5BS2A

Crystal structure of rbcx-iia from chlamydomonas reinhardtii in complex with rbcl c-terminal tail
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
ASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRAAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa
publication title Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 45
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5bs2A00
2PEIA 2PEMA 3Q20A 2PY8A 2PEJA 2Z45A 2PEOA 3RG6C 2PENA 2PEQA 2PEKA 2Z44A 2Z46A 4GR2A 4GR6A 5BS2A 5BS1A 3HYBA
chains in the Genus database with same CATH superfamily
3GKLC 2X2BA 2JU2A 2FACA 4M0IA 4U0AA 4U0DA 4PXHB 4PH1A 2KG8A 2GYKA 4MRTC 3RG2A 3G29A 2P9XA 4QNBA 2FVFA 1W2BO 2GZJA 2KR5A 2AFEA 2CNRA 3WBHA 1L0IA 2NO8A 5HGNA 2KWLA 2JGPA 2LIWA 2CQ8A 3DS2A 2KG6A 2KGDA 1KD1Q 2N6YA 5JPAA 1GXGA 4XRQA 2PEJA 4NEOA 2M5RA 1Q81Q 2KOOA 5F2OA 2JYGA 2GZEA 2LL8A 2L0QA 2K94A 4IZ6A 1IMQA 2E1MA 1QVFO 2XV6A 1VQOP 3CE7A 2MVUA 4U0FA 2GDYA 2XZ1C 1N8RQ 1T8KA 1Z6MA 3DS5A 2VLQA 2EHSA 1VQ6P 2WPTA 3CCLP 3CCRP 2ROQA 2DGYA 2FQ1A 2L6EA 1IUQA 3DS4A 4XFZA 4QKOA 3I55P 1VQKP 3DS1A 2AVAA 2LPKA 2N6ZA 2JBGA 2LOLA 2K5XA 2QEXP 5F2NA 4PWVB 2L4BA 1NQ4A 3DPHA 4WYMA 2FVEA 2OTLP 2CG5B 2JQ4A 7CEIA 4COPA 1HQBA 4H2WC 3CCSP 3P05A 1K73Q 1M6NA 4COCA 1EOQA 2K93A 3OW2O 3H4EA 2FQ2A 1UJZA 2N5HA 2JB0A 1RO2A 3CC4P 4F37A 2LIUA 2JU1A 3DS3A 1VQ5P 3H0DA 2MR8A 3G28A 2EHTA 1YI2P 3NY7B 3G6EP 1VHNA 1X3OA 2KORA 2VLOA 3NTEA 2LF4A 2K92A 2CGQA 2FADA 1ZMBA 3B4QA 4HKGA 3Q20A 2QA4P 3GZLA 5HGLA 1M90Q 4GR2A 1DNYA 2KGEA 2FQ0A 2N50A 5F2KA 5I4TG 3GZMA 4GR6A 1Q86Q 2VSQA 1BXIA 2PEOA 3G26A 2GZIA 2XT1A 3CC2P 2GDWA 2QNWA 2Z45A 5BS1A 1RO0A 2MF4A 3CCMP 1VQ7P 1FR2A 4CA3A 2OARA 2MR7A 1QRJA 2PEIA 1K30A 2L22A 2FHSC 2KODA 1YJNP 1E0HA 1IMPA 2AFDA 1M74A 2GDXA 5BS2A 1F80D 1AYIA 1K9MQ 1KLPA 2KOSA 2PEKA 2JYLA 1GXHA 1QVGO 3DTJA 1VQPP 2N5IA 3G4SP 1RNIA 3VRLC 1Q82Q 1CEIA 2LMLA 1ACPA 1VQNP 1GPJA 1A8OA 2N98A 2PEQA 5HVCA 1M6EX 2KW2A 3CCQP 3GJNA 2LTEA 3E2DA 1UNKA 2JAZA 3G1IA 2K2QA 1EIAA 2MY5A 2M8NA 1KC8Q 4H2YC 2L9FA 1YHQP 1S72P 5DCKA 5KP8B 3CCEP 1YIJP 3EJDA 3RG6C 4R0MA 2Z46A 3HYBA 2K0YA 4BPFA 2JO0A 1A43A 1VQMP 2KGCA 4XFXA 2KGAA 2Z44A 1DV5A 3CCVP 1JJ2O 1VQLP 1OR5A 2LKIA 3G21A 2VLNA 4IPYA 1K8AQ 4DG9A 3CCUP 1AF8A 4H2XC 3H47A 2FVAA 2PY8A 1L0HA 3MGEA 2XXMA 1YITP 3CXCO 4BPGA 4U0BA 5EW5E 2EIAA 3DS0A 2GZGA 1YJ9P 3CMAP 2AF8A 2BUOA 2K0DX 3HZQA 1D1DA 2PNGA 4U0EA 2PENA 5CZDB 1VKUA 3EJBA 3EJEA 3LRYA 1YJWP 5KP7B 4UHPB 3M1MA 4BPHA 2VLPA 1VQ8P 5EJDA 2DNWA 2K0XA 2M8LA 1BAJA 3CCJP 3CMEP 2ERHA 3CPWO 2OTJP 1EMVA 2EFJA 1VQ4P 3CD6P 2PEMA 2CWOA 4U0CA 1NJIQ 1AUMA 5HGOA 2BHVA 2FAEA 2KOPA 3G71P 2XZ0D 3LMOA 2GZFA 2MVVA 5KP6B 4PH0A 1E6JP 2M8PA 4XFYA 4XROA 2EG5A 5HV8A 1MZ8A 3CC7P 1M1KQ 3I56P 1HY8A 2MD9A 2ONTA 3B5IA 3G1GA 3U43A 1VQ9P 5HGMA 1Q7YQ 2KG9A 3G0VA 1KQSO 1ZNVA 2KOQA
chains in the Genus database with same CATH topology
3I55P 1VQKP 2PY8A 3DS1A 1RO0A 3MGEA 3CCMP 1VQ7P 2XXMA 1YITP 3CXCO 2QEXP 4U0BA 5F2NA 2EIAA 2OARA 3DS0A 3DS4A 1QRJA 2PEIA 1YJ9P 4M0IA 1K30A 3DPHA 4U0AA 4U0DA 3CMAP 2BUOA 2KODA 4PH1A 4WYMA 1YJNP 3HZQA 3G29A 2P9XA 2OTLP 4QNBA 1M74A 1D1DA 4COPA 5BS2A 3CCSP 3P05A 4U0EA 1W2BO 1M6NA 1K73Q 1K9MQ 4COCA 1EOQA 2PENA 2PEKA 3OW2O 2JYLA 3H4EA 3WBHA 1QVGO 3DTJA 5HGNA 1VQPP 3G4SP 1RO2A 3LRYA 1YJWP 1RNIA 3VRLC 1Q82Q 3M1MA 3DS2A 3CC4P 1VQ8P 3DS3A 1VQ5P 3H0DA 1KD1Q 5JPAA 3G28A 1VQNP 1A8OA 2PEQA 1YI2P 2M8LA 4XRQA 1BAJA 1M6EX 3CCJP 3CMEP 2PEJA 3CPWO 3G6EP 2OTJP 3CCQP 3E2DA 1Q81Q 3NTEA 2LF4A 3G1IA 2EFJA 1VQ4P 5F2OA 1EIAA 3CD6P 2PEMA 2CWOA 4U0CA 1NJIQ 1AUMA 2M8NA 1KC8Q 5HGOA 1ZMBA 2BHVA 2JYGA 3G71P 1YHQP 1S72P 5DCKA 3Q20A 2QA4P 3CCEP 1YIJP 5HGLA 3RG6C 4PH0A 2Z46A 4GR2A 2M8PA 3HYBA 1E6JP 1M90Q 4XFYA 4XROA 5F2KA 2JO0A 2E1MA 2EG5A 5I4TG 1A43A 1QVFO 1VQMP 3CC7P 2XV6A 1VQOP 4GR6A 1M1KQ 1Q86Q 4U0FA 3I56P 4XFXA 1N8RQ 2PEOA 3G26A 2Z44A 3DS5A 2ONTA 2XT1A 3CCVP 3B5IA 1JJ2O 1VQLP 3G21A 3G1GA 3CC2P 1VQ6P 1VQ9P 5HGMA 1Q7YQ 3CCLP 4IPYA 3CCRP 2Z45A 1K8AQ 3CCUP 2DGYA 3G0VA 1KQSO 5BS1A 2L6EA 1IUQA 3H47A 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEI A;  2PEM A;  3Q20 A;  2PY8 A;  2PEJ A;  2Z45 A;  2PEO A;  3RG6 C;  2PEN A;  2PEQ A;  2PEK A;  2Z44 A;  2Z46 A;  4GR2 A;  4GR6 A;  5BS2 A;  5BS1 A;  3HYB A; 
#chains in the Genus database with same CATH topology
 3GKL C;  2X2B A;  2JU2 A;  2FAC A;  4M0I A;  4U0A A;  4U0D A;  4PXH B;  4PH1 A;  2KG8 A;  2GYK A;  4MRT C;  3RG2 A;  3G29 A;  2P9X A;  4QNB A;  2FVF A;  1W2B O;  2GZJ A;  2KR5 A;  2AFE A;  2CNR A;  3WBH A;  1L0I A;  2NO8 A;  5HGN A;  2KWL A;  2JGP A;  2LIW A;  2CQ8 A;  3DS2 A;  2KG6 A;  2KGD A;  1KD1 Q;  2N6Y A;  5JPA A;  1GXG A;  4XRQ A;  2PEJ A;  4NEO A;  2M5R A;  1Q81 Q;  2KOO A;  5F2O A;  2JYG A;  2GZE A;  2LL8 A;  2L0Q A;  2K94 A;  4IZ6 A;  1IMQ A;  2E1M A;  1QVF O;  2XV6 A;  1VQO P;  3CE7 A;  2MVU A;  4U0F A;  2GDY A;  2XZ1 C;  1N8R Q;  1T8K A;  1Z6M A;  3DS5 A;  2VLQ A;  2EHS A;  1VQ6 P;  2WPT A;  3CCL P;  3CCR P;  2ROQ A;  2DGY A;  2FQ1 A;  2L6E A;  1IUQ A;  3DS4 A;  4XFZ A;  4QKO A;  3I55 P;  1VQK P;  3DS1 A;  2AVA A;  2LPK A;  2N6Z A;  2JBG A;  2LOL A;  2K5X A;  2QEX P;  5F2N A;  4PWV B;  2L4B A;  1NQ4 A;  3DPH A;  4WYM A;  2FVE A;  2OTL P;  2CG5 B;  2JQ4 A;  7CEI A;  4COP A;  1HQB A;  4H2W C;  3CCS P;  3P05 A;  1K73 Q;  1M6N A;  4COC A;  1EOQ A;  2K93 A;  3OW2 O;  3H4E A;  2FQ2 A;  1UJZ A;  2N5H A;  2JB0 A;  1RO2 A;  3CC4 P;  4F37 A;  2LIU A;  2JU1 A;  3DS3 A;  1VQ5 P;  3H0D A;  2MR8 A;  3G28 A;  2EHT A;  1YI2 P;  3NY7 B;  3G6E P;  1VHN A;  1X3O A;  2KOR A;  2VLO A;  3NTE A;  2LF4 A;  2K92 A;  2CGQ A;  2FAD A;  1ZMB A;  3B4Q A;  4HKG A;  3Q20 A;  2QA4 P;  3GZL A;  5HGL A;  1M90 Q;  4GR2 A;  1DNY A;  2KGE A;  2FQ0 A;  2N50 A;  5F2K A;  5I4T G;  3GZM A;  4GR6 A;  1Q86 Q;  2VSQ A;  1BXI A;  2PEO A;  3G26 A;  2GZI A;  2XT1 A;  3CC2 P;  2GDW A;  2QNW A;  2Z45 A;  5BS1 A;  1RO0 A;  2MF4 A;  3CCM P;  1VQ7 P;  1FR2 A;  4CA3 A;  2OAR A;  2MR7 A;  1QRJ A;  2PEI A;  1K30 A;  2L22 A;  2FHS C;  2KOD A;  1YJN P;  1E0H A;  1IMP A;  2AFD A;  1M74 A;  2GDX A;  5BS2 A;  1F80 D;  1AYI A;  1K9M Q;  1KLP A;  2KOS A;  2PEK A;  2JYL A;  1GXH A;  1QVG O;  3DTJ A;  1VQP P;  2N5I A;  3G4S P;  1RNI A;  3VRL C;  1Q82 Q;  1CEI A;  2LML A;  1ACP A;  1VQN P;  1GPJ A;  1A8O A;  2N98 A;  2PEQ A;  5HVC A;  1M6E X;  2KW2 A;  3CCQ P;  3GJN A;  2LTE A;  3E2D A;  1UNK A;  2JAZ A;  3G1I A;  2K2Q A;  1EIA A;  2MY5 A;  2M8N A;  1KC8 Q;  4H2Y C;  2L9F A;  1YHQ P;  1S72 P;  5DCK A;  5KP8 B;  3CCE P;  1YIJ P;  3EJD A;  3RG6 C;  4R0M A;  2Z46 A;  3HYB A;  2K0Y A;  4BPF A;  2JO0 A;  1A43 A;  1VQM P;  2KGC A;  4XFX A;  2KGA A;  2Z44 A;  1DV5 A;  3CCV P;  1JJ2 O;  1VQL P;  1OR5 A;  2LKI A;  3G21 A;  2VLN A;  4IPY A;  1K8A Q;  4DG9 A;  3CCU P;  1AF8 A;  4H2X C;  3H47 A;  2FVA A;  2PY8 A;  1L0H A;  3MGE A;  2XXM A;  1YIT P;  3CXC O;  4BPG A;  4U0B A;  5EW5 E;  2EIA A;  3DS0 A;  2GZG A;  1YJ9 P;  3CMA P;  2AF8 A;  2BUO A;  2K0D X;  3HZQ A;  1D1D A;  2PNG A;  4U0E A;  2PEN A;  5CZD B;  1VKU A;  3EJB A;  3EJE A;  3LRY A;  1YJW P;  5KP7 B;  4UHP B;  3M1M A;  4BPH A;  2VLP A;  1VQ8 P;  5EJD A;  2DNW A;  2K0X A;  2M8L A;  1BAJ A;  3CCJ P;  3CME P;  2ERH A;  3CPW O;  2OTJ P;  1EMV A;  2EFJ A;  1VQ4 P;  3CD6 P;  2PEM A;  2CWO A;  4U0C A;  1NJI Q;  1AUM A;  5HGO A;  2BHV A;  2FAE A;  2KOP A;  3G71 P;  2XZ0 D;  3LMO A;  2GZF A;  2MVV A;  5KP6 B;  4PH0 A;  1E6J P;  2M8P A;  4XFY A;  4XRO A;  2EG5 A;  5HV8 A;  1MZ8 A;  3CC7 P;  1M1K Q;  3I56 P;  1HY8 A;  2MD9 A;  2ONT A;  3B5I A;  3G1G A;  3U43 A;  1VQ9 P;  5HGM A;  1Q7Y Q;  2KG9 A;  3G0V A;  1KQS O;  1ZNV A;  2KOQ A; 
#chains in the Genus database with same CATH homology
 3I55 P;  1VQK P;  2PY8 A;  3DS1 A;  1RO0 A;  3MGE A;  3CCM P;  1VQ7 P;  2XXM A;  1YIT P;  3CXC O;  2QEX P;  4U0B A;  5F2N A;  2EIA A;  2OAR A;  3DS0 A;  3DS4 A;  1QRJ A;  2PEI A;  1YJ9 P;  4M0I A;  1K30 A;  3DPH A;  4U0A A;  4U0D A;  3CMA P;  2BUO A;  2KOD A;  4PH1 A;  4WYM A;  1YJN P;  3HZQ A;  3G29 A;  2P9X A;  2OTL P;  4QNB A;  1M74 A;  1D1D A;  4COP A;  5BS2 A;  3CCS P;  3P05 A;  4U0E A;  1W2B O;  1M6N A;  1K73 Q;  1K9M Q;  4COC A;  1EOQ A;  2PEN A;  2PEK A;  3OW2 O;  2JYL A;  3H4E A;  3WBH A;  1QVG O;  3DTJ A;  5HGN A;  1VQP P;  3G4S P;  1RO2 A;  3LRY A;  1YJW P;  1RNI A;  3VRL C;  1Q82 Q;  3M1M A;  3DS2 A;  3CC4 P;  1VQ8 P;  3DS3 A;  1VQ5 P;  3H0D A;  1KD1 Q;  5JPA A;  3G28 A;  1VQN P;  1A8O A;  2PEQ A;  1YI2 P;  2M8L A;  4XRQ A;  1BAJ A;  1M6E X;  3CCJ P;  3CME P;  2PEJ A;  3CPW O;  3G6E P;  2OTJ P;  3CCQ P;  3E2D A;  1Q81 Q;  3NTE A;  2LF4 A;  3G1I A;  2EFJ A;  1VQ4 P;  5F2O A;  1EIA A;  3CD6 P;  2PEM A;  2CWO A;  4U0C A;  1NJI Q;  1AUM A;  2M8N A;  1KC8 Q;  5HGO A;  1ZMB A;  2BHV A;  2JYG A;  3G71 P;  1YHQ P;  1S72 P;  5DCK A;  3Q20 A;  2QA4 P;  3CCE P;  1YIJ P;  5HGL A;  3RG6 C;  4PH0 A;  2Z46 A;  4GR2 A;  2M8P A;  3HYB A;  1E6J P;  1M90 Q;  4XFY A;  4XRO A;  5F2K A;  2JO0 A;  2E1M A;  2EG5 A;  5I4T G;  1A43 A;  1QVF O;  1VQM P;  3CC7 P;  2XV6 A;  1VQO P;  4GR6 A;  1M1K Q;  1Q86 Q;  4U0F A;  3I56 P;  4XFX A;  1N8R Q;  2PEO A;  3G26 A;  2Z44 A;  3DS5 A;  2ONT A;  2XT1 A;  3CCV P;  3B5I A;  1JJ2 O;  1VQL P;  3G21 A;  3G1G A;  3CC2 P;  1VQ6 P;  1VQ9 P;  5HGM A;  1Q7Y Q;  3CCL P;  4IPY A;  3CCR P;  2Z45 A;  1K8A Q;  3CCU P;  2DGY A;  3G0V A;  1KQS O;  5BS1 A;  2L6E A;  1IUQ A;  3H47 A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...