5BS2A

Crystal structure of rbcx-iia from chlamydomonas reinhardtii in complex with rbcl c-terminal tail
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
113
structure length
113
Chain Sequence
b'ASPERKAAVALRSLFTFVAARVVLEQLQGPGGPETTYNQQAYLDLMDFLGTPMKGDGGDEWMAAVMRKNHALALRLMEVREAYLDEFEWGKTMEMASRETREANTRLMRAAAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase large chain,CrRbcX-IIa
publication title Structural Analysis of the Rubisco-Assembly Chaperone RbcX-II from Chlamydomonas reinhardtii.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Chaperone
total genus 45
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 4.1.1.39: Ribulose-bisphosphate carboxylase.
pdb deposition date 2015-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5bs2A00
2PEOA 4GR6A 2PEJA 2Z44A 5BS1A 2PEQA 2PENA 3HYBA 4GR2A 2PEMA 2PY8A 2PEKA 3Q20A 5BS2A 2PEIA 3RG6C 2Z46A 2Z45A
chains in the Genus database with same CATH superfamily
3I55P 4XFZA 2K0DX 2JQ4A 2PY8A 2L9FA 2XZ1C 3G1IA 1DV5A 2FQ0A 5F2KA 3H47A 2AFDA 2MR7A 2KW2A 5BS1A 4XFYA 1VKUA 2FVFA 1RO2A 2M5RA 2L4BA 2Z44A 1Q7YQ 4F37A 2ERHA 3B4QA 4UHPB 1IUQA 2X2BA 1YI2P 5DCKA 5JPAA 4U0AA 3OW2O 2OTJP 3G26A 2Z45A 3G71P 2EG5A 1AYIA 2ROQA 5KP8B 2KOOA 2N98A 1VQPP 2GDWA 4H2WC 2VSQA 2K94A 2JU1A 1K73Q 2K93A 3NTEA 2JU2A 1KC8Q 2AVAA 4WYMA 1RNIA 3CCQP 2CG5B 2FACA 4COPA 2PEIA 2KGAA 1M74A 2FQ2A 3CPWO 2EIAA 5HGNA 2KOSA 1YIJP 2M8PA 2XV6A 3CC2P 5CZDB 1VQLP 2AF8A 2MVUA 2K2QA 2DGYA 2EHSA 2QA4P 2K0XA 2MF4A 1YJNP 4NEOA 3G28A 1M6NA 1F80D 2N6YA 1HY8A 1VHNA 1DNYA 2CGQA 2LL8A 2K5XA 3LRYA 3GJNA 2GYKA 1E6JP 2QEXP 4M0IA 3E2DA 5EJDA 1L0HA 1ZNVA 1YHQP 3GZLA 1VQ8P 3EJBA 1EMVA 3CCRP 3DTJA 1D1DA 3LMOA 1Z6MA 4U0EA 3CMAP 1OR5A 2N6ZA 4QNBA 2WPTA 3P05A 2FVAA 2LTEA 2MR8A 4HKGA 1Q82Q 2KGDA 1K30A 2FADA 1YJWP 3EJDA 1KD1Q 3G29A 3DPHA 1CEIA 3G0VA 5F2NA 2MVVA 1VQ7P 3G21A 2GDXA 3CCEP 2ONTA 1VQ5P 4GR6A 4U0BA 4MRTC 1X3OA 1YJ9P 2CQ8A 1VQMP 2EHTA 2XXMA 1M1KQ 2K0YA 4H2XC 2L22A 4PXHB 2FQ1A 3CCJP 4XFXA 2BHVA 2FVEA 3DS1A 3G1GA 3CCLP 5HGLA 1EIAA 2N5IA 3CE7A 1M6EX 4DG9A 2E1MA 3G6EP 3HYBA 2GZIA 2GZEA 3DS3A 2LIWA 2KODA 4BPHA 5F2OA 4U0CA 3RG2A 4R0MA 2JYGA 3RG6C 1E0HA 1EOQA 1GPJA 3DS5A 2PEMA 3CCUP 1JJ2O 2GDYA 2LMLA 5HGOA 1L0IA 2CWOA 2L6EA 4COCA 2KG6A 4PH0A 2PNGA 1IMPA 1W2BO 2KOQA 2EFJA 1KLPA 5HGMA 2FAEA 2LKIA 3CXCO 2JYLA 1K9MQ 5HV8A 2GZJA 4BPGA 2KG8A 2JB0A 2DNWA 1BAJA 4XROA 1QVGO 2LIUA 3I56P 3GKLC 2NO8A 1Q81Q 1ACPA 3M1MA 4BPFA 1QVFO 4IZ6A 3H4EA 3HZQA 1AUMA 4PWVB 1HQBA 1UJZA 2N50A 2K92A 3DS4A 1QRJA 3B5IA 1K8AQ 3NY7B 3DS0A 2BUOA 2QNWA 2Z46A 1ZMBA 2GZFA 5EW5E 3U43A 1A8OA 1UNKA 2OARA 3CCMP 4CA3A 2OTLP 2KG9A 2KOPA 1VQ9P 1RO0A 2MD9A 3DS2A 2GZGA 2KORA 3CCVP 3GZMA 2M8LA 2JAZA 1T8KA 5KP7B 4H2YC 3H0DA 2KGEA 3CC7P 2VLNA 2PEJA 3MGEA 2CNRA 5I4TG 1FR2A 2JGPA 1AF8A 3CC4P 4QKOA 2PEOA 2AFEA 2XT1A 4XRQA 5BS2A 1S72P 1VQ4P 3G4SP 1N8RQ 1BXIA 2KWLA 4PH1A 2JO0A 2MY5A 2PEQA 2PENA 1VQKP 4IPYA 1VQNP 2N5HA 5HVCA 2VLPA 2LOLA 2PEKA 2L0QA 1GXHA 3CD6P 2VLQA 1VQ6P 3CMEP 2KR5A 1VQOP 1Q86Q 2LF4A 4U0DA 1KQSO 3EJEA 3VRLC 3WBHA 1NJIQ 5KP6B 1M90Q 1GXGA 2JBGA 2KGCA 1YITP 3CCSP 2LPKA 1MZ8A 1IMQA 4GR2A 2M8NA 7CEIA 3Q20A 1A43A 1NQ4A 2P9XA 4U0FA 2FHSC 2VLOA 2XZ0D
chains in the Genus database with same CATH topology
1VQ9P 3I55P 1RO0A 4XFZA 3DS2A 2PY8A 3G1IA 3CCVP 2M8LA 1M6EX 2E1MA 3G6EP 3HYBA 5F2KA 3DS3A 3H47A 3H0DA 2KODA 5F2OA 4U0CA 5BS1A 3CC7P 2JYGA 3LRYA 4XFYA 2PEJA 3MGEA 5I4TG 1E6JP 2QEXP 4M0IA 1RO2A 3E2DA 3CC4P 3RG6C 2PEOA 2Z44A 1EOQA 3DS5A 1YHQP 2PEMA 3CCUP 1Q7YQ 1JJ2O 1VQ8P 5HGOA 3CCRP 2XT1A 3DTJA 4XRQA 2CWOA 2L6EA 4COCA 1IUQA 1YI2P 5DCKA 4PH0A 5JPAA 5BS2A 1W2BO 4U0AA 3OW2O 2OTJP 3G26A 2Z45A 1S72P 1VQ4P 3G71P 2EG5A 2EFJA 3G4SP 1N8RQ 5HGMA 3CXCO 4U0EA 2JYLA 3CMAP 1K9MQ 4PH1A 2JO0A 2PEQA 2PENA 4QNBA 3P05A 1VQPP 1VQKP 4IPYA 1BAJA 1Q82Q 4XROA 1K30A 1VQNP 1QVGO 1YJWP 3I56P 1K73Q 1KD1Q 1Q81Q 3G29A 3DPHA 3M1MA 3G0VA 5F2NA 1QVFO 3NTEA 2PEKA 1KC8Q 4WYMA 1RNIA 3H4EA 3CD6P 1VQ7P 3CCQP 3HZQA 1VQ6P 1D1DA 1AUMA 3CMEP 1VQOP 3G21A 2LF4A 4COPA 2PEIA 2ONTA 4U0DA 1VQ5P 4GR6A 1Q86Q 4U0BA 3CCEP 1M74A 1YJ9P 1KQSO 3VRLC 3CPWO 1VQMP 3DS4A 2EIAA 3WBHA 2XXMA 1NJIQ 5HGNA 1M1KQ 1M90Q 1QRJA 1YIJP 2M8PA 2XV6A 3B5IA 1K8AQ 3CC2P 3DS0A 2BUOA 1YITP 3CCSP 2Z46A 1VQLP 1ZMBA 3CCJP 4XFXA 4GR2A 2M8NA 3Q20A 1A43A 2BHVA 3DS1A 1A8OA 2P9XA 4U0FA 3G1GA 2DGYA 3CCLP 2QA4P 2OARA 5HGLA 1EIAA 3CCMP 2OTLP 1YJNP 3G28A 1M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEO A;  4GR6 A;  2PEJ A;  2Z44 A;  5BS1 A;  2PEQ A;  2PEN A;  3HYB A;  4GR2 A;  2PEM A;  2PY8 A;  2PEK A;  3Q20 A;  5BS2 A;  2PEI A;  3RG6 C;  2Z46 A;  2Z45 A; 
#chains in the Genus database with same CATH topology
 3I55 P;  4XFZ A;  2K0D X;  2JQ4 A;  2PY8 A;  2L9F A;  2XZ1 C;  3G1I A;  1DV5 A;  2FQ0 A;  5F2K A;  3H47 A;  2AFD A;  2MR7 A;  2KW2 A;  5BS1 A;  4XFY A;  1VKU A;  2FVF A;  1RO2 A;  2M5R A;  2L4B A;  2Z44 A;  1Q7Y Q;  4F37 A;  2ERH A;  3B4Q A;  4UHP B;  1IUQ A;  2X2B A;  1YI2 P;  5DCK A;  5JPA A;  4U0A A;  3OW2 O;  2OTJ P;  3G26 A;  2Z45 A;  3G71 P;  2EG5 A;  1AYI A;  2ROQ A;  5KP8 B;  2KOO A;  2N98 A;  1VQP P;  2GDW A;  4H2W C;  2VSQ A;  2K94 A;  2JU1 A;  1K73 Q;  2K93 A;  3NTE A;  2JU2 A;  1KC8 Q;  2AVA A;  4WYM A;  1RNI A;  3CCQ P;  2CG5 B;  2FAC A;  4COP A;  2PEI A;  2KGA A;  1M74 A;  2FQ2 A;  3CPW O;  2EIA A;  5HGN A;  2KOS A;  1YIJ P;  2M8P A;  2XV6 A;  3CC2 P;  5CZD B;  1VQL P;  2AF8 A;  2MVU A;  2K2Q A;  2DGY A;  2EHS A;  2QA4 P;  2K0X A;  2MF4 A;  1YJN P;  4NEO A;  3G28 A;  1M6N A;  1F80 D;  2N6Y A;  1HY8 A;  1VHN A;  1DNY A;  2CGQ A;  2LL8 A;  2K5X A;  3LRY A;  3GJN A;  2GYK A;  1E6J P;  2QEX P;  4M0I A;  3E2D A;  5EJD A;  1L0H A;  1ZNV A;  1YHQ P;  3GZL A;  1VQ8 P;  3EJB A;  1EMV A;  3CCR P;  3DTJ A;  1D1D A;  3LMO A;  1Z6M A;  4U0E A;  3CMA P;  1OR5 A;  2N6Z A;  4QNB A;  2WPT A;  3P05 A;  2FVA A;  2LTE A;  2MR8 A;  4HKG A;  1Q82 Q;  2KGD A;  1K30 A;  2FAD A;  1YJW P;  3EJD A;  1KD1 Q;  3G29 A;  3DPH A;  1CEI A;  3G0V A;  5F2N A;  2MVV A;  1VQ7 P;  3G21 A;  2GDX A;  3CCE P;  2ONT A;  1VQ5 P;  4GR6 A;  4U0B A;  4MRT C;  1X3O A;  1YJ9 P;  2CQ8 A;  1VQM P;  2EHT A;  2XXM A;  1M1K Q;  2K0Y A;  4H2X C;  2L22 A;  4PXH B;  2FQ1 A;  3CCJ P;  4XFX A;  2BHV A;  2FVE A;  3DS1 A;  3G1G A;  3CCL P;  5HGL A;  1EIA A;  2N5I A;  3CE7 A;  1M6E X;  4DG9 A;  2E1M A;  3G6E P;  3HYB A;  2GZI A;  2GZE A;  3DS3 A;  2LIW A;  2KOD A;  4BPH A;  5F2O A;  4U0C A;  3RG2 A;  4R0M A;  2JYG A;  3RG6 C;  1E0H A;  1EOQ A;  1GPJ A;  3DS5 A;  2PEM A;  3CCU P;  1JJ2 O;  2GDY A;  2LML A;  5HGO A;  1L0I A;  2CWO A;  2L6E A;  4COC A;  2KG6 A;  4PH0 A;  2PNG A;  1IMP A;  1W2B O;  2KOQ A;  2EFJ A;  1KLP A;  5HGM A;  2FAE A;  2LKI A;  3CXC O;  2JYL A;  1K9M Q;  5HV8 A;  2GZJ A;  4BPG A;  2KG8 A;  2JB0 A;  2DNW A;  1BAJ A;  4XRO A;  1QVG O;  2LIU A;  3I56 P;  3GKL C;  2NO8 A;  1Q81 Q;  1ACP A;  3M1M A;  4BPF A;  1QVF O;  4IZ6 A;  3H4E A;  3HZQ A;  1AUM A;  4PWV B;  1HQB A;  1UJZ A;  2N50 A;  2K92 A;  3DS4 A;  1QRJ A;  3B5I A;  1K8A Q;  3NY7 B;  3DS0 A;  2BUO A;  2QNW A;  2Z46 A;  1ZMB A;  2GZF A;  5EW5 E;  3U43 A;  1A8O A;  1UNK A;  2OAR A;  3CCM P;  4CA3 A;  2OTL P;  2KG9 A;  2KOP A;  1VQ9 P;  1RO0 A;  2MD9 A;  3DS2 A;  2GZG A;  2KOR A;  3CCV P;  3GZM A;  2M8L A;  2JAZ A;  1T8K A;  5KP7 B;  4H2Y C;  3H0D A;  2KGE A;  3CC7 P;  2VLN A;  2PEJ A;  3MGE A;  2CNR A;  5I4T G;  1FR2 A;  2JGP A;  1AF8 A;  3CC4 P;  4QKO A;  2PEO A;  2AFE A;  2XT1 A;  4XRQ A;  5BS2 A;  1S72 P;  1VQ4 P;  3G4S P;  1N8R Q;  1BXI A;  2KWL A;  4PH1 A;  2JO0 A;  2MY5 A;  2PEQ A;  2PEN A;  1VQK P;  4IPY A;  1VQN P;  2N5H A;  5HVC A;  2VLP A;  2LOL A;  2PEK A;  2L0Q A;  1GXH A;  3CD6 P;  2VLQ A;  1VQ6 P;  3CME P;  2KR5 A;  1VQO P;  1Q86 Q;  2LF4 A;  4U0D A;  1KQS O;  3EJE A;  3VRL C;  3WBH A;  1NJI Q;  5KP6 B;  1M90 Q;  1GXG A;  2JBG A;  2KGC A;  1YIT P;  3CCS P;  2LPK A;  1MZ8 A;  1IMQ A;  4GR2 A;  2M8N A;  7CEI A;  3Q20 A;  1A43 A;  1NQ4 A;  2P9X A;  4U0F A;  2FHS C;  2VLO A;  2XZ0 D; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  3I55 P;  1RO0 A;  4XFZ A;  3DS2 A;  2PY8 A;  3G1I A;  3CCV P;  2M8L A;  1M6E X;  2E1M A;  3G6E P;  3HYB A;  5F2K A;  3DS3 A;  3H47 A;  3H0D A;  2KOD A;  5F2O A;  4U0C A;  5BS1 A;  3CC7 P;  2JYG A;  3LRY A;  4XFY A;  2PEJ A;  3MGE A;  5I4T G;  1E6J P;  2QEX P;  4M0I A;  1RO2 A;  3E2D A;  3CC4 P;  3RG6 C;  2PEO A;  2Z44 A;  1EOQ A;  3DS5 A;  1YHQ P;  2PEM A;  3CCU P;  1Q7Y Q;  1JJ2 O;  1VQ8 P;  5HGO A;  3CCR P;  2XT1 A;  3DTJ A;  4XRQ A;  2CWO A;  2L6E A;  4COC A;  1IUQ A;  1YI2 P;  5DCK A;  4PH0 A;  5JPA A;  5BS2 A;  1W2B O;  4U0A A;  3OW2 O;  2OTJ P;  3G26 A;  2Z45 A;  1S72 P;  1VQ4 P;  3G71 P;  2EG5 A;  2EFJ A;  3G4S P;  1N8R Q;  5HGM A;  3CXC O;  4U0E A;  2JYL A;  3CMA P;  1K9M Q;  4PH1 A;  2JO0 A;  2PEQ A;  2PEN A;  4QNB A;  3P05 A;  1VQP P;  1VQK P;  4IPY A;  1BAJ A;  1Q82 Q;  4XRO A;  1K30 A;  1VQN P;  1QVG O;  1YJW P;  3I56 P;  1K73 Q;  1KD1 Q;  1Q81 Q;  3G29 A;  3DPH A;  3M1M A;  3G0V A;  5F2N A;  1QVF O;  3NTE A;  2PEK A;  1KC8 Q;  4WYM A;  1RNI A;  3H4E A;  3CD6 P;  1VQ7 P;  3CCQ P;  3HZQ A;  1VQ6 P;  1D1D A;  1AUM A;  3CME P;  1VQO P;  3G21 A;  2LF4 A;  4COP A;  2PEI A;  2ONT A;  4U0D A;  1VQ5 P;  4GR6 A;  1Q86 Q;  4U0B A;  3CCE P;  1M74 A;  1YJ9 P;  1KQS O;  3VRL C;  3CPW O;  1VQM P;  3DS4 A;  2EIA A;  3WBH A;  2XXM A;  1NJI Q;  5HGN A;  1M1K Q;  1M90 Q;  1QRJ A;  1YIJ P;  2M8P A;  2XV6 A;  3B5I A;  1K8A Q;  3CC2 P;  3DS0 A;  2BUO A;  1YIT P;  3CCS P;  2Z46 A;  1VQL P;  1ZMB A;  3CCJ P;  4XFX A;  4GR2 A;  2M8N A;  3Q20 A;  1A43 A;  2BHV A;  3DS1 A;  1A8O A;  2P9X A;  4U0F A;  3G1G A;  2DGY A;  3CCL P;  2QA4 P;  2OAR A;  5HGL A;  1EIA A;  3CCM P;  2OTL P;  1YJN P;  3G28 A;  1M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...