KOO A;  1NQ4 A;  1VQL P;  1VHN A;  2DNW A;  3VRL C;  1VQ6 P;  4MRT C;  3CC2 P;  2PEN A;  4M0I A;  2NO8 A;  2PEJ A;  4XRQ A;  2FQ0 A;  3DS5 A;  1YIJ P;  2FAC A;  2VLN A;  2FVA A;  4H2W C;  1KC8 Q;  1VQM P;  3G29 A;  2K5X A;  4NEO A;  2N98 A;  3MGE A;  1HY8 A;  3NY7 B;  2MVU A;  4PXH B;  1T8K A;  2L22 A;  1CEI A;  2FVE A;  2KG9 A;  1IMQ A;  1BAJ A;  3CCV P;  2EFJ A;  4U0A A;  2QNW A;  4F37 A;  1E6J P;  1MZ8 A;  2JB0 A;  2CGQ A;  2GZE A;  4R0M A;  2K94 A;  1FR2 A;  2GZG A;  1ZNV A;  2JQ4 A;  2L0Q A;  2QEX P;  4BPG A;  1E0H A;  2BUO A;  2PEK A;  1VQ7 P;  4H2Y C;  1Q86 Q;  3CCJ P;  2LIW A;  2FVF A;  1GPJ A;  4BPH A;  3WBH A;  5BS1 A;  2LPK A;  2K93 A;  3HYB A;  4GR2 A;  1EOQ A;  1A43 A;  2GZI A;  4XFY A;  2EG5 A;  3LMO A;  1M6N A;  5CZD B;  2FQ1 A;  3GKL C;  1KD1 Q;  2KGD A;  3H4E A;  5KP8 B;  2GZF A;  3GZL A;  3G6E P;  2LF4 A;  1DNY A;  2XT1 A;  2OAR A;  2CQ8 A;  4COP A;  1Q82 Q;  1VQ8 P;  3EJB A;  3E2D A;  3G1I A;  3I56 P;  4U0C A;  1DV5 A;  1OR5 A;  2GYK A;  2N6Z A;  2PY8 A;  2JAZ A;  5BS2 A;  5KP6 B;  1YJN P;  5I4T G;  2KOP A;  2KOR A;  1VQO P;  2L6E A;  3G28 A;  2DGY A;  1VKU A;  2GZJ A;  2JGP A;  2MR8 A;  5HGL A;  3B4Q A;  3CE7 A;  3EJD A;  3CCU P;  4GR6 A;  2LKI A;  2BHV A;  1EMV A;  2KG8 A;  1X3O A;  2PEM A;  3CCL P;  3CCS P;  1K30 A;  1A8O A;  2N5I A;  2PEO A;  4XFX A;  3Q20 A;  1YI2 P;  3HZQ A;  3B5I A;  2FHS C;  1UNK A;  2PEI A;  1VQ4 P;  2EIA A;  2GDX A;  1K8A Q;  1JJ2 O;  2VLO A;  2KGE A;  2KR5 A;  3DS2 A;  1VQN P;  2N5H A;  5DCK A;  1D1D A;  2M8L A;  2AVA A;  1L0I A;  2N6Y A;  2L9F A;  4DG9 A;  4CA3 A;  1M90 Q;  1L0H A;  1RNI A;  2QA4 P;  3CCQ P;  3RG2 A;  2K92 A;  5F2K A;  1M74 A;  1KLP A;  1GXG A;  1F80 D;  2CNR A;  3CC7 P;  4PWV B;  2M8N A;  5KP7 B;  2AFE A;  3NTE A;  1RO2 A;  2MD9 A;  4XFZ A;  5HGM A;  3DTJ A;  2CWO A;  2EHT A;  3DS0 A;  1Z6M A;  1VQ9 P;  2E1M A;  2KWL A;  2X2B A;  1Q7Y Q;  2Z45 A; 
#chains in the Genus database with same CATH homology
 2MVV A;  2KG8 A;  1X3O A;  2CGQ A;  2LL8 A;  4R0M A;  2K94 A;  5HV8 A;  2JQ4 A;  2L0Q A;  2L4B A;  2FQ2 A;  4BPG A;  2N5I A;  2KGA A;  2FAE A;  2XZ1 C;  5HVC A;  2XZ0 D;  2FHS C;  2KGC A;  4H2Y C;  4IZ6 A;  1HQB A;  2LIW A;  2FVF A;  2K0X A;  4BPH A;  2N50 A;  2LPK A;  2GDY A;  2CG5 B;  2JU2 A;  2K93 A;  2GDX A;  2KG6 A;  2MR7 A;  4HKG A;  2K2Q A;  2JU1 A;  2KGE A;  3LMO A;  2MY5 A;  2KR5 A;  2MF4 A;  2AF8 A;  5CZD B;  2FQ1 A;  2N5H A;  2LTE A;  2LIU A;  2PNG A;  2AVA A;  2EHS A;  2KGD A;  1L0I A;  2LOL A;  2VSQ A;  2KW2 A;  5EJD A;  5KP8 B;  3EJE A;  3GZM A;  3GZL A;  4BPF A;  2GDW A;  2N6Y A;  2KOO A;  1DNY A;  2L9F A;  1NQ4 A;  2CQ8 A;  4DG9 A;  2DNW A;  2LML A;  2ROQ A;  4MRT C;  4CA3 A;  1L0H A;  2AFD A;  3RG2 A;  2K92 A;  2FQ0 A;  2FAC A;  3EJB A;  1KLP A;  2FVA A;  4H2X C;  4H2W C;  1F80 D;  2CNR A;  2FAD A;  4PWV B;  1DV5 A;  1OR5 A;  2AFE A;  5KP7 B;  2N6Z A;  2KOQ A;  4NEO A;  2N98 A;  5KP6 B;  1HY8 A;  2KOP A;  2MD9 A;  3NY7 B;  2KOR A;  2M5R A;  2MVU A;  4PXH B;  1T8K A;  2L22 A;  1VKU A;  2EHT A;  2FVE A;  2KG9 A;  2JGP A;  2K0Y A;  1ACP A;  2MR8 A;  3CE7 A;  2QNW A;  2KOS A;  3EJD A;  2KWL A;  2X2B A;  2LKI A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...