5BS2A

Crystal structure of rbcx-iia from chlamydomonas reinhardtii in complex with rbcl c-terminal tail
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
ASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRAAAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa
publication title Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Chaperone
total genus 45
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5bs2A00
2Z44A 4GR2A 2PY8A 2Z46A 2PEOA 2Z45A 4GR6A 5BS2A 3Q20A 3HYBA 3RG6C 2PEIA 5BS1A 2PEJA 2PENA 2PEQA 2PEMA 2PEKA
chains in the Genus database with same CATH superfamily
1ZNVA 4PH1A 4U0BA 3G0VA 3DS0A 3CXCO 2KGEA 2ONTA 1L0HA 2FHSC 2QEXP 1KD1Q 4F37A 3CMAP 3B4QA 1HY8A 2XZ0D 2K92A 1GPJA 1E0HA 3DS3A 2M8LA 1VQNP 3G6EP 3DTJA 3GKLC 1KQSO 5KP7B 3GJNA 2BUOA 2QNWA 2K94A 1RO0A 4XFXA 2KGDA 2K0XA 1X3OA 2BHVA 4XRQA 4GR2A 1RNIA 1HQBA 1A43A 3CMEP 2LF4A 2MR7A 2DNWA 3CCSP 2N5IA 3HZQA 1YITP 2AFEA 1M90Q 2L22A 1NQ4A 2AFDA 3DS1A 2FQ2A 1YIJP 1W2BO 2MVUA 2PNGA 2KW2A 1D1DA 4U0CA 3Q20A 5F2OA 5CZDB 3CCRP 2K0DX 1YJ9P 1QVFO 1Q7YQ 3E2DA 2KG6A 1VQLP 4UHPB 2GDWA 2QA4P 2KOPA 1QRJA 2L9FA 3P05A 1Z6MA 3H0DA 3U43A 5F2NA 2LTEA 2VLOA 3NY7B 5F2KA 2GZFA 4U0FA 2Z45A 5BS2A 1M6NA 4U0EA 2K0YA 3EJDA 3M1MA 1UJZA 2GZIA 4HKGA 2AF8A 1OR5A 2EHSA 1KLPA 4IZ6A 2KWLA 1YJWP 3G71P 1VQ6P 3H4EA 5BS1A 1S72P 3CC2P 2X2BA 1VQ9P 2JO0A 1VQPP 5KP6B 3VRLC 4WYMA 1VQKP 3CC4P 1UNKA 2M8NA 2LIUA 1YI2P 2ROQA 2CQ8A 1A8OA 1AYIA 1K8AQ 2CG5B 2GZEA 1IMPA 3CCMP 2GZGA 1GXGA 1Q81Q 2DGYA 2N6YA 3MGEA 2PEOA 2LMLA 3NTEA 2PEMA 3HYBA 2FVAA 1CEIA 1Q82Q 2PEIA 3LMOA 1VHNA 3OW2O 2VSQA 1VQ5P 2K93A 4M0IA 2JGPA 3G1GA 2LL8A 4PXHB 3H47A 2OTLP 1ZMBA 1BAJA 3B5IA 2GDYA 2OARA 1AF8A 5HVCA 1AUMA 1QVGO 4XFZA 4CA3A 4QKOA 2KG8A 1NJIQ 4GR6A 2CNRA 2LOLA 1YHQP 2JAZA 5EJDA 3WBHA 2M5RA 2NO8A 4PH0A 2KOQA 2XV6A 1IUQA 2KG9A 2XT1A 3LRYA 2OTJP 1ACPA 1DV5A 2PEKA 1IMQA 2N6ZA 1F80D 2XXMA 1K30A 2K5XA 1VQ7P 2XZ1C 2L4BA 2PY8A 1VKUA 2CWOA 2EG5A 3G28A 2N5HA 2EHTA 4H2YC 1VQ8P 2CGQA 1DNYA 4BPHA 5EW5E 5KP8B 3CCVP 3G21A 2LPKA 2FQ1A 1EIAA 5HGNA 5I4TG 4DG9A 1EOQA 3RG2A 2LKIA 2KODA 3I56P 3CCJP 2MR8A 2KORA 1T8KA 1L0IA 2KOSA 3CE7A 3GZMA 1YJNP 4COPA 2JYGA 4PWVB 2JU2A 2JB0A 2FADA 3DS5A 2GYKA 2LIWA 2GZJA 2N98A 3RG6C 2EFJA 2KGCA 1EMVA 2JQ4A 5DCKA 1VQOP 1GXHA 3CCQP 2JYLA 4R0MA 2JU1A 2MF4A 5JPAA 4XFYA 4H2XC 2P9XA 1K9MQ 2N50A 2FAEA 4BPFA 2M8PA 2FQ0A 2E1MA 3CPWO 3CCLP 2PEQA 1K73Q 5HGLA 2Z46A 2K2QA 2KGAA 2VLNA 4QNBA 3CCEP 4COCA 3CC7P 1RO2A 2L6EA 2Z44A 2JBGA 4IPYA 3DS2A 2FACA 2VLPA 1BXIA 2WPTA 4H2WC 1VQMP 4U0DA 2MVVA 3EJBA 2FVEA 2L0QA 2PEJA 4NEOA 4MRTC 4U0AA 3G26A 3I55P 3G1IA 3G29A 3CD6P 3DS4A 5HV8A 1M74A 1Q86Q 1JJ2O 2VLQA 2KOOA 2PENA 3DPHA 2EIAA 1VQ4P 1FR2A 1M6EX 3CCUP 1E6JP 2AVAA 1KC8Q 3GZLA 2ERHA 2MD9A 2GDXA 1N8RQ 3EJEA 2FVFA 1MZ8A 5HGOA 7CEIA 5HGMA 4BPGA 4XROA 2MY5A 3G4SP 2KR5A 1M1KQ
chains in the Genus database with same CATH topology
4GR6A 5F2KA 5JPAA 4PH1A 4U0BA 4XFYA 1YHQP 2P9XA 3G0VA 3DS0A 3WBHA 1K9MQ 4U0FA 2Z45A 5BS2A 3CXCO 1M6NA 2M8PA 4U0EA 2ONTA 2E1MA 3M1MA 4PH0A 2PEQA 3CPWO 2XV6A 1K73Q 3CCLP 1IUQA 5HGLA 2Z46A 2XT1A 3LRYA 2QEXP 2OTJP 1KD1Q 3CMAP 1YJWP 2PEKA 3G71P 1VQ6P 4QNBA 3CCEP 4COCA 3CC7P 3H4EA 5BS1A 1S72P 3CC2P 3DS3A 1VQ9P 2JO0A 2XXMA 1VQPP 3VRLC 1RO2A 2L6EA 4WYMA 2M8LA 2Z44A 1VQNP 1K30A 4IPYA 3G6EP 1VQKP 3DS2A 3DTJA 3CC4P 1VQ7P 1KQSO 1VQMP 2PY8A 2M8NA 4U0DA 2BUOA 2CWOA 2EG5A 1YI2P 3G28A 1RO0A 4XFXA 1A8OA 1K8AQ 2BHVA 2PEJA 4XRQA 1VQ8P 4GR2A 1RNIA 4U0AA 3G26A 3I55P 3CCVP 1A43A 3CMEP 2LF4A 3G21A 3G1IA 3CCMP 3G29A 3CD6P 3DS4A 1EIAA 1M74A 5HGNA 5I4TG 1Q81Q 2DGYA 3CCSP 1EOQA 1Q86Q 3HZQA 3MGEA 2KODA 1YITP 2PEOA 3I56P 1JJ2O 3CCJP 1M90Q 2PENA 3DPHA 2PEMA 2EIAA 3DS1A 3HYBA 3NTEA 1YIJP 1W2BO 1Q82Q 1VQ4P 1YJNP 2PEIA 4COPA 1D1DA 1M6EX 3OW2O 4U0CA 3Q20A 5F2OA 1VQ5P 3CCUP 1E6JP 2JYGA 4M0IA 3CCRP 3G1GA 1YJ9P 1KC8Q 3H47A 1QVFO 2OTLP 1ZMBA 3DS5A 1BAJA 3B5IA 1Q7YQ 2OARA 1N8RQ 3E2DA 1VQLP 3RG6C 2EFJA 2QA4P 5HGOA 1AUMA 5DCKA 1VQOP 1QVGO 4XFZA 1QRJA 5HGMA 3P05A 4XROA 3CCQP 2JYLA 3H0DA 3G4SP 1NJIQ 1M1KQ 5F2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z44 A;  4GR2 A;  2PY8 A;  2Z46 A;  2PEO A;  2Z45 A;  4GR6 A;  5BS2 A;  3Q20 A;  3HYB A;  3RG6 C;  2PEI A;  5BS1 A;  2PEJ A;  2PEN A;  2PEQ A;  2PEM A;  2PEK A; 
#chains in the Genus database with same CATH topology
 1ZNV A;  4PH1 A;  4U0B A;  3G0V A;  3DS0 A;  3CXC O;  2KGE A;  2ONT A;  1L0H A;  2FHS C;  2QEX P;  1KD1 Q;  4F37 A;  3CMA P;  3B4Q A;  1HY8 A;  2XZ0 D;  2K92 A;  1GPJ A;  1E0H A;  3DS3 A;  2M8L A;  1VQN P;  3G6E P;  3DTJ A;  3GKL C;  1KQS O;  5KP7 B;  3GJN A;  2BUO A;  2QNW A;  2K94 A;  1RO0 A;  4XFX A;  2KGD A;  2K0X A;  1X3O A;  2BHV A;  4XRQ A;  4GR2 A;  1RNI A;  1HQB A;  1A43 A;  3CME P;  2LF4 A;  2MR7 A;  2DNW A;  3CCS P;  2N5I A;  3HZQ A;  1YIT P;  2AFE A;  1M90 Q;  2L22 A;  1NQ4 A;  2AFD A;  3DS1 A;  2FQ2 A;  1YIJ P;  1W2B O;  2MVU A;  2PNG A;  2KW2 A;  1D1D A;  4U0C A;  3Q20 A;  5F2O A;  5CZD B;  3CCR P;  2K0D X;  1YJ9 P;  1QVF O;  1Q7Y Q;  3E2D A;  2KG6 A;  1VQL P;  4UHP B;  2GDW A;  2QA4 P;  2KOP A;  1QRJ A;  2L9F A;  3P05 A;  1Z6M A;  3H0D A;  3U43 A;  5F2N A;  2LTE A;  2VLO A;  3NY7 B;  5F2K A;  2GZF A;  4U0F A;  2Z45 A;  5BS2 A;  1M6N A;  4U0E A;  2K0Y A;  3EJD A;  3M1M A;  1UJZ A;  2GZI A;  4HKG A;  2AF8 A;  1OR5 A;  2EHS A;  1KLP A;  4IZ6 A;  2KWL A;  1YJW P;  3G71 P;  1VQ6 P;  3H4E A;  5BS1 A;  1S72 P;  3CC2 P;  2X2B A;  1VQ9 P;  2JO0 A;  1VQP P;  5KP6 B;  3VRL C;  4WYM A;  1VQK P;  3CC4 P;  1UNK A;  2M8N A;  2LIU A;  1YI2 P;  2ROQ A;  2CQ8 A;  1A8O A;  1AYI A;  1K8A Q;  2CG5 B;  2GZE A;  1IMP A;  3CCM P;  2GZG A;  1GXG A;  1Q81 Q;  2DGY A;  2N6Y A;  3MGE A;  2PEO A;  2LML A;  3NTE A;  2PEM A;  3HYB A;  2FVA A;  1CEI A;  1Q82 Q;  2PEI A;  3LMO A;  1VHN A;  3OW2 O;  2VSQ A;  1VQ5 P;  2K93 A;  4M0I A;  2JGP A;  3G1G A;  2LL8 A;  4PXH B;  3H47 A;  2OTL P;  1ZMB A;  1BAJ A;  3B5I A;  2GDY A;  2OAR A;  1AF8 A;  5HVC A;  1AUM A;  1QVG O;  4XFZ A;  4CA3 A;  4QKO A;  2KG8 A;  1NJI Q;  4GR6 A;  2CNR A;  2LOL A;  1YHQ P;  2JAZ A;  5EJD A;  3WBH A;  2M5R A;  2NO8 A;  4PH0 A;  2KOQ A;  2XV6 A;  1IUQ A;  2KG9 A;  2XT1 A;  3LRY A;  2OTJ P;  1ACP A;  1DV5 A;  2PEK A;  1IMQ A;  2N6Z A;  1F80 D;  2XXM A;  1K30 A;  2K5X A;  1VQ7 P;  2XZ1 C;  2L4B A;  2PY8 A;  1VKU A;  2CWO A;  2EG5 A;  3G28 A;  2N5H A;  2EHT A;  4H2Y C;  1VQ8 P;  2CGQ A;  1DNY A;  4BPH A;  5EW5 E;  5KP8 B;  3CCV P;  3G21 A;  2LPK A;  2FQ1 A;  1EIA A;  5HGN A;  5I4T G;  4DG9 A;  1EOQ A;  3RG2 A;  2LKI A;  2KOD A;  3I56 P;  3CCJ P;  2MR8 A;  2KOR A;  1T8K A;  1L0I A;  2KOS A;  3CE7 A;  3GZM A;  1YJN P;  4COP A;  2JYG A;  4PWV B;  2JU2 A;  2JB0 A;  2FAD A;  3DS5 A;  2GYK A;  2LIW A;  2GZJ A;  2N98 A;  3RG6 C;  2EFJ A;  2KGC A;  1EMV A;  2JQ4 A;  5DCK A;  1VQO P;  1GXH A;  3CCQ P;  2JYL A;  4R0M A;  2JU1 A;  2MF4 A;  5JPA A;  4XFY A;  4H2X C;  2P9X A;  1K9M Q;  2N50 A;  2FAE A;  4BPF A;  2M8P A;  2FQ0 A;  2E1M A;  3CPW O;  3CCL P;  2PEQ A;  1K73 Q;  5HGL A;  2Z46 A;  2K2Q A;  2KGA A;  2VLN A;  4QNB A;  3CCE P;  4COC A;  3CC7 P;  1RO2 A;  2L6E A;  2Z44 A;  2JBG A;  4IPY A;  3DS2 A;  2FAC A;  2VLP A;  1BXI A;  2WPT A;  4H2W C;  1VQM P;  4U0D A;  2MVV A;  3EJB A;  2FVE A;  2L0Q A;  2PEJ A;  4NEO A;  4MRT C;  4U0A A;  3G26 A;  3I55 P;  3G1I A;  3G29 A;  3CD6 P;  3DS4 A;  5HV8 A;  1M74 A;  1Q86 Q;  1JJ2 O;  2VLQ A;  2KOO A;  2PEN A;  3DPH A;  2EIA A;  1VQ4 P;  1FR2 A;  1M6E X;  3CCU P;  1E6J P;  2AVA A;  1KC8 Q;  3GZL A;  2ERH A;  2MD9 A;  2GDX A;  1N8R Q;  3EJE A;  2FVF A;  1MZ8 A;  5HGO A;  7CEI A;  5HGM A;  4BPG A;  4XRO A;  2MY5 A;  3G4S P;  2KR5 A;  1M1K Q; 
#chains in the Genus database with same CATH homology
 4GR6 A;  5F2K A;  5JPA A;  4PH1 A;  4U0B A;  4XFY A;  1YHQ P;  2P9X A;  3G0V A;  3DS0 A;  3WBH A;  1K9M Q;  4U0F A;  2Z45 A;  5BS2 A;  3CXC O;  1M6N A;  2M8P A;  4U0E A;  2ONT A;  2E1M A;  3M1M A;  4PH0 A;  2PEQ A;  3CPW O;  2XV6 A;  1K73 Q;  3CCL P;  1IUQ A;  5HGL A;  2Z46 A;  2XT1 A;  3LRY A;  2QEX P;  2OTJ P;  1KD1 Q;  3CMA P;  1YJW P;  2PEK A;  3G71 P;  1VQ6 P;  4QNB A;  3CCE P;  4COC A;  3CC7 P;  3H4E A;  5BS1 A;  1S72 P;  3CC2 P;  3DS3 A;  1VQ9 P;  2JO0 A;  2XXM A;  1VQP P;  3VRL C;  1RO2 A;  2L6E A;  4WYM A;  2M8L A;  2Z44 A;  1VQN P;  1K30 A;  4IPY A;  3G6E P;  1VQK P;  3DS2 A;  3DTJ A;  3CC4 P;  1VQ7 P;  1KQS O;  1VQM P;  2PY8 A;  2M8N A;  4U0D A;  2BUO A;  2CWO A;  2EG5 A;  1YI2 P;  3G28 A;  1RO0 A;  4XFX A;  1A8O A;  1K8A Q;  2BHV A;  2PEJ A;  4XRQ A;  1VQ8 P;  4GR2 A;  1RNI A;  4U0A A;  3G26 A;  3I55 P;  3CCV P;  1A43 A;  3CME P;  2LF4 A;  3G21 A;  3G1I A;  3CCM P;  3G29 A;  3CD6 P;  3DS4 A;  1EIA A;  1M74 A;  5HGN A;  5I4T G;  1Q81 Q;  2DGY A;  3CCS P;  1EOQ A;  1Q86 Q;  3HZQ A;  3MGE A;  2KOD A;  1YIT P;  2PEO A;  3I56 P;  1JJ2 O;  3CCJ P;  1M90 Q;  2PEN A;  3DPH A;  2PEM A;  2EIA A;  3DS1 A;  3HYB A;  3NTE A;  1YIJ P;  1W2B O;  1Q82 Q;  1VQ4 P;  1YJN P;  2PEI A;  4COP A;  1D1D A;  1M6E X;  3OW2 O;  4U0C A;  3Q20 A;  5F2O A;  1VQ5 P;  3CCU P;  1E6J P;  2JYG A;  4M0I A;  3CCR P;  3G1G A;  1YJ9 P;  1KC8 Q;  3H47 A;  1QVF O;  2OTL P;  1ZMB A;  3DS5 A;  1BAJ A;  3B5I A;  1Q7Y Q;  2OAR A;  1N8R Q;  3E2D A;  1VQL P;  3RG6 C;  2EFJ A;  2QA4 P;  5HGO A;  1AUM A;  5DCK A;  1VQO P;  1QVG O;  4XFZ A;  1QRJ A;  5HGM A;  3P05 A;  4XRO A;  3CCQ P;  2JYL A;  3H0D A;  3G4S P;  1NJI Q;  1M1K Q;  5F2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...